Dictionary
213 Pages

Dictionary

Course Number: CS 2420, Fall 2008

College/University: Utah State

Word Count: 12540

Rating:

Document Preview

Sorry, a summary is not available for this document. Register and Upgrade to Premier to view the entire document.

Unformatted Document Excerpt
Coursehero >> Utah >> Utah State >> CS 2420

Course Hero has millions of student submitted documents similar to the one
below including study guides, practice problems, reference materials, practice exams, textbook help and tutor support.

Course Hero has millions of student submitted documents similar to the one below including study guides, practice problems, reference materials, practice exams, textbook help and tutor support.

a aardvark aardvarks abandon abandoned abandoning abandons abbreviate abbreviated abbreviates abbreviating abbreviation abbreviations abide abilities ability abilitys able abnormal abnormally abolish abolished abolishes abolishing abolition abolitions abort aborted aborting abortion abortions aborts about above abroad absence absences absent absolute absolutely absorb absorbed absorbing absorbs abstract abstraction abstractions absurd abuse abused abuses abusing abusive abysmal academic academics accelerate accent accents accept acceptable acceptance acceptances accepted accepting accepts access accessed accesses accessible accessing accesss accident accidental accidentally accidents accommodate accommodation accommodations accompanied accompanies accompany accompanying accomplish accomplished accomplishes accomplishing accord accordance accordances accorded according accordingly accords account accountant accountants accounted accounting accountings accounts accumulate accumulated accumulates accumulating accuracy accuracys accurate accurately accusation accusations accuse accused accuseds accuses accusing accustom accustomed accustoming accustoms ace aces achieve achieved achievement achievements achieves achieving acid acids acknowledge acknowledged acknowledges acknowledging acorn acorns acoustic acquaintance acquaintances acquire acquired acquires acquiring acquisition acquisitions acronym acronyms across act acted acting action actions activate activated activates activating active actively activities activity activitys actor actors acts actual actually acute adapt adaptation adaptations adapted adapting adapts add added addict addicted addicting addictive addicts adding addition additional additionally additions address addressed addresses addressing addresss adds adequate adequately adhere adhered adheres adhering adjacent adjective adjectives adjust adjusted adjusting adjustment adjustments adjusts administer administered administering administers administration administrations administrative admirable admiration admirations admire admission admissions admit admits admitted admittedly admitting adopt adopted adopting adoption adoptions adopts adult adults advance advanced advances advancing advantage advantageous advantages advent advents adventure adventures adventurous adverse adversely advert advertise advertised advertisement advertisements advertises advertising advertisings adverts advice advices advisable advise advised adviser advisers advises advising advisory advocate advocated advocates advocating aerial aesthetic aesthetically affair affairs affect affected affecting affection affections affects afford aforementioned afraid after afternoon afternoons again against age aged agency agencys agenda agendas agent agents ages aggressive ago agony agonys agree agreed agreeing agreement agreements agrees agricultural ahead aid aided aiding aids aim aimed aiming aims air aircraft aircrafts airport airports airs akin alarm alarmed alarming alarms alas albeit album albums alcohol alcoholic alcoholics alcohols alert algebra algebraic algebras algorithm algorithms alias aliases alien aliens align aligned aligning alignment alignments aligns alike alive all allegation allegations allege alleged allegedly alleges alleging allergic alleviate alliance alliances allies alliess allocate allocated allocates allocating allocation allocations allow allowable allowance allowances allowed allowing allows ally almost alone along alongside aloud alpha alphabet alphabetic alphabetical alphabets alphas already also alter alteration alterations altered altering alternate alternative alternatively alternatives alters although altogether always am amateur amateurs amaze amazed amazes amazing amazingly ambassador ambassadors amber ambers ambient ambiguities ambiguity ambiguitys ambiguous ambitious amend amended amending amendment amendments amends among amongst amount amounts amp ample amplifier amplifiers amps amuse amused amusement amusements amuses amusing an anagram anagrams analogous analogue analogues analogy analogys analysis analysiss analyst analysts anarchy anarchys anatomy anatomys ancestor ancestors ancient and anecdote anecdotes angel angels anger angers angle angles angry anguish anguishs animal animals anniversary anniversarys announce announced announcement announcements announces announcing annoy annoyance annoyances annoyed annoying annoys annual annually anomalies anomaly anonymous anorak anoraks another answer answered answering answers anthology anthologys anticipate anticipated anticipates anticipating anticipation anticipations antidote antidotes antique antiques antisocial anxious any anybody anyhow anyone anyplace anything anyway anywhere apart apathetic apathy apathys apologies apology apologys apostrophe apostrophes appalled appalling appallingly apparatus apparatuses apparatuss apparent apparently appeal appealed appealing appeals appear appearance appearances appeared appearing appears append appended appending appendix appendixs appends applause applauses apple apples applicable applicant applicants application applications applied applies apply applying appoint appointed appointing appointment appointments appoints appraisal appraisals appreciate appreciated appreciates appreciating appreciation appreciations approach approached approaches approaching appropriate appropriately approval approvals approve approved approves approving approximate approximately approximation approximations apt arbitrarily arbitrary arc arcade arcades arcane arch archaic architecture architectures archive archived archives archiving archs arcs are area areas arena arenas arguable arguably argue argued argues arguing argument arguments arise arisen arises arising arithmetic arithmetics arm armed arming arms army armys arose around arrange arranged arrangement arrangements arranges arranging array arrays arrest arrested arresting arrests arrival arrivals arrive arrived arrives arriving arrogance arrogances arrogant arrow arrows art article articles artificial artificially artist artistic artists arts as ascend ascended ascending ascends ash ashamed ashcan ashcans ashes aside ask asked asking asks asleep aspect aspects assault assaults assemble assembled assembler assemblers assembles assembling assembly assemblys assert asserted asserting assertion assertions asserts assess assessed assesses assessing assessment assessments asset assets assign assigned assigning assignment assignments assigns assist assistance assistances assistant assistants assisted assisting assists associate associated associates associating association associations assort assorted assorting assorts assume assumed assumes assuming assumption assumptions assure assured assures assuring asterisk asterisks astronomer astronomers astronomy astronomys asynchronous at ate atheism atheisms atheist atheists atlas atlass atmosphere atmospheres atmospheric atom atomic atoms atrocities atrocity attach attached attachs attaching attachment attachments attachs attack attacked attacking attacks attain attempt attempted attempting attempts attend attendance attendances attendant attendants attended attending attends attention attentions attitude attitudes attorney attorneys attract attracted attracting attraction attractions attractive attracts attribute attributed attributes attributing audible audience audiences audio audios aunt aunts authentic author authorities authority authoritys authors autobiography autobiographys automate automated automates automatic automatically automating automobile automobiles autumn autumns availability availabilitys available average averages avoid avoided avoiding avoids await awaited awaiting awaits awake award awarded awarding awards aware awareness awarenesss away awful awfully awkward axes axiom axioms axis axiss babies baby babys back backbone backbones backed background backgrounds backing backings backlog backlogs backs backspace backward backwards bacteria bacterium bad badge badges badly baffle baffled baffles baffling bag baggage baggages bagged bags bake baked bakes baking balance balanced balances balancing ball ballet ballets ballot ballots balls ban banal banana bananas band bands bandwagon bandwagons bandwidth bandwidths bang bangs bank bankrupt bankrupts banks banned banner banners banning bans bar bare barely bargain bargains bark barked barking barks baroque baroques barred barrel barrels barrier barriers barring barrister barristers bars base based basement basements bases bash bashed bashes bashing basic basically basics basing basis basiss basket baskets bass basses basss bastard bastards bat batch batchs bath bathroom bathrooms baths bats batteries battery batterys battle battles baud bauds bay bays be beach beachs beam beams bean beans bear beard bearded bearding beards bearing bearings bears beast beasts beat beaten beating beatings beats beautiful beautifully beauty beautys became because become becomes becoming bed bedroom bedrooms beds beef beefs been beer beers before beforehand beg began begin beginner beginners beginning beginnings begins begun behalf behalfs behave behaved behaves behaving behind being beings belief beliefs believable believe believed believer believers believes believing bell bells belong belonged belonging belongings belongs beloved below belt belts bench benchs bend bending bends beneath beneficial benefit benefits bent beside besides best bet beta betas bets better betting between beware beyond bias biased biases biasing biass bible biblical bicycle bicycles bid bidding bids big bigger biggest bigot bigoted bigotry bigotrys bigots bill billfold billfolds billion billions bills bin binary bind binding bindings binds bins biochemistry biochemistrys biography biographys biological biologist biologists biology biologys bird birds birth birthday birthdays births biscuit biscuits bishop bishops bit bite bites biting bitmap bits bitten bitter bizarre black blackboard blackboards blackmail blackmails blacks blade blades blame blamed blames blaming blank blanket blankets blanks blast blasted blasting blasts blatant blatantly bless blessed blesses blessing blew blind blindly blink bliss blisss blob blobs block blocked blocking blocks blood bloods bloody blow blowing blowings blown blows blue blues blurb blurbs board boards boat boats bob bobs bodies body bodys bog bogged bogging boggle boggles bogs bogus boil boiled boiling boils bold bolt bolts bomb bombed bombing bombs bond bonds bone bones bonus bonuss book booked booking bookings booklet booklets books bookshop bookshops bookstore boom boost boosts boot boots border borderline borderlines borders bore bored boredom boredoms bores boring borings born borne borrow borrowed borrowing borrowings borrows boss bosss both bother bothered bothering bothers bottle bottles bottom bottoms bought bounce bound boundaries boundary boundarys bounds bout bouts bow bowl bowls box boxes boxs boy boys bracket bracketed bracketing brackets brain brains brake brakes branch branches branchs brand branded branding brands brass brasss brave breach breachs bread breads break breakdown breakdowns breakfast breakfasts breaking breakings breaks breath breathe breathed breathes breathing breathings breaths bred breed breeding breedings breeds breeze breezes brethren brick bricks bridge bridges brief briefly brigade brigades bright brighter brightest brightly brightness brightnesss brilliant brilliantly bring bringing brings broad broadcast broadcasting broadcasts broadly broke broken brother brothers brought brown browns browse browsed browses browsing brush brushs brutal bubble bubbles buck bucket buckets bucks budget budgets buffer buffered buffering buffers bug bugger buggers bugs build building buildings builds built bulb bulbs bulk bulks bull bullet bulletin bulletins bullets bulls bump bunch bunchs bundle bundles burden burdens bureaucracy bureaucracys buried buries burn burned burning burns burnt burst bursting bursts bury burying bus buses bush bushs business businesses businesss buss bust busts busy but butter butters button buttons buy buyer buyers buying buys by bye byes bypass bypasss byte bytes cabbage cabbages cabinet cabinets cable cabled cables cabling caf caffeine caffeines cage cages cake cakes calculate calculated calculates calculating calculation calculations calculator calculators calculus calculuss calendar calendars call called caller callers calling callings calls calm cam came camera cameras camp campaign campaigned campaigning campaigns camps campus campuss cams can cancel cancels cancer cancers candidate candidates cannot canonical cans cant cants cap capabilities capability capabilitys capable capacity capacitys capital capitalism capitalisms capitalist capitalists capitals caps captain captains capture captured captures capturing car carbon carbons card cardboard cardboards cards care cared career careers careful carefully careless cares caring carpet carpets carriage carriages carried carrier carriers carries carrot carrots carry carrying cars cartoon cartoons cartridge cartridges case cased cases cash cashs casing casings cassette cassettes cast casting castings castle castles casts casual cat catastrophic catch catches catching categorically categories category categorys cater catered catering caterings caters cathedral cathedrals catholic cats cattle cattles caught causal causality causalitys cause caused causes causing caution cautions cave caveat caveats caves cease ceased ceases ceasing ceiling ceilings celebrate celebrated celebrates celebrating celebration celebrations cell cells cellular censor censored censoring censors censorship censorships cent central centrally cents centuries century centurys ceremony ceremonys certain certainly certainty certaintys certificate certificates chain chains chair chairman chairmans chairs chalk chalks challenge challenged challenges challenging chamber chambers champagne champagnes champion champions chance chancellor chancellors chances change changed changeover changeovers changes changing channel channels chaos chaoss chaotic chap chapel chapels chaps chapter chapters char character characteristic characteristics characters charge charged charges charging charitable charities charity charitys charm charmed charming charms chars chart charter charters charts chase chased chases chasing chasings chat chats chatted chatting cheap cheaper cheapest cheaply cheat cheated cheating cheats checked checking cheek cheeks cheer cheerful cheers cheese cheeses chemical chemicals chemist chemistry chemistrys chemists chess chesss chest chestnut chestnuts chests chew chewed chewing chews chicken chickens chief chiefs child childhood childhoods childish children childrens childs chip chips chocolate chocolates choice choices choir choirs choose chooses choosing chop chopped chopping chops choral chord chords chorus choruss chose chosen chuck chucked chucking chucks chunk chunks church churches churchs cider ciders cigarette cigarettes cinema cinemas circa circle circles circuit circuitry circuitrys circuits circular circulate circulated circulates circulating circulation circulations circumstance circumstances cite cited cites cities citing citizen citizens city citys civil civilian civilians claim claimed claiming claims clarification clarifications clarified clarifies clarify clarifying clarity claritys clash clashes class classed classes classic classical classics classicss classification classifications classified classifies classify classifying classing classs clause clauses clean cleaned cleaner cleaners cleanest cleaning cleanings cleanly cleans clear clearance clearances cleared clearer clearers clearest clearing clearings clearly clears clever cleverer cleverest clich clichs click clicks client clients cliff cliffs climate climates climb climbed climbing climbs clinic clinical clinics clip clipped clipping clippings clips clique cliques clock clocks clog clone clones close closed closely closer closers closes closest closet closets closing closure closures cloth clothe clothed clothes clothing clothings cloths cloud clouds club clubs clue clues clumsy cluster clusters coach coachs coal coals coarse coast coasts coat coats cobbler cobblers code coded codes coding codings coffee coffees coherent coin coincide coincidence coincidences coined coining coins coke cokes cold collaboration collaborations collapse collapsed collapses collapsing collar collars collate collated collates collating colleague colleagues collect collected collecting collection collections collective collects college colleges colon colons colony colonys column columns combat combats combination combinations combine combined combines combining come comedy comedys comes comess comfort comfortable comfortably comforts comic comics coming comma command commandment commandments commands commas commence comment commentary commentarys commentator commentators commented commenting comments commercial commercially commission commissioned commissioning commissions commit commitment commitments commits committed committee committees committing commodity commoditys common commonly commons commonss communal communicate communicated communicates communicating communication communications communism communisms communist communists communities community communitys compact companies companion companions company companys comparable comparative comparatively compare compared compares comparing comparison comparisons compassion compassions compatibility compatibilitys compatible compel compelled compelling compellings compels compensate compensation compensations compete competed competence competences competent competes competing competition competitions competitive competitor competitors compilation compilations compile compiled compiler compilers compiles compiling complacent complain complained complaining complains complaint complaints complement complementary complements complete completed completely completeness completenesss completes completing completion completions complex complexity complexitys complicate complicated complicates complicating complication complications compliment compliments comply component components compose composed composer composers composes composing composite composition compositions compound compounds comprehend comprehensible comprehension comprehensions comprehensive compress compressed compresses compressing compression compressions comprise comprised comprises comprising compromise compromises compulsion compulsions compulsory computation computational computations compute computed computer computers computes computing con concatenate concatenated concatenates concatenating conceal concealed concealing conceals concede conceivable conceivably conceive conceived conceives conceiving concentrate concentrated concentrates concentrating concentration concentrations concept conception conceptions concepts conceptual concern concerned concerning concerns concert concerto concertos concerts concise conclude concluded concludes concluding conclusion conclusions concrete concretes concur concurrently condemn condemnation condemnations condemned condemning condemns condense condensed condenses condensing condition conditional conditioned conditioning conditionings conditions condom condoms condone conduct conducted conducting conductor conductors conducts conference conferences confess confidence confidences confident confidential confidentiality confidentialitys configuration configurations configure configured configures configuring confine confined confines confining confirm confirmation confirmations confirmed confirming confirms conflict conflicted conflicting conflicts conform confront confronted confronting confronts confuse confused confuses confusing confusion confusions congest congested congesting congestion congestions congests congratulate congratulations conjecture conjectures conjunction conjunctions connect connected connecting connection connections connector connectors connects connotation connotations cons conscience consciences conscious consciously consciousness consciousnesss consecutive consensus consensuss consent consented consenting consents consequence consequences consequent consequently conservation conservations conservative conservatives consider considerable considerably considerate consideration considerations considered considering considers consist consisted consistency consistencys consistent consistently consisting consists consolation consolations console conspicuous conspiracy conspiracys constant constantly constants constituency constituencys constituent constituents constitute constitutes constitution constitutional constitutions constrain constrained constraining constrains constraint constraints construct constructed constructing construction constructions constructive constructs consult consultancy consultant consultants consultation consultations consulted consulting consults consume consumed consumer consumers consumes consuming consumption consumptions contact contacted contacting contacts contain contained container containers containing contains contemplate contemplated contemplates contemplating contemporary contempt contempts contend content contention contentions contentious contents contest contests context contexts continent continental continents continual continually continuation continuations continue continued continues continuing continuity continuitys continuous continuously continuum continuums contour contours contraception contraceptions contract contracted contracting contracts contradict contradicted contradicting contradiction contradictions contradictory contradicts contrary contrast contravention contraventions contribute contributed contributes contributing contribution contributions contributor contributors contrive contrived contrives contriving control controlled controller controllers controlling controls controversial controversy controversys convenience conveniences convenient conveniently convention conventional conventions conversation conversations converse conversely conversion conversions convert converted converter converters converting converts convey convict convicted convicting conviction convictions convicts convince convinced convinces convincing convincingly cook cooked cookie cookies cooking cookings cooks cool cooled cooling cools cooperate cooperation cooperations coordinate coordinates coordination coordinations cope coped copes copied copies coping copings copper coppers copy copying copyright copyrights copys core cores corn corner corners corns corporate corporation corporations corpse corpses correct corrected correcting correction corrections correctly corrects correlate correlation correlations correspond corresponded correspondence correspondences correspondent correspondents corresponding corresponds corridor corridors corrupt corrupted corrupting corruption corruptions corrupts cosmic cosmology cosmologys cost costing costly costs cotton cottons cough could council councils counsel counsels count counted counter counterexample counterpart counterparts counters counting countless countries country countrys countryside countrysides counts county countys couple coupled couples coupling courage courages courier couriers course courses court courtesy courtesys courts cousin cousins cover coverage coverages covered covering coverings covers coverss cow cows crack cracked cracking cracks craft crafts cramp cramped cramping cramps crap craps crash crashed crashes crashing crass crawl crawled crawling crawls crazy cream creams create created creates creating creation creations creative creator creators creature creatures credibility credibilitys credible credit credits creed creeds creep crew crews cricket crickets cried cries crime crimes criminal criminals crisis crisiss crisp crisps criteria criterion criterions critic critical criticism criticisms critics crop crops cross crossed crosses crossing crossings crossroad crossroads crossroadss crosss crossword crowd crowded crowding crowds crown crowns crucial crude cruel cruelty crueltys cruise cruised cruises cruising crunch crunched crunches crunching crush crushed crushes crushing cry crying cryptic crystal crystals cs css cube cubes cubic cuckoo cuckoos cuddly cue cues culprit culprits cult cults cultural culture cultures cumbersome cumming cums cumulative cunning cup cupboard cupboards cups cure cured cures curing curiosity curiositys curious curiously curly currency currencys current currently curriculum curriculums curry currys curse curses cursor cursors curtain curtains curve curves custard custards custom customary customer customers customs cut cute cuts cutting cuttings cycle cycled cycles cycling cyclings cyclist cyclists cylinder cylinders cynic cynical cynics daft daily damage damaged damages damaging damn damnation damnations damned damning damns damp dance danced dances dancing danger dangerous dangerously dangers dare dared dares daring dark darkness darknesss darling darlings dash dashed dashes dashing data database databases datas date dated dates dating datum datums daughter daughters dawn dawns day daylight daylights days daytime daytimes dead deadline deadlines deadly deaf deal dealer dealers dealing dealings deals dealt dear death deaths debatable debate debated debates debating debt debts debug debugged debugger debugging debugs decade decades decay decent decide decided decides deciding decimal decimals decision decisions deck decks declaration declarations declare declared declares declaring decline declined declines declining decode decoded decodes decoding decrease decreased decreases decreasing dedicate dedicated dedicates dedicating deduce deduced deduces deducing deduction deductions deed deeds deem deemed deeming deems deep deeper deepest deeply default defaults defeat defeated defeating defeats defect defective defects defend defended defending defends deficiencies deficiency define defined defines defining definite definitely definition definitions definitive defy degenerate degradation degradations degrade degraded degrades degrading degree degrees deity deitys delay delayed delaying delays delete deleted deletes deleting deletion deletions deliberate deliberately delicate delicious delight delighted delightful delighting delights delimiters deliver delivered delivering delivers delivery deliverys delta deltas delusion delusions demand demanded demanding demands demented demise demises democracy democracys democratic democratically demolish demolished demolishes demolishing demonstrate demonstrated demonstrates demonstrating demonstration demonstrations denied denies denominator denominators denote denotes dense density densitys dentist dentists deny denying department departmental departments departure departures depend depended dependence dependences depending depends deposit depress depressed depresses depressing depression depressions deprive deprived deprives depriving depth depths deputy deputys derange deranged deranges deranging derivative derive derived derives deriving derogatory descend descended descending descends describe described describes describing description descriptions descriptive desert deserted deserting deserts deserve deserved deserves deserving design designate designated designates designating designed designer designers designing designs desirable desire desired desires desiring desk desks desktop despair desperate desperately despise despite destination destinations destine destined destines destining destroy destroyed destroying destroys destruction destructions destructive detach detached detaches detaching detail detailed detailing details detect detectable detected detecting detection detections detective detectives detector detectors detects deter determination determinations determine determined determines determining deterrent deterrents detract devastate devastated devastates devastating develop developed developer developers developing development developments develops deviation deviations device devices devil devils devious devise devised devises devising devoid devote devoted devotes devoting diagnosis diagnosiss diagnostic diagnostics diagnosticss diagonal diagram diagrams dial dialect dialects dials diameter diameters diary diarys dice dictate dictator dictators dictatorship dictatorships dictionaries dictionary dictionarys did die died dies diesel diesels diess diet diets differ differed difference differences different differential differentiate differently differing differs difficult difficulties difficulty difficultys dig digest digging digit digital digits dignity dignitys digs dilemma dilemmas dim dimension dimensional dimensions dine dined diner dines dining dinner dinners dip diplomatic dire direct directed directing direction directions directive directives directly director directories directors directory directorys directs dirt dirts dirty disable disabled disables disabling disadvantage disadvantages disagree disagreed disagreeing disagreement disagreements disagrees disappear disappeared disappearing disappears disappoint disappointed disappointing disappointment disappointments disappoints disaster disasters disastrous disc discard discarded discarding discards discharge disciplinary discipline disciplines disclaimer disclaimers disco disconnect disconnected disconnecting disconnects discontinue discontinued discontinues discontinuing discos discount discounts discourage discouraged discourages discouraging discover discovered discoveries discovering discovers discovery discoverys discrepancy discrepancys discrete discretion discretions discriminate discriminated discriminates discriminating discrimination discriminations discs discuss discussed discusses discussing discussion discussions disease diseases disguise disguised disguises disguising disgust disgusted disgusting disgusts dish dishes dishonest dishs disk disks dislike disliked dislikes disliking dismal dismiss dismissed dismisses dismissing disorder disorders display displayed displaying displays disposable disposal disposals dispose disposed disposes disposing disposition dispositions dispute disregard disrupt disruption disruptions dissertation dissertations dissimilar distance distances distant distasteful distinct distinction distinctions distinctive distinctly distinguish distinguished distinguishes distinguishing distort distorted distorting distortion distortions distorts distract distracted distracting distracts distress distressed distresses distressing distribute distributed distributes distributing distribution distributions district districts disturb disturbance disturbances disturbed disturbing disturbs ditch ditchs ditto dittos dive dived diverse diversity diversitys divert diverted diverting diverts dives divide divided divides dividing divine diving division divisions divorce divorces do doctor doctors doctrine doctrines document documentary documentation documentations documented documenting documents dodge doe does dog dogma dogmas dogs doing doings dole doles dollar dollars domain domains domestic dominant dominate dominated dominates dominating don donate donated donates donating donation donations done dons doom doomed dooming dooms door doors dose doses dot dots dotted dotting double doubled doubles doubling doubt doubtful doubtless doubts down downhill downright downstairs downwards dozen dozens drag dragged dragging dragon dragons drags drain drained draining drains drama dramas dramatic dramatically drank drastic drastically draw drawback drawbacks drawing drawings drawn draws dread dreaded dreadful dreading dreads dream dreaming dreams dreary dress dressed dresses dressing dressings drew dried dries drift drill drills drink drinking drinks drip dripped dripping drippings drips drive drivel driven driver drivers drives driving drop dropped dropping droppings drops drove drown drowned drowning drowns drug drugs drum drums drunk drunken dry drying dual dubious duck ducks due dues duff duffs dug dull duly dumb dummy dummys dump dumped dumping dumps dumpster duplicate duplicated duplicates duplicating duplication duplications duration durations during dust dustbin dustbins dusts dusty duties duty dutys dying dynamic dynamically dynamics dynamicss each eager eagerly eagers eagle eagles ear earlier earliest early earn earned earning earnings earns ears earth earths ease eases easier easiest easily east eastern easts easy eat eaten eater eaters eating eatings eats eccentric echo echoed echoes echoing echos ecological ecology ecologys economic economical economically economics economicss economies economy economys edge edges edit edited editing edition editions editor editorial editors edits educate educated educates educating education educational educations effect effective effectively effectiveness effectivenesss effects efficiency efficiencys efficient efficiently effort efforts egg eggs ego egos eh eight eighteen eighteens eighth eights either elaborate elderly elect elected electing election elections electoral electorate electorates electric electrical electricity electricitys electron electronic electronically electronics electronicss electrons elects elegant element elementary elements elephant elephants elevator elevators eleven elevens eligible eliminate eliminated eliminates eliminating elite elites elitist elitists else elsewhere em embarrass embarrassed embarrasses embarrassing embarrassment embarrassments embed embedded embedding embeds emerge emerged emergency emergencys emerges emerging eminent eminently emit emotion emotional emotionally emotions emphasis emphasiss empire empires empirical employ employed employee employees employer employers employing employment employments employs emptied empties empty emptying ems emulate emulation emulations emulator emulators enable enabled enables enabling enclose enclosed encloses enclosing encode encoded encodes encoding encounter encountered encountering encounters encourage encouraged encouragement encouragements encourages encouraging end ended ending endings endless endlessly ends enemies enemy enemys energy energys enforce enforced enforces enforcing engage engaged engages engaging engine engineer engineered engineering engineerings engineers engines enhance enhanced enhancement enhancements enhances enhancing enjoy enjoyable enjoyed enjoying enjoyment enjoyments enjoys enlarge enlarged enlarges enlarging enlighten enlightened enlightening enlightenment enlightenments enlightens enormous enormously enough ensure ensured ensures ensuring entail entails enter entered entering enterprise enterprises enters entertain entertained entertaining entertainment entertainments entertains enthusiasm enthusiasms enthusiastic entire entirely entirety entiretys entities entitle entitled entitles entitling entity entitys entrance entrances entries entry entrys envelope envelopes environment environmental environments envisage envisaged envisages envisaging envy envys epic epics episode episodes equal equality equalitys equally equals equate equation equations equilibrium equilibriums equip equipment equipments equipped equipping equips equivalent equivalents era eras erase erased eraser erasers erases erasing ergo err erroneous error errors escape escaped escapes escaping esoteric especially essay essays essence essences essential essentially establish established establishes establishing establishment establishments estate estates estimate estimated estimates estimating estimation estimations eternal eternity eternitys ethic ethical ethics ethnic etymology etymologys evaluate evaluated evaluates evaluating evaluation evaluations even evened evening evenings evenly evens event events eventual eventually ever every everybody everyday everyone everything everywhere evidence evidences evident evidently evil evils evolution evolutionary evolutions evolve evolved evolves evolving exact exactly exaggerate exaggerated exaggerates exaggerating exam examination examinations examine examined examiner examiners examines examining example examples exams exceed exceeded exceeding exceedingly exceeds excellent except excepted excepting exception exceptional exceptionally exceptions excepts excess excessive excessively excesss exchange exchanged exchanges exchanging excite excited excitement excitements excites exciting exclamation exclamations exclude excluded excludes excluding exclusion exclusions exclusive exclusively excuse excuses executable execute executed executes executing execution executions executive executives exempt exercise exercised exercises exercising exhaust exhausted exhausting exhaustive exhausts exhibit exhibition exhibitions exist existed existence existences existing exists exit exited exiting exits exotic expand expanded expanding expands expansion expansions expect expectation expectations expected expecting expects expedition expeditions expenditure expenditures expense expenses expensive experience experienced experiences experiencing experiment experimental experimentally experimentation experimentations experimented experimenting experiments expert expertise expertises experts expire expired expires expiring expiry expirys explain explained explaining explains explanation explanations explanatory explicit explicitly explode exploded explodes exploding exploit exploitation exploitations exploited exploiting exploits exploration explorations explore explored explores exploring explosion explosions explosive exponential export exports expose exposed exposes exposing exposure exposures express expressed expresses expressing expression expressions expressway expressways extant extend extended extending extends extension extensions extensive extensively extent extents external externally extinction extinctions extra extract extracted extracting extraction extractions extracts extraneous extraordinarily extraordinary extras extreme extremely extremes extremist extremists eye eyes eyesight eyesights fabric fabrics face faced faces facilitate facilities facility facilitys facing facings fact factor factories factors factory factorys facts factual factually faculties faculty facultys fail failed failing failings fails failure failures faint fainter faintest fair fairer fairest fairly fairness fairnesss fairy fairys faith faithful faiths fake fall fallacious fallacy fallacys fallen falling falls false fame fames familiar familiarity familiaritys families family familys famine famines famous fan fancy fans fantasies fantastic fantasy fantasys far farce farces fare fares farewell farewells farm farmer farmers farms farther farthest fascinate fascinated fascinates fascinating fascist fascists fashion fashionable fashioned fashioning fashions fast faster fastest fat fatal fate fates father fathers fats fatuous faucet fault faults faulty fear feared fearing fears feasibility feasibilitys feasible feat feats feature featured features featuring fed federal fee feeble feed feedback feedbacks feeding feedings feeds feel feeling feelings feels fees feet feets fell fellow fellows felt female females feminist feminists fence fences fender fenders festival festivals fetch fever fevers few fewer fewest fiction fictional fictions fiddle fiddled fiddles fiddling field fields fierce fifteen fifteens fifth fifty fiftys fight fighter fighters fighting fights figure figured figures figuring file filed files filing fill filled filling fillings fills film filmed filming films filter filtered filtering filters filthy final finally finals finance finances financial financially find finding findings finds fine fined finer fines finest finger fingers fining finish finished finishes finishing finite fire fired fires firework fireworks firing firings firm firmly firms first firstly fiscal fish fished fishes fishing fishings fishs fit fits fitted fitting five fiver fivers fives fix fixed fixes fixing fixings fizzy flag flagged flagging flags flame flames flash flashed flashes flashing flashings flashs flat flaw flawed flawing flaws fleet fleets flesh fleshs flew flexibility flexibilitys flexible flied flies flight flights flip flipped flipping flips float floated floating floats flood flooded flooding floods floor floors floppy flour flours flow flowed flower flowers flowing flown flows fluctuation fluctuations fluent fluffy fluid fluids flush flushed flushes flushing flute flutes fly flying foam foams focus focuss fog fogs fold folded folder folders folding folds folk folks follow followed follower followers following follows fond fonds font fonts food foods fool fooled fooling foolish fools foot football footballs footnote footnotes foots for forbade forbid forbidden forbidding forbids force forced forces forcibly forcing forecast forecasting forecasts foreign foreigner foreigners foreseeable forest forests forever forgave forget forgets forgetting forgive forgiven forgives forgiving forgot forgotten fork forks form formal formally format formation formations formats formatted formatting formed former formerly forming forms formula formulas formulation formulations forth forthcoming fortnight fortnights fortunate fortunately fortune fortunes forty fortys forum forums forward forwarded forwarding forwardings forwards fossil fossils fought foul found foundation foundations founded founding founds fountain fountains four fours fourteen fourteens fourth fraction fractions fragile fragment fragments frame frames framework frameworks frank frankly frantic fraud frauds freak freaks free freed freedom freedoms freeing freely frees freeway freeways freeze freezes freezing french frequencies frequency frequencys frequent frequently fresh friction frictions fried friend friendly friends friendship friendships fries frighten frightened frightening frightens fringe fringes frivolous frog frogs from front fronts frown frowned frowning frowns froze frozen fruit fruits frustrate frustrated frustrates frustrating frustration frustrations fry frying fudge fudges fuel fuels fulfilled fulfilling full fuller fullers fullest fully fume fumes fun function functional functionality functioned functioning functions fund fundamental fundamentalist fundamentalists fundamentally funded funding funds funeral funerals funnier funniest funny funs fur furniture furnitures furry furs further furthermore furthest fuse fuses fusion fusions fuss fusss fussy futile future futures fuzzy gain gained gaining gains galactic galaxy galaxys game games gang gangs gap gaps garage garages garbage garbages garble garbled garbles garbling garden gardens gas gasoline gasolines gasp gass gate gates gateway gateways gather gathered gathering gatherings gathers gave gay gear geared gearing gears gender genders gene general generally generate generated generates generating generation generations generator generators generic generous genes genetic genetically genetics geneticss genius geniuss genocide genocides genre genres gentle gentleman gentlemans gentlemen gently genuine genuinely geographical geography geographys geology geologys geometry geometrys gesture gestures get gets getting ghastly ghost ghosts giant giants gibberish gibberishs gift gifts gig gigs gin gins girl girlfriend girlfriends girls give given gives giving glad gladly glance glass glasses glasss glean gleaned gleaning gleans global globally glorious glory glorys glossy glove gloves glow glowed glowing glows glue glues gnome gnomes go goal goals goat goats god gods goes going goings gold golden goldfish goldfishes goldfishs golds golf golfs gone good goodbye goodbyes goodies goodness goodnesss goods goody gorgeous gos gospel gospels gossip gossips got gotten govern governed governing government governments governor governors governs gown gowns grab grabbed grabbing grabs grace graces grade grades gradual gradually graduate graduated graduates graduating graduation graduations graffiti graffito grain grains grammar grammars grammatical grand grandfather grandfathers grandmother grandmothers grands grant granted granting grants graph graphic graphical graphics graphicss graphs grasp grass grasss grateful gratefully gratuitous gratuitously grave graves gravitational gravity gravitys greasy great greater greatest greatly greed greeds greedy green greens grew grid grids grief griefs grim grind grinding grinds grip grips groan groans gross grosses grossly ground grounds group grouped grouping groupings groups grow growing grown grows growth growths guarantee guaranteed guaranteeing guarantees guard guarded guarding guards guess guessed guesses guessing guest guests guidance guidances guide guided guideline guidelines guides guiding guilt guilts guilty guinea guineas guitar guitars gulf gulfs gullible gum gums gun guns gut guts gutter gutters guy guys ha habit habits hack hacked hacker hackers hacking hacks had hail hails hair haircut haircuts hairs hairy half halfs hall halls halt halted halting halts halve halves halvess ham hammer hammers hams hand handbook handbooks handed handful handfuls handicap handicaps handing handle handled handler handlers handles handling handlings hands handy hang hanged hanging hangings hangover hangovers hangs happen happened happening happenings happens happier happiest happily happiness happinesss happy hard hardback hardbacks harden hardened hardening hardens harder hardest hardly hardship hardships hardware hardwares hardy harm harmful harmless harmony harmonys harms harsh has hash hashs hassle hassles hasten hasty hat hate hated hates hating hatred hatreds hats have having havoc havocs hay hays hazard hazards hazy he head headache headaches headed header headers heading headings headline headlines heads health healths healthy heap heaps hear heard hearing hearings hears heart heartily hearts heat heated heating heats heaven heavens heavier heaviest heavily heavy heel heels height heights held helicopter helicopters hell hello hellos hells helmet helmets help helped helpful helping helpings helpless helps hence henceforth her herd herds here hereby heresy heresys heritage heritages hero heroes heroic heroin heroins heros herring herrings herself hes hesitate heterosexual heterosexuals hexadecimal hey hid hidden hide hided hideous hideously hides hiding hidings hierarchical hierarchy hierarchys high higher highest highlight highlighted highlighting highlights highly highway highways hilarious hill hills him himself hindsight hindsights hint hinted hinting hints hip hips hire hired hires hiring his historian historians historic historical historically history historys hit hitherto hits hitting ho hobby hobbys hog hogs hold holder holders holding holdings holds hole holes holiday holidays hollow holy home homes homosexual homosexuality homosexualitys homosexuals honest honestly honesty honestys honey honeys honorary hook hooked hooking hooks hope hoped hopeful hopefully hopeless hopelessly hopes hoping horde hordes horizon horizons horizontal horizontally horn horns horrendous horrendously horrible horribly horrid horrific horrified horrifies horrify horrifying horror horrors horse horses hospital hospitals host hostile hosts hot hotel hotels hour hours house housed household households houses housing housings how however huge hugely huh hum human humane humanity humanitys humans humble humbly humorous hundred hundreds hung hungry hunt hunted hunting huntings hunts hurry hurt hurting hurts husband husbands hut huts hydrogen hydrogens hyphen hyphens hypocrisy hypocrisys hypocrite hypocrites hypocritical hypothesis hypothesiss hypothetical hysterical ice ices icon icons id idea ideal idealistic ideally ideals ideas identical identically identification identifications identified identifier identifiers identifies identify identifying identity identitys ideological ideology ideologys idiom idioms idiosyncratic idiot idiotic idiots idle ids if ignorance ignorances ignorant ignore ignored ignores ignoring ill illegal illegally illiterate illness illnesss illogical illusion illusions illustrate illustrated illustrates illustrating illustration illustrations image images imaginary imagination imaginations imaginative imagine imagined imagines imagining imbalance imbalances immature immediate immediately immense immensely imminent immoral immortal immune impact impacts impair impaired impairing impairs impend impended impending impends imperative imperfect imperial impersonal implausible implement implementation implementations implemented implementing implements implication implications implicit implicitly implied implies imply implying import importance importances important importantly imported importing imports impose imposed imposes imposing impossible impractical impress impressed impresses impressing impression impressions impressive imprison imprisoned imprisoning imprisons improbable improve improved improvement improvements improves improving impulse impulses in inability inabilitys inaccessible inaccuracies inaccuracy inaccurate inadequate inadvertently inane inappropriate incapable incarnation incarnations incentive incentives inch inches inchs incidence incidences incident incidental incidentally incidents inclination inclinations incline inclined inclines inclining include included includes including inclusion inclusions inclusive incoherent income incomes incoming incompatible incompetence incompetences incompetent incomplete incomprehensible inconsistencies inconsistency inconsistencys inconsistent inconvenience inconvenienced inconveniences inconveniencing inconvenient incorporate incorporated incorporates incorporating incorrect incorrectly increase increased increases increasing increasingly incredible incredibly increment increments incur incurred incurring incurs indeed indefensible indefinite indefinitely indent independence independences independent independently indeterminate index indexed indexes indexing indexs indicate indicated indicates indicating indication indications indicative indicator indicators indictment indictments indirect indirection indirections indirectly indistinguishable individual individually individuals induce induced induces inducing induction inductions indulge indulged indulges indulging industrial industries industry industrys ineffective inefficiency inefficiencys inefficient inequality inequalitys inertia inertias inevitable inevitably inexperienced infallible infamous infant infantile infants infect infected infecting infection infections infects infelicity infelicitys infer inference inferences inferior inferiority inferioritys infinite infinitely infinity infinitys inflation inflations inflexible inflict influence influenced influences influencing influential info inform informal informally information informations informative informed informing informs infos infrastructure infrastructures infrequent infringement infringements ingenious ingredient ingredients inhabit inhabitant inhabitants inhabited inhabiting inhabits inherent inherently inherit inheritance inheritances inherited inheriting inherits inhibit inhibited inhibiting inhibition inhibitions inhibits initial initially initials initiate initiated initiates initiating initiative initiatives inject injure injured injures injuries injuring injury injurys injustice injustices ink inks inner innocence innocences innocent innovation innovations innovative input inputs inputted inputting insane insect insects insecure insensitive insert inserted inserting insertion insertions inserts inside insides insidious insight insights insignificant insist insisted insistence insistences insisting insists insofar inspect inspected inspecting inspection inspections inspects inspiration inspirations inspire inspired inspires inspiring install installation installations installed installing installs instance instances instant instantly instants instead instinct instincts institute institution institutions instruct instructed instructing instruction instructions instructs instrument instrumental instruments insufficient insult insulted insulting insults insurance insurances intact intake intakes integer integers integral integrate integrated integrates integrating integration integrations integrity integritys intellect intellects intellectual intelligence intelligences intelligent intend intended intending intends intense intensely intensity intensitys intensive intent intention intentional intentionally intentions intents inter interact interacted interacting interaction interactions interactive interactively interacts intercourse intercourses interest interested interesting interestingly interests interface interfaced interfaces interfacing interfacings interfere interfered interference interferences interferes interfering interim interior interiors intermediate intermittent internal internally internals international interpret interpretation interpretations interpreted interpreter interpreters interpreting interprets interrogate interrupt interrupted interrupting interruption interruptions interrupts intersection intersections interval intervals intervene intervened intervenes intervening intervention interventions interview interviewed interviewing interviews intimate into intolerance intolerances intrinsic intrinsically introduce introduced introduces introducing introduction introductions introductory intuitive invade invaded invades invading invalid invalidate invalids invaluable invariably invasion invasions invent invented inventing invention inventions inventor inventors invents inverse invert inverted inverting inverts invest investigate investigated investigates investigating investigation investigations investment investments invisible invitation invitations invite invited invites inviting invoke invoked invokes invoking involve involved involvement involvements involves involving ion ions irate iron ironic irons irony ironys irrational irrelevant irrespective irresponsible irritate irritated irritates irritating irritation irritations is island islands isolate isolated isolates isolating isolation isolations issue issued issues issuing it item items its itself jack jacket jackets jacks jail jails jam jammed jamming jams jargon jargons jazz jazzs jealous jeans jellies jelly jerk jest jests jet jets job jobs join joined joining joins joint jointly joints joke joked jokes joking jolly journal journalist journalists journals journey journeys joy joys judge judged judges judging juice juices jump jumped jumping jumps junction junctions jungle jungles junior junk junks jury jurys just justice justices justifiable justifiably justification justifications justified justifies justify justifying juvenile keen keep keeper keepers keeping keepings keeps ken kens kept kernel kernels kettle kettles key keyboard keyboards keyed keying keys keystroke keystrokes keyword keywords kick kicked kicking kicks kid kidded kidding kiddings kidnap kidnapped kidnapping kidnaps kidney kidneys kids kill killed killer killers killing kills kind kindly kindness kindnesss kinds king kingdom kingdoms kings kiss kit kitchen kitchens kits knee knees knew knife knifes knight knights knock knocked knocking knocks know knowing knowledge knowledges known knows lab label labels laboratory laboratorys labs lack lacked lacking lacks lad ladder ladders ladies lads lady ladys lag lager lagers laid lain lake lakes lamp lamps land landed landing landings landlord landlords lands landscape landscapes lane lanes language languages large largely larger largest lark larks laser lasers last lasted lasting lasts late lately later latest latter laugh laughed laughing laughings laughs laughter laughters launch launched launches launching lavatory lavatorys law lawn lawns laws lawyer lawyers lay layer layers laying layout layouts lays laziness lazinesss lazy leach lead leaded leader leaders leadership leaderships leading leads leaf leaflet leaflets leafs league leagues leak leaks lean leaned leaning leanings leans leap learn learning learnings learns least leather leathers leave leaved leaves leavess leaving leavings lecture lectured lecturer lecturers lectures lecturing led left leg legal legally legend legendary legends legible legislation legislations legitimate legitimately legs leisure leisures lemon lemons lend lending lends length lengths lengthy lenient lens lenses lenss lent lesbian lesbians less lesser lesson lessons lest let lethal lets letter letters letting level levels liability liabilitys liable liaison liaisons libel libels liberal liberties liberty libertys librarian librarians libraries library librarys lid lids lie lied lieds lies life lifes lifestyle lifetime lifetimes lift lifted lifting lifts light lighted lighter lighters lightest lighting lightings lightly lightning lightninged lightnings lights like liked likelihood likelihoods likely likes likewise liking likings limb limbs limit limitation limitations limited limiting limits line linear lined lines linguistic lining linings link linkage linkages linked linking links lion lions lip lips liquid liquids liquor lisp lisps list listed listen listened listener listeners listening listens listing listings lists lit literal literally literary literate literature literatures litter litters little live lived lively liver livers lives livess livest living load loaded loader loaders loading loadings loads loan loans lobby lobbys local locally locals locate located locates locating location locations lock locked locking locks lodge lodges log logged logging loggings logic logical logically logics logo logos logs lonely long longer longest look looked looking looks loop loophole loopholes loops loose loosely lop lopped lord lords lorries lorry lorrys lose loses losing loss losses losss lost lot lots loud louder loudest loudly lousy love loved lovely lover lovers loves loving low lower lowered lowering lowers lowest loyal luck luckily lucks lucky ludicrous ludicrously luggage luggages lump lumps lunatic lunch lunchs lunchtime lunchtimes lung lungs lurk lurked lurking lurks lust lusts luxury luxurys lying lyric lyrics machine machinery machinerys machines macintoshs mad made madness madnesss magazine magazines magic magical magics magnetic magnificent magnitude magnitudes mail mailbox mailboxs mailed mailing mails main mainframe mainframes mainly mains mainss mainstream mainstreams maintain maintained maintaining maintains maintenance maintenances maize maizes major majority majoritys majors make maker makers makes making makings male males malfunction malicious man manage managed management managements manager managers manages managing mandate mandates mandatory mangle mangled mangles mangling mania manias manifestation manifestations manifestly manifesto manifestos manipulate manipulated manipulates manipulating manipulation mankind mankinds manned manner manners manning manpower manpowers mans manual manually manuals manufacture manufactured manufacturer manufacturers manufactures manufacturing many map mapped mapping mappings maps march margin marginal marginally margins marital mark marked marker markers market marketed marketing marketings markets marking markings marks marriage marriages married marries marry marrying mask masks mass masses massive massively master masters match matched matches matching matchs mate material materials mates mathematical mathematically mathematician mathematicians mathematics mathematicss matrices matrix matrixs matter matters mature maximum maximums may maybe mayor mayors maze mazes me meal meals mean meaning meaningful meaningless meanings means meanss meant meantime meantimes meanwhile measure measured measurement measurements measures measuring meat meats mechanic mechanical mechanics mechanism mechanisms media medias medical medicine medicines medieval medium mediums meet meeting meetings meets megabyte megabytes melody melodys melt member members membership memberships memorable memories memory memorys men mend mended mending mends mens mental mentality mentalitys mentally mention mentioned mentioning mentions menu menus mercury mercurys mercy mercys mere merely merge merged merges merging merit merits merry mess message messages messed messes messing messs messy met metal metals metaphor metaphors method methods metric metro metros mice mices microcomputer microcomputers microprocessor microprocessors microwave microwaves midday middays middle midnight midnights might mighty migrate migrated migrates migrating migration migrations mild mildly mile mileage mileages miles military milk milks mill million millions mills mimic mind minded minding mindless minds mine mined mines minimal minimalist minimalists minimum minimums mining minings minister ministers minor minorities minority minoritys mint mints minus minute minutes miracle miracles miraculous mirror mirrors miscellaneous misdirect misdirected misdirecting misdirects miserable miserably misery miserys misfortune misfortunes misguide misguided misguides misguiding misinterpret misinterpreted misinterpreting misinterprets mislead misleading misleads misled misplace misplaced misplaces misplacing misprint misprints misread misreading misreads misrepresent misrepresented misrepresenting misrepresents miss missed misses missile missiles missing mission missions mist mistake mistaken mistakenly mistakes mistaking mistook mists misunderstand misunderstanding misunderstandings misunderstands misunderstood misuse misuses mix mixed mixes mixing mixture mixtures mnemonic moan moaned moaning moans mob mobile mobs mock mod mode model models moderate moderately moderation moderations modern modes modest modification modifications modified modifies modify modifying module modules mole molecular molecule molecules moles moment momentarily moments momentum momentums monarch monarchs money moneys monitor monitored monitoring monitors monkey monkeys monochrome monochromes monopoly monopolys monster monsters month monthly months mood moods moon moons moral morality moralitys morally morals more moreover morning mornings moron morons mortal mortality mortalitys mortals most mostly mother mothers motion motions motivate motivated motivates motivating motivation motivations motive motives motor motors motorway motorways motto mottos mount mountain mountains mounted mounting mountings mounts mouse mouses mouth mouths move moved movement movements moves movie movies moving much muck mucked mucking mucks mud muddle muddled muddles muddling muds mug mugs multiple multiples multiplication multiplications multiplied multiplies multiply multiplying mum mumble mummy mummys mums mundane murder murdered murderer murderers murdering murders muscle muscles museum museums music musical musician musicians musics must mutter muttered muttering mutters mutual mutually my myself mysteries mysterious mysteriously mystery mysterys mystic mystics myth mythical mythology mythologys myths nail nailed nailing nails naive naked name named nameds nameless namely names naming namings narrative narratives narrow narrower narrowest nastier nastiest nasty nation national nationally nations native natives natural naturally nature natures naughty nay nays near nearby nearer nearest nearly neat neatly necessarily necessary necessity necessitys neck necks need needed needing needle needles needless needlessly needs negate negative neglect neglected neglecting neglects negligible negotiable negotiate negotiated negotiates negotiating negotiation negotiations neither nerve nerves nervous nest nested nesting nests net nets network networked networking networks neural neutral never nevertheless new newcomer newcomers newer newest newly news newsletter newsletters newspaper newspapers newss next nice nicely nicer nicest nick nicked nicking nickname nicknames nicks night nightmare nightmares nights nil nils nine nines no noble nobody node nodes noise noises noisy nominal nominally nominate nominated nominates nominating none nonetheless nonsense nonsenses noon noons nor norm normal normality normalitys normally norms north northern norths nose noses nostalgia nostalgias not notable notably notation notations note noted notes nothing notice noticeable noticeably noticed notices noticing notification notifications notified notifies notify notifying noting notion notions notorious notwithstanding noun nouns novel novels novelty noveltys novice novices now nowadays nowhere nuclear nuisance nuisances null numb number numbered numbering numbers numbest numeral numerals numeric numerical numerous nun nuns nurse nurses nut nuts oar oars obey obeyed obeying obeys object objected objecting objection objectionable objections objective objects obligation obligations obligatory oblige obliged obliges obliging obnoxious obscene obscure obscured obscures obscuring obscurity obscuritys observation observations observe observed observer observers observes observing obsess obsessed obsesses obsessing obsession obsessions obsolete obstruct obstructed obstructing obstructs obtain obtainable obtained obtaining obtains obvious obviously occasion occasional occasionally occasions occupation occupations occupied occupies occupy occupying occur occurred occurrence occurrences occurring occurs ocean oceans odd oddly odds of off offend offended offender offenders offending offends offer offered offering offerings offers offhand office officer officers offices official officially officials offset offsets offsetting offspring offsprings often oh oil oils old older oldest omission omissions omit omits omitted omitting on once one ones oneself ongoing onion onions only onto onus onuss onwards open opened opening openings openly opens opera operas operate operated operates operating operation operational operations operator operators opinion opinions opponent opponents opportunities opportunity opportunitys oppose opposed opposes opposing opposite opposition oppositions oppress oppressed oppresses oppressing oppression oppressions opt opted optic optical optimal optimistic optimum optimums opting option optional optionally options opts opus opuses or oral orange oranges orbit orbital orbitals orbits orchestra orchestral orchestras order ordered ordering orders ordinary organ organic organs orient oriental orientate orientated orientates orientating orientation orientations oriented orienting orients origin original originally originals originate originated originates originating originator originators origins ors orthodox other others otherwise ought our ours ourselves out outcome outcomes outcry outcrys outdated outer outgoing outline outlined outlines outlining outlook outlooks output outputs outrage outraged outrageous outrages outraging outright outset outsets outside outstanding outweigh outweighs over overall overcame overcome overcomes overcoming overdraft overdrafts overdue overflow overhead overheads overlap overload overloaded overloading overloads overlong overlook overlooked overlooking overlooks overly overnight overprice overpriced overprices overpricing overridden override overrides overriding overrode overseas overtime overtimes overtone overtones overview overviews overwhelm overwhelmed overwhelming overwhelms overwriting overwritten owe owed owes owing own owned owner owners ownership ownerships owning owns oxygen oxygens ozone ozones pace paces pacifier pacifiers pack package packaged packages packaging packagings packed packet packets packing packings packs pad padded padding paddings pads page paged pages paging paid pain painful painfully painless pains paint painted painting paintings paints pair pairs palace palaces pale pan panel panels panic panics pant pants paper paperback paperbacks papers par parade parades paradise paradises paradox paradoxs paragraph paragraphs parallel parallels parameter parameters paranoia paranoias paranoid paraphrase paraphrases pardon parent parentheses parenthesis parents parity paritys park parked parking parkings parks parliament parliaments parochial parody parodys parrot parrots pars parse parsed parses parsing part partial partially participant participants participate participated participates participating particle particles particular particularly parties partition partitioned partitioning partitions partly partner partners parts party partys pass passage passages passed passenger passengers passes passing passion passionate passions passive passport passports password passwords past paste pastes pat patch patched patches patching patchs patent patents path pathetic paths patience patiences patient patients pattern patterns pause paused pauses pausing pavement pavements pay payed paying payment payments pays peace peaceful peaces peak peaks peanut peanuts peasant peasants peculiar pedal pedals pedant pedantic pedantry pedantrys pedants pedestrian pedestrians peer peers pen penalties penalty penaltys pence pences pencil pencils pended pending pends penguin penguins pennies penny pennys pens people peoples per perceive perceived perceives perceiving percent percentage percentages percents perception perceptions perfect perfection perfections perfectly perform performance performances performed performing performs perhaps period periodic periodically periods peripheral peripherals permanent permanently permissible permission permissions permit permits permitted permitting perpetual persecute persecuted persecutes persecuting persist persistent person personal personalities personality personalitys personally personnel personnels persons perspective perspectives persuade persuaded persuades persuading persuasion persuasions perverse pet petrol petrols pets petty pharmacies pharmacy pharmacys phase phased phases phasing phenomena phenomenas phenomenon phenomenons philosopher philosophers philosophical philosophies philosophy philosophys phoenix phoenixs phone phoned phones phoning photo photocopy photocopys photograph photographic photographs photos phrase phrased phrases phrasing phrasings physic physical physically physicist physicists physics physiology physiologys pi piano pianos pick picked picking picks picture pictures pie piece pieces pies pig pigeon pigeons pigs pile piles pill pills pilot pilots pin pinch pinched pinches pinching pink pinks pins pint pints pipe pipeline pipelines pipes pit pitch pitfall pitfalls pits pity pitys pizza pizzas place placed places placing plague plagued plagues plaguing plain plainly plan plane planes planet planetary planets planned planning plans plant planted planting plants plaster plastered plastering plasters plastic plastics plate plates platform platforms plausible play played player players playground playgrounds playing plays plea pleas pleasant pleasantly please pleased pleases pleasing pleasure pleasures plenty plentys plot plots plotted plotter plotters plotting ploy ploys plug plugged plugging plugs plural plus pocket pockets poem poems poet poetic poetry poetrys poets point pointed pointer pointers pointing pointings pointless points poison poisoned poisoning poisonings poisons poke polar pole poles police policeman policemans polices policies policy policys polish polished polishes polishing polite politeness politenesss political politically politician politicians politics politicss poll polls pollution pollutions polynomial pompous pool pools poor poorer poorest poorly pop pope popes popped popping pops populace populaces popular popularity popularitys populate populated populates populating population populations pork porks pornography pornographys port portability portable ported porter porters porting portion portions portray portrayed portraying portrays ports pose posed poses posing position positioned positioning positions positive positively possess possessed possesses possessing possession possessions possibilities possibility possibilitys possible possibly post postage postages postal postcard postcards posted poster posters posting postings postmaster postmasters postpone postponed postpones postponing posts postscript postscripts postulate pot potato potatoes potatos potential potentially pots pound pounds pour poured pouring pours poverty povertys powder powders power powered powerful powering powers practicable practical practically practicals pragmatic praise praises pray prayed prayer prayers praying prays preach preached preaches preaching precaution precautions precede preceded precedence precedences precedent precedents precedes preceding precious precise precisely precision precisions predecessor predecessors predict predictable predicted predicting prediction predictions predicts predominantly preface prefaces prefer preferable preferably preference preferences preferred preferring prefers prefix prefixed prefixes prefixing prefixs pregnancy pregnancys pregnant prejudice prejudiced prejudices prejudicing preliminary premature prematurely premise premises premium premiums preparation preparations prepare prepared prepares preparing prerequisite prescribe prescribed prescribes prescribing prescription prescriptions presence presences present presentation presentations presented presenting presently presents preserve preserved preserves preserving president presidents press pressed presses pressing pressure pressures presumably presume presumed presumes presuming pretend pretended pretending pretends pretentious pretty prevail prevalent prevent prevented preventing prevention preventions prevents preview previewer previews previous previously price priced prices pricing pride prides priest priests primarily primary prime primes primitive primitives prince princes principal principally principle principles print printed printer printers printing printings printout printouts prints prior priorities priority prioritys prison prisoner prisoners prisons privacy privacys private privately privilege privileged privileges privileging pro probabilities probability probabilitys probable probably problem problems procedure procedures proceed proceeded proceeding proceedings proceeds process processed processes processing processor processors processs proclaim produce produced producer producers produces producing product production productions productive productivity productivitys products profession professional professionals professions professor professors profile profiles profit profitable profits profound programmable programmer programmers progress progressed progresses progressing progresss prohibit prohibited prohibiting prohibits project projected projecting projection projections projects proliferation proliferations prolong prolonged prolonging prolongs prominent promise promised promises promising promote promoted promotes promoting promotion promotions prompt prompted prompting promptly prompts prone pronoun pronounce pronounced pronounces pronouncing pronouns pronunciation pronunciations proof proofs propaganda propagandas proper properly properties property propertys prophet prophets proportion proportional proportions proposal proposals propose proposed proposes proposing proposition propositions proprietary prose prosecute prosecuted prosecutes prosecuting prosecution prosecutions proses prospect prospective prospects prostitute prostitutes protect protected protecting protection protections protects protein proteins protest protests protocol protocols prototype prototypes proud prove proved proves provide provided provides providing proving provision provisional provisions provocative provoke provoked provokes provoking proximity proximitys pseudo psychological psychologist psychologists psychology psychologys pub public publication publications publicity publicitys publicly publish published publisher publishers publishes publishing publishings pubs pudding puddings pull pulled pulling pulls pulp pulps pulse pulses pump pumped pumping pumpings pumps pun punch punched punches punching punctuation punctuations puncture punish punished punishes punishing punishment punishments puns punt punts pupil pupils purchase purchased purchases purchasing pure purely purge purity puritys purple purples purpose purposes pursue pursued pursues pursuing pursuit pursuits push pushed pushes pushing put puts putt putted putting putts puzzle puzzled puzzles puzzling python pythons qualification qualifications qualified qualifier qualifiers qualifies qualify qualifying qualities quality qualitys quantities quantity quantitys quantum quantums quarter quarters queen queens queries query querys quest question questionable questioned questioning questionnaire questionnaires questions quests queue queued queues quibble quick quicker quickest quickly quiet quieter quieters quietest quietly quit quite quits quitting quiz quizs quota quotas quotation quotations quote quoted quotes quoting rabbit rabbits rabid race raced races racial racing racism racist racists rack racket rackets racks radar radars radiation radiations radical radically radio radios radius radiuss rag rage rages rags raid raids rail railroad railroads rails railway railways rain rainbow rainbows rained raining rains raise raised raises raising raisings ram rampant rams ran random randomly rang range ranged ranges ranging rank ranks rant ranted ranting rants rape rapes rapid rapidly rare rarely rarer rarest rash rat rate rated rates rather rating ratings ratio rational rationale rationales rationally ratios rats rattle rattled rattles rattling rave raved raves raving raw ray rays razor razors re reach reached reaches reaching react reacted reacting reaction reactionary reactions reactor reactors reacts read readable reader readers readership readerships readily reading readings reads ready real realistic reality realitys really realm realms rear rearrange rearranged rearranges rearranging rears reason reasonable reasonably reasoned reasoning reasonings reasons reassure reassured reassures reassuring rebuild rebuilding rebuilds rebuilt recall recalled recalling recalls receipt receipts receive received receiver receivers receives receiving recent recently reception receptions recipe recipes recipient recipients reckless reckon reckoned reckoning reckons reclaim recognition recognitions recollection recollections recommend recommendation recommendations recommended recommending recommends reconcile reconsider record recorded recorder recorders recording recordings records recover recovered recovering recovers recovery recoverys recreational recruit recruited recruiting recruitment recruitments recruits rectangle rectangles rectangular rectified rectifies rectify rectifying recursion recursions recursive recycle recycled recycles recycling red redefine redefined redefines redefining redirect reds reduce reduced reduces reducing reduction reductions redundancy redundancys redundant refer reference referenced references referencing referendum referendums referred referring refers refine refined refines refining reflect reflected reflecting reflection reflections reflects reflex reflexs reform reformat reformed reforming reforms refrain refresh refreshed refreshes refreshing refund refusal refusals refuse refused refuses refusing refute regain regard regarded regarding regardless regards regime regimes region regional regions register registered registering registers registration registrations regret regrets regrettably regretted regretting regular regularly regulation regulations reign reigns reinstate reinstated reinstates reinstating reiterate reject rejected rejecting rejection rejections rejects relate related relates relating relation relations relationship relationships relative relatively relatives relativity relativitys relax relaxed relaxes relaxing relay relays release released releases releasing relevance relevances relevant reliability reliabilitys reliable reliably relied relief reliefs relies relieve relieved relieves relieving religion religions religious relocation relocations reluctance reluctances reluctant reluctantly rely relying remain remainder remainders remained remaining remains remark remarkable remarkably remarked remarking remarks remedy remedys remember remembered remembering remembers remind reminded reminder reminding reminds reminiscent remote remotely removal removals remove removed removes removing rename renamed renames renaming rend render rendered rendering renderings renders rending rendition renditions rends renew renewed renewing renews rent rents repair repaired repairing repairs repeat repeatable repeated repeatedly repeating repeats repent repertoire repertoires repetition repetitions repetitive rephrase replace replaced replacement replacements replaces replacing replied replies reply replying report reported reporter reporters reporting reports represent representation representations representative representatives represented representing represents reproduce reproduced reproduces reproducing reproduction reproductions repulsive reputation reputations request requested requesting requests require required requirement requirements requires requiring requisite reread rereading rereads res rescue research researcher researchers researchs resemblance resemblances resemble resembled resembles resembling resent reservation reservations reserve reserved reserves reserving reset resets resetting reside residence residences resident residents resides resign resignation resignations resigned resigning resigns resist resistance resistances resolution resolutions resolve resolved resolves resolving resort resorted resorting resorts resource resourced resources resourcing respect respectable respected respecting respective respectively respects respond responded responding responds response responses responsibilities responsibility responsibilitys responsible rest restart restarted restarting restarts restaurant restaurants rested resting restore restored restores restoring restrain restrained restraining restrains restrict restricted restricting restriction restrictions restrictive restricts rests result resulted resulting results resume resumed resumes resuming resurrection resurrections retail retails retain retained retaining retains retire retired retirement retirements retires retiring retract retrieval retrievals retrieve retrieved retrieves retrieving return returned returning returns reuse reveal revealed revealing reveals revelation revelations revenge revenges revenue revenues reverse reversed reverses reversing revert review reviewed reviewing reviews revise revised revises revising revision revisions revolt revolted revolting revolts revolution revolutionary revolutionarys revolutions reward rewards rewrite rewrites rewriting rewritten rewrote rhetorical rhyme rhymes rhythm rhythms ribbon ribbons rice rices rich richer richest rid ridden ridding ride rides ridiculous ridiculously riding ridings rids right rightly rights rightss rigid rigorous ring ringed ringing rings riot riots rip ripped ripping rips rise risen rises rising risings risk risked risking risks risky ritual rituals rival rivals river rivers road roads robot robots robust rock rocket rockets rocks rod rode rods role roles roll rolled rolling rolls roman romance romances romantic roof roofs room rooms root roots rope ropes rose roses rot rotate rotated rotates rotating rotation rotations rotten rough roughly round roundabout roundabouts rounded rounding rounds rout route routed routes routine routinely routines routing routings routs row rows royal royalties rub rubber rubbers rubbish rubbishs rude ruin ruined ruining ruins rule ruled ruler rulers rules ruling rulings run rung running runs rural rush rushed rushes rushing rushings rusty sabotage sabotages sack sacked sacking sacks sacred sacrifice sacrificed sacrifices sacrificing sad sadden saddened saddening saddens sadly safe safeguard safeguards safely safer safest safety safetys saga sagas said sail sailed sailing sailings sails saint saints sake sakes salaries salary salarys sale sales salesman salesmans salt salts salvation salvations same sample sampled samples sampling samplings sand sands sandwich sandwiches sandwichs sane sang sanity sanitys sank sarcasm sarcasms sarcastic sat satellite satellites satire satires satisfaction satisfactions satisfactorily satisfactory satisfied satisfies satisfy satisfying sauce sauces save saved saves saving savings saw saws say saying sayings says sayss scale scaled scales scaling scan scandal scandals scanned scanner scanners scanning scans scarce scarcely scare scared scares scarf scarfs scaring scarlet scarlets scatter scattered scattering scatters scenario scenarios scene scenery scenerys scenes schedule scheduled scheduler schedules scheduling scheme schemes scholar scholars school schools science sciences scientific scientifically scientist scientists scope scopes score scored scoreds scores scoring scotch scotchs scrap scrapped scrapping scraps scratch scratched scratches scratching scream screamed screaming screams screen screens screw screwed screwing screws script scripts scroll scrolled scrolling scrolls scum scums sea seal sealed sealing seals search searched searches searching seas season seasons seat seats second secondary seconded seconding secondly seconds secret secretaries secretary secretarys secretly secrets sect section sections sector sectors sects secular secure security securitys see seed seeds seeing seeings seek seeking seeks seem seemed seeming seemingly seems seen sees segment segments seldom select selected selecting selection selections selective selectively selects self selfish selfs sell selling sells semantic semantics semanticss seminar seminars send sender senders sending sends senior sensation sensations sense senses sensible sensibly sensitive sensitivity sensitivitys sent sentence sentenced sentences sentencing sentient sentiment sentimental sentiments separate separated separately separates separating separation separations separator separators sequel sequels sequence sequences sequential serial serials series seriess serious seriously seriousness seriousnesss sermon sermons servant servants serve served server servers serves service services serving servings session sessions set sets setting settings settle settled settles settling seven sevens seventh several severe severely severity severitys sex sexes sexist sexists sexs sexual sexuality sexualitys sexually sexy shade shades shadow shadows shake shaken shakes shaking shakings shaky shall shallow shame shames shape shaped shapes shaping share shared shareholder shareholders shares sharing sharp sharply she shed shedding sheds sheep sheeps sheer sheet sheets shelf shelfs shell shells shelter shelters shelve shelves shelvess shift shifted shifting shifts shine shined shines shining shiny ship shipped shipping shippings ships shirt shirts shock shocked shocking shocks shoe shoes shone shook shoot shooting shoots shop shopped shopping shoppings shops short shortage shortages shorten shortened shortening shortens shorter shortest shorthand shorthands shortly shorts shot shots should shoulder shoulders shout shouted shouting shouts shove show showed shower showers showing showings shown shows shut shutdown shutdowns shuts shutting shy sic sick sicken sickened sickening sickens side sided sides sideways siding sigh sight sighted sighting sights sigma sigmas sign signal signals signature signatures signed significance significances significant significantly signing signs silence silences silent silicon silicons sillier silliest silly silver silvers similar similarities similarity similaritys similarly simple simpler simplest simplicity simplicitys simplified simplifies simplify simplifying simplistic simply simulate simulated simulates simulating simulation simulations simultaneous simultaneously sin since sincere sincerely sine sines sinful sing singer singers singing single singles sings singular singularly sinister sink sinking sinkings sinks sins sir sirs sister sisters sit site sites sits sitting sittings situate situated situates situating situation situations six sixs sixteen sixteens sixth sixties sixty size sized sizes sizing skeleton skeletons sketch sketches sketchs skill skilled skills skin skins skip skipped skipping skips skirt skirts skull skulls sky skys slag slags slang slangs slash slave slaves sleep sleeping sleepings sleeps slept slice sliced slices slicing slid slide slides sliding slight slighter slightest slightly slim slip slipped slippery slipping slips slogan slogans slope sloppy slot slots slow slowed slower slowest slowing slowly slows small smaller smallest smallish smart smash smashed smashes smashing smell smells smelly smile smiled smiles smiling smith smiths smoke smoked smoker smokers smokes smoking smokings smooth smoothly smug snack snacks snag snags snail snails sneak sneaked sneaking sneaks sneaky sniff snobbery snobberys snow snows so soap soaps sober social socialism socialisms socialist socialists socially societies society societys sock socket sockets socks sod sods soft software softwares soil soils solar sold soldier soldiers sole solely soles solicitor solicitors solid solo solos solution solutions solve solved solves solving some somebody somehow someone someplace something sometime sometimes somewhat somewhere son song songs sons soon sooner soonest sophisticate sophisticated sophisticates sophisticating sordid sore sorry sort sorted sorting sorts sought soul souls sound sounded sounding sounds soundtrack soundtracks soup soups source sources south southern souths space spaced spaces spacing spacings span spans spare spares spatial speak speaker speakers speaking speaks special specialist specialists specially species specific specifically specification specifications specified specifies specify specifying specimen specimens spectacular spectrum spectrums speculate speculation speculations sped speech speeches speechs speed speeding speeds spell spelling spellings spells spend spending spends spent sphere spheres spies spigot spike spikes spill spin spiral spirit spirits spiritual spit spite spites spits spitted spitting splendid split splits splitss splitting spoil spoiling spoils spoke spoken spokesman spokesmans sponsor sponsored sponsoring sponsors spontaneous spontaneously spoof spoofs spool spools sport sports spot spots spotted spotting spottings spout sprang spray sprays spread spreading spreads spring springing springs sprung spur spurious spurs spy spys squad squads square squared squares squaring squash squashed squashes squashing squeeze squeezed squeezes squeezing stability stabilitys stable stables stack stacks staff staffs stage stages stagger staggered staggering staggers stair staircase staircases stairs stake stakes stale stall stalls stamp stamped stamping stamps stance stances stand standard standards standing standings standpoint standpoints stands star stare stared stares staring stark starred starring stars start started starter starters starting startle startled startles startling starts starve starved starves starving state stated statement statements states static stating station stationary stations statistic statistical statistics status statuss stay stayed staying stays steadily steady steal stealing stealings steals steam steams steel steels steep steer steered steering steers stem stems step stepped stepping steps stereo stereotype stereotypes sterile sterling sterlings stick sticking sticks sticky stiff still stimulate stimulated stimulates stimulating stimulation stimulations stir stirred stirring stirs stock stocks stole stolen stomach stomachs stone stones stood stop stopped stopping stoppings stops stopss storage storages store stored stores storing storm storms straight straightforward strain strains strange strangely stranger strangers strangest strategic strategies strategy strategys straw straws stray stream streams street streets strength strengthen strengths stress stressed stresses stressing stresss stretch stretched stretches stretching strict strictly strike strikes striking string stringent strings strip stripped stripping strips strive stroke strokes strong stronger strongest strongly struck structural structure structured structures structuring struggle struggled struggles struggling stuck student students studied studies studio studios study studying stuff stuffed stuffing stuffs stumble stumbled stumbles stumbling stun stunned stunning stuns stunt stupid stupidity stupiditys style styles subject subjected subjecting subjective subjects submission submissions submit submits submitted submitting subroutine subroutines subscribe subscription subscriptions subsequent subsequently subset subsets subsidiary substance substances substantial substantially substitute substituted substitutes substituting substitution substitutions subtle subtleties subtlety subtletys subtly subway subways succeed succeeded succeeding succeeds success successful successfully succession successions successive successor successors successs such sudden suddenly sue sued sues suffer suffered sufferer sufferers suffering sufferings suffers suffice sufficient sufficiently suffix suffixs sugar sugars suggest suggested suggesting suggestion suggestions suggests suicidal suicide suicides suing suit suitability suitable suitably suite suited suites suiting suits sum summaries summary summarys summed summer summers summing sums sun sundry sung sunk sunlight sunlights sunny sunrise sunrises suns sunshine sunshines super superb superficial superficially superfluous superior superiority superioritys supermarket supermarkets supernatural supervise supervised supervises supervising supervision supervisions supervisor supervisors supplement supplementary supplements supplied supplier suppliers supplies supply supplying support supported supporter supporters supporting supports suppose supposed supposedly supposes supposing suppress suppressed suppresses suppressing suppression suppressions supreme sure surely surface surfaces surgery surgerys surname surnames surplus surpluss surprise surprised surprises surprising surprisingly surround surrounded surrounding surroundings surrounds survey surveys survival survivals survive survived survives surviving susceptible suspect suspected suspecting suspects suspend suspended suspending suspends suspension suspensions suspicion suspicions suspicious suspiciously sustain sustained sustaining sustains swallow swallowed swallowing swallows swam swamp swamped swamping swamps swap swapped swapping swaps swear swearing swears sweat sweating sweats sweep sweeping sweeps sweet swept swim swimming swimmings swims swing switch switched switches switching switchs sword swords swore sworn swum symbol symbolic symbols symmetric symmetry symmetrys sympathetic sympathies sympathy sympathys symphonies symphony symphonys symptom symptoms syndicate syndicates syndrome syndromes synonym synonymous synonyms syntactic syntactically syntax syntaxs synthesis synthesiss system systematic systems tab table tables tabs tack tacked tacking tackle tackled tackles tackling tacks tactic tactical tactics tactless tag tags tail tailor tailored tailoring tailors tails take taken taker takers takes taking tale talent talented talenteds talents tales talk talked talking talks tall tame tangent tangents tank tanks tap tape tapes target targets task tasks taste tasted tasteless tastes tasting taught tax taxation taxations taxes taxi taxis taxpayer taxpayers taxs tea teach teacher teachers teaches teaching teachings team teams teapot teapots tear teared tearing tears teas technical technically technique techniques technological technology technologys tedious teenage teenager teenagers teeth teeths telephone telephones telescope telescopes television televisions tell telling tells temper temperature temperatures tempers temple temples temporarily temporary tempt temptation temptations tempted tempting tempts ten tend tended tendencies tendency tendencys tender tending tends tennis tenniss tens tense tension tensions tentative tentatively tenth term termed terminal terminally terminals terminate terminated terminates terminating termination terminations terminator terminators terming terminology terminologys terms terrible terribly terrified terrifies terrify terrifying territory territorys terror terrorism terrorisms terrorist terrorists terrors terse test tested testing tests text textbook textbooks texts textual than thank thanked thankful thankfully thanking thanks that thats the thee theft thefts their theirs them theme themes themselves then theological theology theologys theorem theorems theoretical theoretically theories theory theorys therapy therapys there thereabouts thereafter thereby therefore therein thereof theres these theses thesis thesiss they thick thickness thicknesss thief thieve thieves thin thing things think thinking thinkings thinks third thirst thirsts thirty thirtys this thorough thoroughfare thoroughfares thoroughly those thou though thought thoughts thous thousand thousands thread threads threat threaten threatened threatening threatens threats three threes threshold thresholds threw throat throats through throughout throughput throughputs throw throwing thrown throws thrust thrusting thrusts thumb thumbs thus thy tick ticket tickets ticks tidied tidies tidy tidying tidyings tie tied ties tiger tigers tight tightly tile tiles till time timed timer timers times timescale timetable timetables timing timings tin tins tiny tip tips tiresome title titles to toad toads toast toasts tobacco tobaccos today todays toe toes together toggle toggles toilet toilets token tokens told tolerance tolerances tolerant tolerate tolerated tolerates tolerating toll tomato tomatoes tome tomes tomorrow tomorrows ton tone tones tongue tongues tonight tonights tons too took tool tools tooth tooths top topic topical topics tops tore torn torture toss total totally totals touch touched touches touching tough tour tourist tourists tours toward towards tower towers town towns toy toys trace traced traces tracing tracings track tracked tracking tracks trade traded trades trading tradition traditional traditionally traditions traffic traffics tragedy tragedys tragic trail trailed trailing trails train trained training trainings trains transaction transactions transcript transcripts transfer transferred transferring transfers transform transformation transformations transformed transforming transforms transient transit transition transitions transits translate translated translates translating translation translations translator translators transmission transmissions transmit transmits transmitted transmitter transmitters transmitting transparent transport transported transporting transports trap trapped trapping traps trash trashcan trashcans trashs travel travels tray trays tread treasure treasures treat treated treating treatment treatments treats treaty treatys tree trees trek tremendous tremendously trend trends trendy trial trials triangle triangles tribe tribes trick tricks tricky tried tries trifle trifles trigger triggered triggering triggers trilogy trilogys trinity trinitys trip triple tripos triposs trips triumph triumphs trivia trivial trivially trolley trolleys troop troops trouble troubles trouser trousers truck trucks true truly trumpet trumpets truncate truncated truncates truncating trunk trunks trust trusted trusting trusts trusty trustys truth truths try trying tube tubes tune tuned tunes tuning tunings tunnel tunnels turn turned turning turnings turnround turns turntable turntables tutor tutorial tutorials tutors twelve twelves twentieth twenty twentys twice twin twins twist twisted twisting twists two twos tying type typed types typeset typesets typesetting typesettings typewriter typewriters typical typically typing ugh ugly ultimate ultimately umbrella umbrellas unable unacceptable unaffected unambiguous unattended unavailable unavoidable unaware unbalanced unbearable unbelievable unbelievably unbiased uncertain uncertainty uncertaintys unchanged uncle unclear uncles uncomfortable uncommon unconnected unconscious unconvincing undefined under underestimate undergo undergoes undergoing undergone undergraduate undergraduates underground undergrounds underlain underlay underlie underlies underline underlined underlines underlining underlying underneath understand understandable understanding understandings understands understood undertake undertaken undertakes undertaking undertook underwent undesirable undid undo undocumented undoes undoing undone undoubtedly unduly uneasy unemployed unemployment unemployments unexpected unexpectedly unexplained unfair unfamiliar unfinished unfortunate unfortunately unfounded unfriendly unhappy unhealthy unhelpful unified unifies uniform uniformly uniforms unify unifying unimportant uninteresting union unions unique uniquely unit unite united unites uniting units unity unitys universal universally universe universes universities university universitys unjustified unknown unless unlike unlikely unlimited unload unlock unlocked unlocking unlocks unlucky unnatural unnecessarily unnecessary unobtainable unofficial unpleasant unpopular unpredictable unread unreadable unrealistic unreasonable unrelated unreliable unsafe unsatisfactory unseen unset unsolicited unsound unspecified unstable unsuccessful unsuitable unsupported unsure unsuspecting untidy until unto untrue unusable unused unusual unusually unwanted unwelcome unwilling unwise unworkable up upbringing upbringings update updated updates updating upgrade upgraded upgrades upgrading upon upper upright ups upset upsets upsetting upsettings upside upsides upstairs upward upwards urban urge urged urgency urgencys urgent urgently urges urging us usable usage usages use used useful usefully usefulness usefulnesss useless user users uses using usual usually utilities utility utilitys utter utterly vacancies vacancy vacation vacations vacuum vacuums vague vaguely vain valid validity validitys valley valleys valuable value valued values valuing valve valves van vandalism vandalisms vanish vanished vanishes vanishing vans variable variables variance variances variant variants variation variations varied varies varieties variety varietys various vary varying vast vastly vat vats vector vectors vegetable vegetables vegetarian vegetarians vehicle vehicles vein veins velocity velocitys vend vended vending vendor vendors vends venture venue venues verb verbal verbally verbatim verbose verbs verdict verdicts verification verified verifies verify verifying versatile verse verses version versions versus vertical vertically very vessel vessels vet vets via viable vicar vicars vice vices vicinity vicinitys vicious victim victims victory victorys video videos view viewed viewer viewers viewing viewings viewpoint viewpoints views vigorously vile village villages vintage vintages vinyl vinyls violate violation violence violences violent violently violin violins virgin virgins virtual virtually virtue virtues virus viruses viruss visible vision visions visit visited visiting visitor visitors visits visual visually vital vocabulary vocabularys vocal voice voices void voltage voltages volume volumes voluntarily voluntary volunteer volunteered volunteering volunteers vomit vote voted voter voters votes voting vouch vowel vowels vulnerable wade waded wades wading waffle waffles wage wages wait waited waiting waits wake waked wakes waking walk walked walking walks wall wallet wallets walls wander wandered wandering wanders want wanted wanting wants war ward wards warehouse warehouses warm warmed warming warms warn warned warning warnings warns warp warped warping warps warrant warrants warranty warrantys wars wartime wartimes wary was wash washed washes washing washings waste wasted wasteful wastes wasting watch watched watches watching water waters wave waved waves waving way ways we weak weakness weaknesses weaknesss wealth wealths wealthy weapon weapons wear wearing wears weary weasel weasels weather weathers wed wedded wedding weddings weds wee week weekday weekdays weekend weekends weekly weeks weigh weight weights weird welcome welcomed welcomes welcoming welfare welfares well went were west western wests wet wets wetting whale whales what whatever whatsoever wheel wheels when whence whenever where whereas whereby whereupon wherever whether which whichever while whilst whim whims whistle whistles white whites who whoever whole wholeheartedly wholly whom whoop whoops whose why wicked wide widely wider widespread widest width widths wife wifes wild wildly will willed willing willingly wills win wind winded winding windings window windowing windows winds wine wines wing wings winner winners winning wins winter winters wipe wiped wipes wiping wire wired wires wiring wirings wisdom wisdoms wise wiser wisest wish wished wishes wishing wit witch witchs with withdraw withdrawal withdrawals withdrawing withdrawn withdraws withdrew within without witness witnessed witnesses witnessing witnesss wits witty wive wives wivess wizard wizards woke woken wolf wolfs woman womans wombat wombats women womens won wonder wondered wonderful wonderfully wondering wonders wondrous wont wonts wood wooden woods word worded wording wordings words wore work workable worked worker workers working workings workload workloads works workshop workshops workstation workstations world worlds worldwide worm worms worn worried worries worry worrying worse worship worst worth worthless worthwhile worthy would wound wounds wow wrap wrapped wrapper wrappers wrapping wrappings wraps wrath wraths wreck wrecked wrecker wreckers wrecking wrecks wren wrens wretched wrist wrists write writer writers writes writing writings written wrong wrongly wrongs wrote yard yards yawn year yearly years yellow yellows yes yesterday yesterdays yet yeti yetis yield yields you young younger youngest your yours yourself yourselves youth youths zero zeros zone zones zoom

Find millions of documents on Course Hero - Study Guides, Lecture Notes, Reference Materials, Practice Exams and more. Course Hero has millions of course specific materials providing students with the best way to expand their education.

Below is a small sample set of documents:

Utah State - CS - 6670
GAGAATTCACGATTCGAACGATTGAGAATTCCGA
Utah State - CS - 5050
>seq2STGLLLNGSYSENRTQIWQRHRVNNDSVIILFNKHYNLTVTCRRPGNKTVLPVTIMAGLVFHSHKYNTRLRQAWCHFQGNWRGAWREVREKIVKLPKDRYQGTNDTSKIFLQRQFGDPEAANLWFNCQGEFFYCKMDWFLNYLNNLTVDADHNGCNKTSKGKAPGPCVQRTYVACHIRSVINDWYTISKKTYAPPREGHLQCTSTVTGMTVELNYNNDNRTNVTLSPQIGGIWAAELGRYKLVE
Utah State - CS - 2420
cancerchancellorcontraventioncountrysidesessencesurgencycomplicationcraftsmaintainedconventionlowestquietturningsgodlikederogatorymayheavensimminentlibertynightmarespermitsfactoriesshortenedspoolsexescivilianabolishingsynth
Utah State - CS - 6670
bioinformaticsbiologybiobibliographybibleuniversityuniversal
Utah State - CS - 6670
>sequence1ANNTTGFTRIIKAAGYSWKGLRAAWINEAAFRQEGVAVLLAVVIACWLDVDAITRVLLISSVMLVMIVEILNSAIEAVVDRIGSEYHELSGRAKDMGSAAVLIAIIVAVITWCILLWSHFG
Utah State - CS - 3100
Here are a few example problems that I came up with while I was preparing your exam. What is the difference between a simple 'batch' system and a 'multiprogrammed batch' system? What is the purpose of the 'interrupt vector' in a comput
Utah State - CS - 1030
1/27/2009Representing Images Chapter 12 - concludedRepresenting Data images are stored using a variety of formats and compression techniques the simplest representation is a bitmap bitmaps partition an image into a grid of picture elements, called
Utah State - CS - 1410
Chapter 8 Searching and Sorting Arrays1Starting Out with C+, 3rd Edition8.1 Introduction to Search Algorithms A search algorithm is a method of locating a specific item of information in a larger collection of data. This section discusses two
Utah State - CS - 2810
CS2810 Spring 2007Dan Watson dan.watson@usu.edu Course syllabus, calendar, and assignments found at http:/www.cs.usu.edu/~watson/cs2810 These overheads are based on presentations courtesy of Professor Mary Jane Irwin, Penn State University and Profe
Utah State - CS - 1410
Chapter 1. Introduction to Computers and Programming1Starting Out with C+, 3rd Edition1.1 Why Program? Computers can do many different jobs because they are programmable.2Starting Out with C+, 3rd Edition1.2 Computer Systems: Hardware an
Utah State - CS - 1410
Chapter 15 Inheritance, Polymorphism, and Virtual Functions1Starting Out with C+, 3rd Edition15.1 What is Inheritance? Inheritance allows a new class to be based on an existing class. The new class inherits all the member variables and functi
Utah State - CS - 1410
Chapter 10 Characters, Strings, and the string Class1Starting Out with C+, 3rd Edition10.1 Character Testing The C+ library provides several macros for testing characters. Be sure to include ctype.h header file2Starting Out with C+, 3rd
Utah State - CS - 3100
The Deadlock Problem A set of blocked processes each holding a resource and waiting to acquire a resource held by another process in the set. Example: System has 2 tape drives. P1 and P2 each hold one tape drive and each needs another one. Exam
Utah State - CS - 3100
Basic Concepts Maximum CPU utilization obtained with multiprogramming CPUI/O Burst Cycle Process execution consists of a cycle of CPU execution and I/ O wait. CPU burst distributionAlternating Sequence of CPU And I/O BurstsHistogram of CPU-bu
Utah State - CS - 1410
CS1410Exam2Fall 2007 Eagle Pin_Name_Closed book and notes. You need only a pencil and a copy of this exam; remove all other materials from reach. Definition: A code snippet is a small section of code a program. For this exam, consider the fol
Utah State - CS - 2420
CS 2420 Fall 2006Assignment 3 20 points Due September 20, 2006Experimental Complexities Objective:Your goal in this homework is to experimentally verify the algorithmic complexity of the following sorting methods: 1) Insertion Sort 2) Bubble So
Utah State - CS - 6890
CS6890Exam3Summer 2008Name:_ Email:_Instructions: Take home exam. Open book. Open notes. Answer any 10 of the following 13 questions. Answer only 10 questions. Additional answers will result in my grading your 10 worst answers for you
Utah State - CS - 2810
2.1[15] <2.4> Using the MIPS program in Exercise 2.34 (with bugs intact), determine the instruction format for each instruction and the decimal values of each instruction field.2.5[15] <2.5> Consider the following code used to implement the ins
Utah State - CS - 6890
CS6890Exam1Spring 2005Name:_ Email:_1. _ 2. _ 3. _ 4. _ 5. _ 6. _ 7. _ 8. _ 9. _ 10. _ 11. _ 12. _ 13. _ 14. _ Instructions: Closed book. Closed notes. No Calculators. No scratch paper. All you need is a pencil or a pen. Write all you
Utah State - CS - 6890
CS6890Exam2Summer2005Name:_ Email:_ Site:_Instructions:Openbook.Closednotes.NoCalculators.Noscratchpaper. Writeallyouranswersinthespaceindicatedontheexam. 135minutetimelimit.Ifyouhavequestionsduringtheexam,call4357704315. IfIamunavailable,you
Utah State - CS - 2810
CS5500hw4Spring 2007Battlestar GallithmaticScene: Starbuck and Helo on occupied Caprica, day 57. They come up out of a manhole cover directly underneath a battle-scarred Hopper. Starbuck pops the hatch, they scramble in, and start spooling up
Utah State - CS - 2810
2.21 [30] <2.7, 2.8> Write a program in MIPS assembly language to convert anASCII decimal string to an integer. Your program should expect register $a0 to hold the address of a null- terminated string containing some combination of the digits 0 thr
Utah State - CS - 3100
Here are some questions I probably didnt use when I wrote the final version of exam 2 # Write a critical section solution using semaphores# Write a critical section solution using test-and-set# What is the difference between deadlock prevention a
Utah State - CS - 1410
CS1410Exam1Fall 2007 Eagle Pin_Name_Closed book and notes. You need only a pencil and a copy of this exam; remove all other materials from reach. Definition: A code snippet is a small section of code program. that could be used in a2 extra
Utah State - CS - 2420
CS 2420 Fall 2006Assignment 9 20 points Due November 20, 2006Wake Up, Brain!(adapted from the 2003 ACM Regional Programming Contest in Murcia, Spain)Recent groundbreaking research at the ACME Neuro-Anatomy Laboratory indicates the presence of
Utah State - CS - 2200
CS2200hw1Fall 2005This hw is worth 10 points and is due September 14 at11:59:59pm. Turn in a .doc or .txt file via eagle. Consider the following list of complexity classes a. O(1) g. (1) b. O(log n) h. (log n) c. O(n) i. (n) d. O(nk) j. (nk) e
Utah State - CS - 2810
CS5500hw5Spring 2007Benchmark Fist of DeathObjective: Compare two computers using benchmarks of your own devising. Details: Your benchmarks should cover three basic operations: integer add, fp divide, and memory write. Run your benchmarks on t
Utah State - CS - 2420
CS 24020 Fall 2006Assignment 1 20 points Due September 6, 2005Experimental Complexities Objective:For this assignment, you are to use your keen sleuthing skills to experimentally determine the time complexity of various "secret" functions. The
Utah State - CS - 2420
CS 2420 Fall 2006Assignment 2 20 points Due September 13, 2006Recursion Objective:Sudoku is a simple solitaire game played on a 9 9 grid partially filled in with integers in the range 1 to 9. The goal of the game is simply to fill in the empty
Utah State - CS - 2420
CS 2420 Fall 2006Assignment 8 20 points Due November 6, 2006Rosie the RobotRosie the Robot is the automated domestic employee of the Jetson family (George, Jane, Judy, Elroy, and Astro). Rosie works hard, but she can't keep up with all the task
Utah State - CS - 2420
CS 24020 Fall 2006Assignment 10 20 points Due December 4, 2005 RISKThis homework is worth 2 points. RISK Background In this programming assignment, you will write a set of functions that act as a player in the classic Hasbro board game called RI
Utah State - CS - 2420
CS 2420 Fall 2006Assignment 6 20 points Due: Oct 18th 2006AVL Trees Problem Statement:AVL search trees are balanced binary search trees. For this assignment, you have to implement inserting elements in an AVL Search Tree. You are to write your
Utah State - CS - 2200
CS 2200Assignment 13Due December 5, 2005 20 PointsRISKBackground In this programming assignment, you will write a set of functions that act as a player in the classic Hasbro board game called RISK. If you don't know how to play RISK, I recommen
Utah State - CS - 2420
CS 2420 Fall 2006Assignment 7 20 points Due Oct 27, 2006Hashing it Out on the Lone Prairie Story Line:Dusty and Slim lean back against their saddles next to the campfire while their horses nicker quietly into their oat buckets. The last remnant
Utah State - CS - 2420
0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1 0 0 0 0 0 0 0 0 0 0 0 1 0 0 0 0 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1 0 0 1 0 0 0 0 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1 0 0 0 0 0 0 0 0 0 0 0 0 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0
Utah State - CS - 2420
Boongalla 1383 886 777Coocoobyrnie 915 1793 2335Wangalawa 1386 492 2649Fangbooboo 1421 362 1027Stubbyhand 690 59 1763Sheilaville 1926 540 426Plax 1172 1736 1211Gatorcreek 1368 567 429Yangboola 1782 1530 1862Billabong 1123 67 1135Chikamakaga
Utah State - CS - 2420
CS 2420 Fall 2006Assignment 5 20 points Due Oct 11, 2006Railroad Tycoon Part II Story Line:Its still a wild frontier out there, in the Australian Outback (see the previous assignment). And you still need to get a set of railroad lines in place
Utah State - CS - 2420
B+-Trees (Part 1)Motivation AVL tree with N nodes is an excellent data structure for searching, indexing, etc. The Big-Oh analysis shows most operations finishes within O(logN) time The theoretical conclusion works as long as the entire structu
Utah State - CS - 5050
Pattern Matchinga a b b a a a b c c a a a4a1bb3 2cabPattern Matching1StringsA string is a sequence of characters Examples of strings: Let P be a string of size m An alphabet is the set of possible characters for a
Utah State - USU - 1360
Googling to the Max - ExercisesGetting the most from: http:/www.google.comPart 1 of Research Quality Web Searching The Teaching Library, Fall 2005 University of California, BerkeleyGoogle Toolbars (FREE) - highlight terms, remember searches, sea
Utah State - CS - 5050
1. You may not use notes or a calculator. 2. Tear off this sheet and use it to keep your answers covered at all times. If you need more scratch paper, I have some. 3. Write your name on the back of the test by the staple to facilitate returning the e
Utah State - CS - 5050
CS 5050 Fall 2008 Course InformationInstructor: Dr. Vicki Allan, Vicki.Allan@usu.edu, 421 Old Main, (435)-797-2022 Office Hours: MWF 8:30-9:30 or 3:30-4:20. Other hours by appointment. Send email to set up. I love to talk to students so feel free to
Utah State - USU - 1360
USU 1360: Integrative Physical Science Spring 2009 Course InformationInstructor: Dr. Vicki Allan, Vicki.Allan@usu.edu, 429 Old Main, 797-2022 Office Hours (Old Main 429): MWF: 3-4:30 p.m. Graduate TA: Nazneen Malik: Nazneen.Malik@aggiemail.usu.edu G
Utah State - CS - 2420
I have pulled questions from a variety of exams to fit our current coverage. So your exam may differ from this one in length.Exam 2 True-False (2 points each) (Circle the correct answer)T F T F TF TF T F 1. Hashing can be a useful way of sorting.
Utah State - USU - 1360
Written Homework 3 Due Friday January 30, 2009 at classtime! (10 Points) Number Systems 1. What is the result of the following addition 10111 + 00101 a) 11111 b) 11100 c) 10101 d) 10111 e) none of the above 2. What is the result of
Utah State - CS - 5050
O Notation (Big Oh) We want to give an upper bound on the amount of time it takes to solve a problem. Why would we settle for an upper bound instead of a tight bound? Definition: v(n) = ( f (n) constant c and n0 such that v(n) c f (n) whenever
Utah State - CS - 2420
DebuggingI see many of you wasting large blocks of time on debugging. As you already know, the requirements of this class are such that you cannot afford to waste any time. Below are my suggestions for debugging. 1) After you finish entering your co
Utah State - CS - 6890
Presentation Hints(Copied from a variety of others and my own experience) 1. The Golden Rule: Talk unto others as you would have them talk unto you. 2. PowerPoint's (or other slides) are used to convey information efficiently. Even those of us who d
Utah State - CS - 2420
CS 2420 Summer 2008 Written Homework 6Turn in your written homework by folding it in half lengthwise and putting your names on the outside. Written homework provides an excellent framework for achieving the goals of obtaining a working knowledge of
Utah State - CS - 5050
RSA encryption: n = pq, with p and q primes e relatively prime to (n) = (p - 1) (q 1) d inverse of e in Z(n) Keys: Public key: KE = (n, e) Private key: KD =(n,d) Encryption: Plaintext M in Zn C = Me mod n Decryption: M = Cd mod n = Med mod n Theorem
Utah State - CS - 5050
DebuggingI see many of you wasting large blocks of time on debugging. As you already know, the requirements of this class are such that you cannot afford to waste any time. Below are my suggestions for debugging. I have been programming for 35 years
Utah State - CS - 5050
CS 5050 - Program #5 - 30 points Edit Distance as Shortest Path ProblemPart 1 Edit Distance (15 points)Problems in molecular biology involve finding the minimum number of edit steps which are required to change one string into another. There are f
Utah State - CS - 2420
CS 2420 Summer 2008 Written Homework 4Written homework provides an excellent framework for achieving the goals of obtaining a working knowledge of data structures, perfecting programming skills, and developing critical thinking strategies to aid the
Utah State - CS - 2420
CS 2420 Program 5 Summer 2008 30 points Due July 21, 2008 Part 1 Disjoint Set Class (10 points)Create a class to do union/find operations. Demonstrate the class works by showing the following commands (assume possible values of 1-10 in the set): uni
Utah State - CS - 5070
Automation Principles8/15/07These principles concern finding efficient computational ways to perform human tasks. Tasks can be physical, such as running an assembly line, driving a car, controlling airplane surfaces; or mental, such as doing arith
Utah State - CS - 5070
Activity 5Twenty Guesses-Information TheorySummary How much information is there in a 1000-page book? Is there more information in a 1000-page telephone book, or in a ream of 1000 sheets of blank paper, or in Tolkien's Lord of the Rings? If we can
Utah State - CS - 5070
Recollection Principles8/14/07These principles concern how computations store and recall information, and how data layout in the storage system affects their performance. All computations take place in storage systems. A. Storage is essential for
Utah State - CS - 6890
CS 6890 Homework 2 (20 points) Written homework provides an excellent framework for achieving the goals of this course. Because assignments are done as a group and any questions are discussed in class or during office hours, written solutions to the
Utah State - CS - 5070
Evaluation Principles8/15/07These principles concern how computing systems perform under various computational loads and how much capacity they need to deliver their results on time. The principal tools of evaluation are modeling, simulation, expe
Utah State - CS - 6890
CS 6890 Homework 3 (20 points) Written homework provides an excellent framework for achieving the goals of this course. Because assignments are done as a group and any questions are discussed in class or during office hours, written solutions to the
Utah State - CS - 6890
CS 6890 Game Theory Summer 2005 Exam 2 Fill in the blank (1 point each)1. A set of nodes representing the locations a player COULD be in at a single moment in time is called the _information set_. 2. If it is player 2's turn at a give node, we say t