Course Hero has millions of student submitted documents similar to the one
below including study guides, practice problems, reference materials, practice exams, textbook help and tutor support.
Find millions of documents on Course Hero - Study Guides, Lecture Notes, Reference Materials, Practice Exams and more.
Course Hero has millions of course specific materials providing students with the best way to expand
their education.
Below is a small sample set of documents:
Emory - POLS - 508
POLS 508 Prof. Eric Reinhardt Sept 23, 2005 Assignment # 3 Due: Sept 30, 2005 at start of class The objective this time is to use your aggregation, merge, and graphing skills. We will use the file disputes.dta in the datasets subdirectory of the cour
Emory - POLS - 508
1 Helpful Hints December 8, 2005 POLS 508, Prof. Reinhardt Stata Commands (y refers to the dependent variable, x to an independent variable) su to get sample size, mean, and standard deviation for a given variable by x: command executes command
Emory - POLS - 508
Guidelines for Methods Paper POLS 508, Fall 2004 August 30, 2004 Eric Reinhardt This document provides some more extensive guidelines about how to write your methods paper and what it should look like. The syllabus has the following instructions: 30%
Emory - POLS - 509
POLS 509: The Linear Model, Lecture # 5Eric Reinhardt (from the notes of Chris Zorn) Feb 17, 2004The Regression Model. Model t, Interactions. Feb 17: Model t and outliers. Dummy variables, interactions, regression graphs. Fox, 267-287, 135-154. K
Emory - POLS - 508
POLS 508 Prof. Eric Reinhardt Oct 3, 2005 Assignment # 4 Due: Wed, Oct 12, 2005 The objective this time is to use your skills in reasoning about probabilities, working with probability distributions, and using measures of central tendency and dispers
Emory - POLS - 509
Political Science 509: The Linear ModelEmory University, Spring 2005, Class No. 3305 Tarbutton Hall 111 TuTh 1:00p-2:15p January 20, 2005 Professor: Office: Office hours: Phone: Email: My home page: Course home page: Course directory: Eric Reinhardt
Emory - POLS - 508
POLS 508 Prof. Eric Reinhardt Nov 28, 2005 Assignment # 9 Due: Dec 7, 2005 Open the file q:\datasets\homework9.dta. This file contains a dataset of country-year observations, including 99 countries, observed over the period 1948 through 1998. The var
Emory - REL - 210
Prophetic Rhetorolect in Matthew 12:1-8 Lecture by Vernon K. RobbinsProduced by Sam Bradford Either left click or push the right arrow on your keyboard to proceed to the instructions on the next slide. INSTRUCTIONS* (1) If your computer h
Emory - P - 01
rev.4/20/2009 EMORY UNIVERSITY SCHOOL OF MEDICINE CURRICULUM VITAE Name Address Paula M. Vertino, Ph.D. Winship Cancer Institute Emory University School of Medicine 1365-C Clifton Rd., N.E. Atlanta, GA 30322 Tel: (404) 778-3119 Fax: (404) 778-5530 em
Emory - MEDI - 510
BlackBoard site:http:/classes.emory.edu/webapps/loginEmbryology Site http:/www.cellbio.emory.edu/courses/medi510/Karl Saxe contacts: room: Whitehead Research Building Room 405F phone: 404-727-6248 e-mail: karl@cellbio.emory.eduJohn Rolston cont
Emory - MEDI - 510
Five Major Questions of Morphogenesis:1. How are tissues formed from populations of cells? e.g. how do neural retinal cells stick to each other and not the retinal pigmented epithelium? 2. How are organs constructed from tissues? e.g. the retina mus
Emory - MEDI - 510
MEDI 510 (IBS 518) July 24 - August 7, 2006 Human Embryology: Development and Disease Charles Saxe, Ph.D., Course Director Text: Moore, K.W., The Developing Human, W.B. Saunders Co., 7th ed., 2003 Place: Week 1 lectures and clinical cor relations wil
Emory - MEDI - 510
MEDI 510 (IBS 518) July 24 - August 7, 2006 Human Embryology: Development and Disease Charles Saxe, Ph.D., Course Director Text: Moore, K.W., The Developing Human, W.B. Saunders Co., 7th ed., 2003 Place: Week 1 lectures and clinical cor relations wil
Emory - MEDI - 510
Human Embryology: Development and DiseaseEctoderm: PNS and CNS derivatives of the neural tubesuggested reading in Moore & Persaud: Chapters 18 & 19 (pages 428-476) Ken Moberg PhD Whitehead 435 7-3733 kmoberg@cellbio.emory.eduThe Nervous System C
Emory - MEDI - 510
N = # of sets of chromosomes 1N = haploid 2N = diploidC = amount of DNA 2C = amount of DNA in a normal cell 4C = amount of DNA in a cells right after all of the DNA is duplicated but before the cell divides 1C = amount of DNA in a gamete - half the
Emory - MEDI - 510
1234567891011A role for neural crest in heart formation12Prenatal circulation13Post-natal circulation1415Atrial Septal DefectsPatent foramen ovale Patent foramen ovalePatent foramen ovalePatent foramen ovale
Emory - MEDI - 510
MEDI 510 (IBS 518) July 24 - August 7, 2006 Human Embryology: Development and Disease Charles Saxe, Ph.D., Course Director Text: Moore, K.W., The Developing Human, W.B. Saunders Co., 7th ed., 2003 Place: Week 1 lectures and clinical cor relations wil
Emory - MEDI - 510
LECTURE 9: CARDIOVASCULAR SYSTEM II: CONGENITAL HEART DEFECTS"The trouble with mammals is that you never see any really bizarre mutants." W. Bender and M. Peifer (1987) Reading Assignment: Moore pp 329-380.A. INCIDENCE 1. Congenital heart disease
Emory - MEDI - 510
MEDI 510 (IBS 518) July 25 - August 8, 2005 Human Embryology: Development and Disease Charles Saxe, Ph.D., Course Director Text: Moore, K.W., The Developing Human, W.B. Saunders Co., 7th ed., 2003 Place: Week 1: lectures and clinical correlations wil
Emory - MEDI - 510
LECTURE 6: UROGENITAL SYSTEM II: DEVELOPMENT OF THE GONADS"Sexual reproduction is.the masterpiece of nature." Erasmus Darwin (1791) Reading Assignment: Moore pp 304-328. A. THE UROGENITAL RIDGE 1. Formation. During the third week, a longitudinal co
Johns Hopkins - V - 022
Joan M. JensenContributorsLISA BICKMOREs work has appeared in Quarterly West and Mudfish. Her book Haste was published in 1994 by Signature Press. Among her honors is an Academy of American Poets Prize. She was recently awarded an artists residen
Emory - CHEM - 731
, .In this chapter, we do not attempt to give a cOl11prehensive, or even historical, presentation of non-NVE MD simulations. Rather, we have selected a single (but important) case that will be discussed in detail, namely, constant temperature simulat
Emory - CHEM - 731
TINKERSoftware Tools for Molecular DesignVersion 4.2 June 2004TINKERSoftware Tools for Molecular Design Version 4.2 June 2004Copyright 1990-2004 by Jay William Ponder All Rights ReservedCopyright 1990-2004 by Jay William Ponder All Rights
Emory - CHEM - 731
Chemistry 731 Spring '07 SyllabusI. "Molecular Modeling" based on Classical Mechanics via TINKER From the TINKER user guide (1) building protein and nucleic acid models from sequence (2) energy minimization and structural optimization (3) analysis o
Emory - CHEM - 731
TINKER Software Tools for Molecular DesignJay Ponder Lab, Department of Biochemistry and Molecular Biophysics, Washington University School of Medicine, Saint Louis, Missouri 63110 U.S.A. TINKER is a complete package for performing empirical force
Emory - CHEM - 731
NOTES ON NORMAL MODE ANALYSIS CODEThe source codes are dpes_shell.f, normal.f plus a user-supplied potential code which is called by dpes_shell.f. The input to the user code is the Cartesian coordinates of all atoms. (See deps_shell.f for details.)
Emory - JUNE - 16
COMMENTARYDengue virus envelope glycoprotein structure: New insight into its interactions during viral entryFelix A. Rey* Virologie Moleculaire et Structurale, Unite Mixte de Recherche 2472 1157, Centre National de la Recherche Scientique et In
Emory - JUNE - 30
HIV SPECIALREVIEW 2003 Nature Publishing Group http:/www.nature.com/naturemedicineTransmission, acute HIV-1 infection and the quest for strategies to prevent infectionMelissa Pope1 & Ashley T Haase2By the acute stage of HIV-1 infection, the i
Emory - JUNE - 30
HIV SPECIALREVIEW 2003 Nature Publishing Group http:/www.nature.com/naturemedicineImmunopathogenesis and immunotherapy in AIDS virus infectionsNorman L Letvin1 & Bruce D Walker2The heterogeneity of HIV and the different human leukocyte antige
Emory - JUNE - 30
NEWS AND VIEWSThe problem of plain vanilla peptidesMark M DavisThe anti-influenza CD8+ T cell response in HLA-A2 adults is dominated by a specific TCR. The crystal structure of the TCR and peptide-MHC complex show unusual interactions that help t
Emory - JULY - 7
Natural killer T cells reactive to a single glycolipid exhibit a highly diverse T cell receptor repertoire and small clone sizeJennifer L. Matsuda*, Laurent Gapin*, Nicolas Fazilleau, Kris Warren*, Olga V. Naidenko*, and Mitchell Kronenberg**La Jol
Emory - JULY - 7
Journal of General Virology (2003), 84, 17431750DOI 10.1099/vir.0.19118-0Hepatitis C virus dynamics and pathology: the role of CTL and antibody responsesDominik WodarzCorrespondence Dominik Wodarz wodarz@fhcrc.orgFred Hutchinson Cancer Resear
Emory - CD - 8
REPORTS36. 37. 38. 39. 40. agarose beads (2.5 l) were used in a standard RNAi reaction at 37C. G. Hutvagner, P. D. Zamore, unpublished data. E. Billy, V. Brondani, H. Zhang, U. Muller, W. Filipowicz, Proc. Natl. Acad. Sci. U.S.A. 98, 14428 (2001).
Emory - JULY - 7
R5 HIV productively infects Langerhans cells, and infection levels are regulated by compound CCR5 polymorphismsTatsuyoshi Kawamura*, Forrest O. Gulden, Makoto Sugaya*, David T. McNamara, Debra L. Borris*, Michael M. Lederman, Jan M. Orenstein, Peter
Emory - JULY - 7
Journal of General Virology (2003), 84, 16491661DOI 10.1099/vir.0.19110-0ReviewMechanisms of CD4+ T lymphocyte cell death in human immunodeciency virus infection and AIDSJudie B. Alimonti, T. Blake Ball and Keith R. FowkeDepartment of Medical
Emory - JUNE - 30
Rapid evolution of the neutralizing antibody response to HIV type 1 infectionDouglas D. Richman*, Terri Wrin, Susan J. Little*, and Christos J. Petropoulos*Departments of Pathology and Medicine, Veterans Affairs San Diego Healthcare System and the
Emory - JUNE - 16
International Immunology, Vol. 15, No. 7, pp. 861870 doi: 10.1093/intimm/dxg082 2003 The Japanese Society for ImmunologyLIGHT-deciency impairs CD8+ T cell expansion, but not effector functionJinqi Liu1, Clint S. Schmidt2, Feisha Zhao1, Angela J.
Emory - JUNE - 30
NEWS AND VIEWShas highlighted the existence of a functional barrier in the membrane of polarized neurons during development and underscores the importance of further studies on membrane heterogeneity for better understanding of neuronal functions.C
Emory - JUNE - 16
A role for Z-DNA binding in vaccinia virus pathogenesisYang-Gyun Kim*, Maneesha Muralinath, Teresa Brandt, Matthew Pearcy, Kevin Hauns, Ky Lowenhaupt*, Bertram L. Jacobs , and Alexander Rich**Department of Biology, Massachusetts Institute of Techno
Emory - JUNE - 16
International Immunology, Vol. 15, No. 7, pp. 885892 doi: 10.1093/intimm/dxg087 2003 The Japanese Society for ImmunologyEffector T cells have a lower ligand afnity threshold for activation than naive T cellsKazuhiko Kimachi1, Katsuji Sugie2 and
Emory - JUNE - 16
Protection and compensation in the influenza virus-specific CD8 T cell responseRichard J. Webby*, Samita Andreansky, John Stambas, Jerold E. Rehg, Robert G. Webster*, Peter C. Doherty, and Stephen J. TurnerDepartments of *Infectious Diseases, Immun
Emory - JUNE - 30
Stepwise cytoskeletal polarization as a series of checkpoints in innate but not adaptive cytolytic killing Christoph Wulng*, Bozidar Purtic, Jennifer Klem, and John D. Schatzle*Center for Immunology, Departments of Cell Biology and Pathology, Unive
Emory - JUNE - 16
A ligand-binding pocket in the dengue virus envelope glycoproteinYorgo Modis*, Steven Ogata, David Clements, and Stephen C. Harrison**Howard Hughes Medical Institute, Childrens Hospital and Harvard Medical School, 320 Longwood Avenue, Boston, MA 02
Emory - CD - 8
REPORTSRequirement for CD4 T Cell Help in Generating Functional CD8 T Cell MemoryDevon J. Shedlock and Hao Shen*Although primary CD8 responses to acute infections are independent of CD4 help, it is unknown whether a similar situation applies to s
Emory - JUNE - 16
Specific Nature of Cellular Immune Responses Elicited by Chimpanzees Against HIV-1Sunita S. Balla-Jhagjhoorsingh, Ernst J. Verschoor, Natasja de Groot, Vera J. P. Teeuwsen, Ronald E. Bontrop, and Jonathan L. HeeneyABSTRACT: Recent epidemiologic and
Emory - CD - 8
REPORTSindependent. It remains to be determined if help in this case involves direct CD40CD40L interaction between CD4 and CD8 cells, as suggested for TH-dependent antigens (6). Elucidation of the mechanism will help us better understand the develop
Emory - TUTHILL - 2
REPORTSnumber corresponds to a bulk resistivity of 2.4 10 6 ohm m for the silver nanowire. This nanowire is easily reproducible and has markedly higher conductivity than previously reported double-helix DNAtemplated silver nanowires (20). The 4 4 DN
Emory - SWANSON - 2
JOURNAL IMMUNOLOGYCUTTING EDGE Cutting Edge: Signaling and Cell Surface Expression of a H Chain in the Absence of 5: A Paradigm Revisited1Wolfgang Schuh,2Silke Meister,2 Edith Roth, and Hans-Martin Jack3 Pre-B cell receptor (pre-BCR) signals are
Emory - GILSON - 2
The Journal of ImmunologyIFN- Skews Monocyte Differentiation into Toll-Like Receptor 7-Expressing Dendritic Cells with Potent Functional Activities1Mohamad Mohty,* Alexandra Vialle-Castellano,* Jacques A. Nunes, Daniel Isnardon,* Daniel Olive,* an
Emory - SIEGEL - 2
JOURNAL IMMUNOLOGYCUTTING EDGE Cutting Edge: Effector Memory CD8 T Cells in the Lung Airways Retain the Potential to Mediate Recall Responses1Kenneth H. Ely, Alan D. Roberts, and David L. Woodland 2Previous studies have shown that long-lived memo
Emory - QUEREC - 2
Regulation of Dendritic Cell Migration to the Draining Lymph Node: Impact on T Lymphocyte Trafc and PrimingAlfonso Martn-Fontecha,1 Silvia Sebastiani,1 Uta E. Hpken,2 Mariagrazia Uguccioni,1 Martin Lipp,2 Antonio Lanzavecchia,1 and Federica Sallusto
Emory - CHOO - 2
IMMUNOBIOLOGYIL-15 induces antigen-independent expansion and differentiation of human naive CD8 T cells in vitroNuno L. Alves, Berend Hooibrink, Fernando A. Arosa, and Rene A. W. van Lier Recent studies in mice have shown that although interleuk
Emory - EVANS - 2
Immunity, Vol. 19, 413423, September, 2003, Copyright 2003 by Cell PressMolecular Characterization, Reactivation, and Depletion of Latent HIVDavid G. Brooks,1,2 Dean H. Hamer,4 Philip A. Arlen,1 Lianying Gao,2 Greg Bristol,2 Christina M.R. Kitchen
Emory - GRAY - 2
Veterinary Immunology and Immunopathology 93 (2003) 169176The role of WC1 gd T-cells in the delayed-type hypersensitivity (DTH) skin-test reaction of Mycobacterium bovis-infected cattleH.E. Kennedya, M.D. Welshb,*, J.P. Cassidyc, D.G. Brysonb, F.
Emory - IBS - 574
gernert@emory.edu_0002Alignment 1 Seqs: human/mouse Criteria: 75%, 100 bp Regions: 0 X-axis: human Resolution: 15 Window size: 100 bp gene exon UTR CNS mRNA Repeats: LINE LTR SINE RNA DNA OtherAF5q31/AF4100%75%05001000150020002500
Emory - IBS - 574
gernert@emory.edu_0003Alignment 1 Seqs: human/mouse Criteria: 75%, 100 bp Regions: 41 X-axis: human Resolution: 15 Window size: 100 bp gene exon UTR CNS mRNA Repeats: LINE LTR SINE RNA DNA OtherAF5q31/AF4100%75%05001000150020002500
Emory - IBS - 574
gernert@emory.edu_0001Alignment 1 Seqs: human/mouse Criteria: 75%, 100 bp Regions: 30 X-axis: human Resolution: 39 Window size: 100 bp gene exon UTR CNS mRNA Repeats: LINE LTR SINE RNA DNA OtherKIA0076CGI-22SRF_UNK.1100%75%0k1k2k3k
SUNY College of Environmental Science and Forestry - PRE - 2003
Honor Roll of Donors 2000-2001Inside ESF is published four times each year for alumni and friends of the SUNY College of Environmental Science and Forestry.SUNY-ESF 1 Forestry Drive Syracuse, NY 13210-2778 www.esf.edu President: Cornelius B. Murph
Emory - RSPATE - 2
ARTICLE IN PRESSJournal of Theoretical Biology 234 (2005) 201212 www.elsevier.com/locate/yjtbiFinding optimal vaccination strategies for pandemic inuenza using genetic algorithmsRajan Patel, Ira M. Longini Jr., M. Elizabeth HalloranDepartment o
Emory - IBS - 700
PileUp Name: VDR_HUMAN/232-394 Name: PPAT_HUMAN/285-444 Name: RXRA_HUMAN/270-429 Name: PRGR_HUMAN/720-884 Name: Q20832/185-380/VDR_HUMAN/232-394 DLVSYSIQKVIGFAK-MIPGFRDLTS-EDQIVLLKSSAIEVIMLRSNESFPPAT_HUMAN/285-444 FRSVEAVQEITEYAK-SIP