Course Hero has millions of student submitted documents similar to the one
below including study guides, practice problems, reference materials, practice exams, textbook help and tutor support.
Find millions of documents on Course Hero - Study Guides, Lecture Notes, Reference Materials, Practice Exams and more.
Course Hero has millions of course specific materials providing students with the best way to expand
their education.
Below is a small sample set of documents:
Emory - CD - 8
REPORTS36. 37. 38. 39. 40. agarose beads (2.5 l) were used in a standard RNAi reaction at 37C. G. Hutvagner, P. D. Zamore, unpublished data. E. Billy, V. Brondani, H. Zhang, U. Muller, W. Filipowicz, Proc. Natl. Acad. Sci. U.S.A. 98, 14428 (2001).
Emory - JULY - 7
R5 HIV productively infects Langerhans cells, and infection levels are regulated by compound CCR5 polymorphismsTatsuyoshi Kawamura*, Forrest O. Gulden, Makoto Sugaya*, David T. McNamara, Debra L. Borris*, Michael M. Lederman, Jan M. Orenstein, Peter
Emory - JULY - 7
Journal of General Virology (2003), 84, 16491661DOI 10.1099/vir.0.19110-0ReviewMechanisms of CD4+ T lymphocyte cell death in human immunodeciency virus infection and AIDSJudie B. Alimonti, T. Blake Ball and Keith R. FowkeDepartment of Medical
Emory - JUNE - 30
Rapid evolution of the neutralizing antibody response to HIV type 1 infectionDouglas D. Richman*, Terri Wrin, Susan J. Little*, and Christos J. Petropoulos*Departments of Pathology and Medicine, Veterans Affairs San Diego Healthcare System and the
Emory - JUNE - 16
International Immunology, Vol. 15, No. 7, pp. 861870 doi: 10.1093/intimm/dxg082 2003 The Japanese Society for ImmunologyLIGHT-deciency impairs CD8+ T cell expansion, but not effector functionJinqi Liu1, Clint S. Schmidt2, Feisha Zhao1, Angela J.
Emory - JUNE - 30
NEWS AND VIEWShas highlighted the existence of a functional barrier in the membrane of polarized neurons during development and underscores the importance of further studies on membrane heterogeneity for better understanding of neuronal functions.C
Emory - JUNE - 16
A role for Z-DNA binding in vaccinia virus pathogenesisYang-Gyun Kim*, Maneesha Muralinath, Teresa Brandt, Matthew Pearcy, Kevin Hauns, Ky Lowenhaupt*, Bertram L. Jacobs , and Alexander Rich**Department of Biology, Massachusetts Institute of Techno
Emory - JUNE - 16
International Immunology, Vol. 15, No. 7, pp. 885892 doi: 10.1093/intimm/dxg087 2003 The Japanese Society for ImmunologyEffector T cells have a lower ligand afnity threshold for activation than naive T cellsKazuhiko Kimachi1, Katsuji Sugie2 and
Emory - JUNE - 16
Protection and compensation in the influenza virus-specific CD8 T cell responseRichard J. Webby*, Samita Andreansky, John Stambas, Jerold E. Rehg, Robert G. Webster*, Peter C. Doherty, and Stephen J. TurnerDepartments of *Infectious Diseases, Immun
Emory - JUNE - 30
Stepwise cytoskeletal polarization as a series of checkpoints in innate but not adaptive cytolytic killing Christoph Wulng*, Bozidar Purtic, Jennifer Klem, and John D. Schatzle*Center for Immunology, Departments of Cell Biology and Pathology, Unive
Emory - JUNE - 16
A ligand-binding pocket in the dengue virus envelope glycoproteinYorgo Modis*, Steven Ogata, David Clements, and Stephen C. Harrison**Howard Hughes Medical Institute, Childrens Hospital and Harvard Medical School, 320 Longwood Avenue, Boston, MA 02
Emory - CD - 8
REPORTSRequirement for CD4 T Cell Help in Generating Functional CD8 T Cell MemoryDevon J. Shedlock and Hao Shen*Although primary CD8 responses to acute infections are independent of CD4 help, it is unknown whether a similar situation applies to s
Emory - JUNE - 16
Specific Nature of Cellular Immune Responses Elicited by Chimpanzees Against HIV-1Sunita S. Balla-Jhagjhoorsingh, Ernst J. Verschoor, Natasja de Groot, Vera J. P. Teeuwsen, Ronald E. Bontrop, and Jonathan L. HeeneyABSTRACT: Recent epidemiologic and
Emory - CD - 8
REPORTSindependent. It remains to be determined if help in this case involves direct CD40CD40L interaction between CD4 and CD8 cells, as suggested for TH-dependent antigens (6). Elucidation of the mechanism will help us better understand the develop
Emory - TUTHILL - 2
REPORTSnumber corresponds to a bulk resistivity of 2.4 10 6 ohm m for the silver nanowire. This nanowire is easily reproducible and has markedly higher conductivity than previously reported double-helix DNAtemplated silver nanowires (20). The 4 4 DN
Emory - SWANSON - 2
JOURNAL IMMUNOLOGYCUTTING EDGE Cutting Edge: Signaling and Cell Surface Expression of a H Chain in the Absence of 5: A Paradigm Revisited1Wolfgang Schuh,2Silke Meister,2 Edith Roth, and Hans-Martin Jack3 Pre-B cell receptor (pre-BCR) signals are
Emory - GILSON - 2
The Journal of ImmunologyIFN- Skews Monocyte Differentiation into Toll-Like Receptor 7-Expressing Dendritic Cells with Potent Functional Activities1Mohamad Mohty,* Alexandra Vialle-Castellano,* Jacques A. Nunes, Daniel Isnardon,* Daniel Olive,* an
Emory - SIEGEL - 2
JOURNAL IMMUNOLOGYCUTTING EDGE Cutting Edge: Effector Memory CD8 T Cells in the Lung Airways Retain the Potential to Mediate Recall Responses1Kenneth H. Ely, Alan D. Roberts, and David L. Woodland 2Previous studies have shown that long-lived memo
Emory - QUEREC - 2
Regulation of Dendritic Cell Migration to the Draining Lymph Node: Impact on T Lymphocyte Trafc and PrimingAlfonso Martn-Fontecha,1 Silvia Sebastiani,1 Uta E. Hpken,2 Mariagrazia Uguccioni,1 Martin Lipp,2 Antonio Lanzavecchia,1 and Federica Sallusto
Emory - CHOO - 2
IMMUNOBIOLOGYIL-15 induces antigen-independent expansion and differentiation of human naive CD8 T cells in vitroNuno L. Alves, Berend Hooibrink, Fernando A. Arosa, and Rene A. W. van Lier Recent studies in mice have shown that although interleuk
Emory - EVANS - 2
Immunity, Vol. 19, 413423, September, 2003, Copyright 2003 by Cell PressMolecular Characterization, Reactivation, and Depletion of Latent HIVDavid G. Brooks,1,2 Dean H. Hamer,4 Philip A. Arlen,1 Lianying Gao,2 Greg Bristol,2 Christina M.R. Kitchen
Emory - GRAY - 2
Veterinary Immunology and Immunopathology 93 (2003) 169176The role of WC1 gd T-cells in the delayed-type hypersensitivity (DTH) skin-test reaction of Mycobacterium bovis-infected cattleH.E. Kennedya, M.D. Welshb,*, J.P. Cassidyc, D.G. Brysonb, F.
Emory - IBS - 574
gernert@emory.edu_0002Alignment 1 Seqs: human/mouse Criteria: 75%, 100 bp Regions: 0 X-axis: human Resolution: 15 Window size: 100 bp gene exon UTR CNS mRNA Repeats: LINE LTR SINE RNA DNA OtherAF5q31/AF4100%75%05001000150020002500
Emory - IBS - 574
gernert@emory.edu_0003Alignment 1 Seqs: human/mouse Criteria: 75%, 100 bp Regions: 41 X-axis: human Resolution: 15 Window size: 100 bp gene exon UTR CNS mRNA Repeats: LINE LTR SINE RNA DNA OtherAF5q31/AF4100%75%05001000150020002500
Emory - IBS - 574
gernert@emory.edu_0001Alignment 1 Seqs: human/mouse Criteria: 75%, 100 bp Regions: 30 X-axis: human Resolution: 39 Window size: 100 bp gene exon UTR CNS mRNA Repeats: LINE LTR SINE RNA DNA OtherKIA0076CGI-22SRF_UNK.1100%75%0k1k2k3k
SUNY College of Environmental Science and Forestry - PRE - 2003
Honor Roll of Donors 2000-2001Inside ESF is published four times each year for alumni and friends of the SUNY College of Environmental Science and Forestry.SUNY-ESF 1 Forestry Drive Syracuse, NY 13210-2778 www.esf.edu President: Cornelius B. Murph
Emory - RSPATE - 2
ARTICLE IN PRESSJournal of Theoretical Biology 234 (2005) 201212 www.elsevier.com/locate/yjtbiFinding optimal vaccination strategies for pandemic inuenza using genetic algorithmsRajan Patel, Ira M. Longini Jr., M. Elizabeth HalloranDepartment o
Emory - IBS - 700
PileUp Name: VDR_HUMAN/232-394 Name: PPAT_HUMAN/285-444 Name: RXRA_HUMAN/270-429 Name: PRGR_HUMAN/720-884 Name: Q20832/185-380/VDR_HUMAN/232-394 DLVSYSIQKVIGFAK-MIPGFRDLTS-EDQIVLLKSSAIEVIMLRSNESFPPAT_HUMAN/285-444 FRSVEAVQEITEYAK-SIP
Emory - CS - 190
The Web: Concepts and TechnologyIntroduction to JavaScript Feb 31CS 584: Information Retrieval. Math & Computer Science Department, Emory University Fall 2006Todays PlanJ Javascript (contd): p ( )Fixes Debugging Compilation vs. Interpretation
Emory - ZLIU - 5
Why Does the Cyclical Behavior of Real Wages Change Over Time?Kevin X. D. Huang Kansas City Fed CIRPEE (Canada) kevin.huang@kc.frb.org Zheng Liu Emory University CIRPEE (Canada) zliu5@emory.edu Revised: December 2003 Louis Phaneuf University of Qu
Emory - ZLIU - 5
Zheng LiuFederal Reserve Bank of San Francisco 101 Market Street, MS 1130 San Francisco, CA 94105 Telephone: (415) 974-3328 E- Mail: zheng.liu@sf.frb.org Homepage: http:/userwww.service.emory.edu/~zliu5/November 2008Citizenship: U.S. Marital Stat
Emory - ZLIU - 5
Inflation Targeting: What Inflation to Target?Kevin X.D. Huang Federal Reserve Bank of Kansas City February 2004 Zheng Liu Emory UniversityAbstract This paper derives a central bank's objective function and optimal policy rule for an economy with
Emory - ZLIU - 5
Zheng LiuContact Information Department of Economics Emory University 1602 Fishburne Drive Atlanta, GA 30322 Education November 2006Telephone: (404) 727-1128 Fax: (404) 727-4639 E- Mail: zheng.liu@emory.edu URL: http:/userwww.ser
Emory - ZLIU - 5
Impact of Uncertainty and Sunk Costs on Firm Survival and Industry DynamicsVivek Ghosal* School of Economics Georgia Institute of Technology Atlanta, GA 30332 Vivek.Ghosal@econ.gatech.eduSeptember 2002AbstractThis paper examines the role played
Emory - SALT - 2000
How a strong alliance of very different partners has helped to combat iodine deficiency through the Universal Iodization of Salt. Paper to be presented at the Salt 2000 Symposium, The Hague, Netherlands, May 2000 Mr. David J. Alnwick, Dr Werner Schul
Emory - AFRICA - 08
Fluctuating Grain Prices: g An Opportunity For FortificationHye Kim Cargill, Incorporated0FFI First Africa Flour Fortification Workshop Arusha, Tanzania1FFI First Africa Flour Fortification Workshop Arusha, TanzaniaGlobal Population: Inc
Emory - CS - 424000
CS424 Problem Set 2This homework is due by 11:59pm on Friday, 2/20 (PDA exercises due on Monday, 2/23). All work should be your own and governed by the Emory Honor Code. A portion of your grade (typically no more than 10%) depends upon the clarity
Emory - CHEM - 531
CHEMISTRY 531 EXAM II SOLUTIONS Problem 1 (40 pts)a) Why is the energy degeneracy of the hydrogen 2s and 2p orbitals lifted in atoms (other than hydrogenic ones)? Which energy is lower and why? Electron-electron repulsion is greater in the 2p orbita
Emory - CHEM - 430
GENERALARTICLERamachandran and his MapC Ramakrishnan IntroductionProfessor G N Ramachandran was one of the greatest scientists India has produced during the 20th century. During his research career spanning through four decades he has contribut
Emory - CHEM - 534
General Matrix Elements iq h Hint = i i mic i(1) (2)^ A = A0e cos( k r - t )= [e i(kr -t ) + e -i (kr -t ) ] /2So, the interaction is time dependent and of the form discussed in detail Thus, the 1st order perturbation theory result for the
Emory - CHEM - 531
More on Angular Momentum2 2 2 + cot + 12 2 = h sin = ih sin + cot cos = ih cos cot sin = ih 2L2 opLx Ly Lz()2 Eigenfunctions of LopFirst, Lz , L2 = 0 so eigs. of L z are eigs of L2 . op opLz m ( ) = m (
Emory - CHEM - 430
Constant temperature/constant pressure MD algorithms1. 2. 3. Constant temperature: what does it really mean? Why do "constant temperature" simulations Constant temperature methods 1. Andersen method: random velocity changes 2. Berendsen method: cont
Emory - CHEM - 531
Hydrogen AtomThe Hamiltonian in spherical polar coordinates isl2 h2 2 2 Ze 2 op H= ( 2 + )+ 2 r r r r 2r2where is the square of angular momentum operator l 2 . Note that the op potential depends only on r and so H commutes with l 2 and l z .
Emory - CHEM - 430
Chem 430, Guest lecture on Monte Carlo methods James Kindt, jkindt@emory.edu periodic boundary conditions choice of move sizeMotivations for classical simulation MD vs. MC Probabilities in the canonical (NVT) ensemble Importance sampling: a
Emory - CHEM - 534
Chemistry 534 Exam II Solutions1. In an octahedral complex of Co3+ (point group Oh) the ground electronic state transforms as A1g and is a singlet. [This central ion is surrounded by six ligands, e.g., Co3+(CO)6] a) Are transitions to the excited s
Emory - CHEM - 531
Perturbation Theory (contd)Insert( ( En = En0 ) + En1 ) + 2 E(n2 )(1)( ( n = n 0 ) + n1 ) + 2 (n2 )(2)into( H0 + V En ) n = 0and separate terms according to powers of .( ( 0 : H0 En 0 ) n 0 )(3)()3 by assumption(4)( ( (
Emory - CHEM - 534
Fundamentals of Quantization of Electromagnetic Radiations We have already introduced the H.O. picture of photons in a discussion of the Planck radiation law. To do this more rigorously we need to return to the H.O. and develop the quantum solutions
Emory - CHEM - 534
Details on Matrix Diagonalization FC = C Consider a 2x2 example: F 11 F21 F C11 C12 C11 C12 1 0 12 = F22 C21 C22 C 21 C22 0 2 F11 F21 F11 F21 F12 C11 C11 = 1 F22 C21 C21 F12 C12 C12 = 2 F22 C22 C22
Emory - CHEM - 534
CLEBSCH-GORDON COEFFICIENTS Classically two angular momenta add vectorially to form a resultant total angular momentum. Thus, classicallyj3 = j1 + j2 and each component adds as usual, i.e., j3x = j1x + j2x j3y = j1y + j2y and j3z = j1z + j2z Also,
Emory - CHEM - 534
ELECTRONIC SPECTROSCOPY (Study pp. 362-365 in MQM) As already described the matrix element for a ro-vibronic transition is given in the dipole approximation by of the texte' v' J' K' M' d evJKM = v' J' K' M' e'e vJKM ,where we have made the Born-O
Emory - CHEM - 531
CHEMISTRY 531 EXAM I SOLUTIONS1. Consider a particle of mass m in a two-dimensional box of dimensions Lx = Ly = La) Give the normalized wavefunctions in Cartesian coordinates, the energy eigenvalues, and the degeneracy of the first four energy le
Emory - CHEM - 534
The Photon GasThe total energy density (energy per unit volume) of an electromagnetic field is given by E(t) +B(t) , where E and B are the electric and magnetic fields. The sum of these terms is a constant (in the absence of absorption.) We can make
Emory - CHEM - 531
PERTURBATION THEORYAssume H can be written as = 0 + V Also, assume we know the eigenfunctions and eigenvalues of 0 . Thus, 0 ( 0 ) = E (k0 ) (0) k k (k 0 ) are termed the zero-order eigenfunctions;(0) E k are termed the zero-order eigenvalue
Emory - CHEM - 534
ELECTRONIC SPECTROSCOPY IIAs already described the matrix element for a ro-vibronic transition is given in the dipole approximation bye' v' J' K' M' d evJKM = v' J' K' M' e'e vJKM ,where we have made the Born-Oppenheimer approximation and(1)
Emory - CHEM - 531
Basics of QMClassical Recap p2 H H V +V(q); q = ; p= = 2m p q qH=Quantum Mechanics pop2 - one degree of freedom + V ( q ) ; pop = ih 2m qHop =h2 2 Hop = + V (q); pop = ih = ih( x + y + z) - 3dof 2m x y yThe Schrdinger equation(
Emory - CHEM - 534
EXAM I: SOLUTIONSChem 534 Spring 2002 Problem 1 a) b) In 3D there are 9 normal modes, of which 5 are of zero frequency. In 1D there are N normal modes, where N equals the number of atoms. Thus for CO2 there are 3 normal modes. The 6 missing modes a
Emory - CHEM - 534
Rovibrational transitions in Polyatomics Consider the dipole matrix element between two vibration/rotation states of a molecule v' J' M ' K ' vJMK , where v stands for the 3N-6 set of vibrational quantum numbers and the rotational notation is for a s
Emory - CHEM - 534
Extra lecture on vibrating-rotor Exact Hamiltonian in spherical polar coordinates2 jop ( , ) h 2 2 2 H= 2 2 +R + 2 + V ( R) , R R 2 R(1)where R is the diatom internuclear distance, and 0 R . Since V does not depend on asor , the exact w
Emory - CHEM - 534
LASERS IIThe Ruby laser is an example of a 3-level laser, even though 4 energy states were indicated. Explanation:3-level laser (minimum no. of levels)E3radiationless decayE2excitationlaser emissionE1Population inversion formed in level
Emory - CHEM - 534
Fermis Golden Rule Timedependent perturbation treatmentReview: A multi-Level System in an Electro-magnetic field Lets consider a multi-level system interacting with an electromagnetic field. Under the electric dipole approximation (to be defined i
Emory - CHEM - 534
NORMAL MODE ANALYSIS OF THE VIBRATIONS OF MOLECULES & CLUSTERSI.Thoery of "small amplitude" vibrations Classical QuantumII.Examples HCO Si(100)-(2x1)III.What about anharmonicity and coupling? Thoery Some examplesVibrations: Normal