8 Pages

Wodarz.03.JGV.84.1743

Course: JULY 7, Fall 2009
School: Emory
Rating:
 
 
 
 
 

Word Count: 5969

Document Preview

of Journal General Virology (2003), 84, 17431750 DOI 10.1099/vir.0.19118-0 Hepatitis C virus dynamics and pathology: the role of CTL and antibody responses Dominik Wodarz Correspondence Dominik Wodarz wodarz@fhcrc.org Fred Hutchinson Cancer Research Center, 1100 Fairview Avenue North, MP-665, Seattle, WA 98109, USA Received 22 January 2003 Accepted 2 April 2003 This paper investigates the role of CTL and...

Register Now

Unformatted Document Excerpt

Coursehero >> Georgia >> Emory >> JULY 7

Course Hero has millions of student submitted documents similar to the one
below including study guides, practice problems, reference materials, practice exams, textbook help and tutor support.

Course Hero has millions of student submitted documents similar to the one below including study guides, practice problems, reference materials, practice exams, textbook help and tutor support.
of Journal General Virology (2003), 84, 17431750 DOI 10.1099/vir.0.19118-0 Hepatitis C virus dynamics and pathology: the role of CTL and antibody responses Dominik Wodarz Correspondence Dominik Wodarz wodarz@fhcrc.org Fred Hutchinson Cancer Research Center, 1100 Fairview Avenue North, MP-665, Seattle, WA 98109, USA Received 22 January 2003 Accepted 2 April 2003 This paper investigates the role of CTL and antibody responses in hepatitis C virus (HCV) dynamics and pathology. Mathematical models suggest that a strong CTL response is required for resolution of HCV infection and that a weak CTL response can result in persistent infection. According to the model, establishment of persistent infection is accompanied mainly by an ongoing antibody response, while CTLs are not maintained at high levels. In the model, this outcome correlates with absence of pathology. Persistent infection in the face of an ongoing antibody response can result in evolution of antigenic escape. According to the model, evolution towards escape from antibodies can shift the balance of immune responses so that the weak CTL levels become increasingly more dominant relative to antibodies. This shift results in onset of liver pathology as the virus evolves towards increased levels of antigenic escape. Therefore, the relative balance of the immune response can be a decisive factor that determines whether patients are asymptomatic or whether pathology is observed. Virus evolution can shift this balance towards pathology over time. Theoretical results are discussed in the context of published data. INTRODUCTION Hepatitis C virus (HCV) infection can lead to two qualitatively different outcomes (Hoofnagle, 1999): in a small fraction of patients (15 % of cases), infection is controlled and cleared from the blood; in the rest of the patients, chronic infection is established, which eventually results in liver pathology. Disease develops after an asymptomatic phase that can last for decades. These two types of outcome are characterized by different immunological proles (Cooper et al., 1999; Lechner et al., 2000a, b, c; Thimme et al., 2001). Virus clearance after acute infection is associated with strong and polyclonal CD4 T cell responses, as well as sustained CTL responses. Signicant virus diversication is not observed in these cases. Chronic infection is characterized by weak CD4 T cell proliferative responses and the absence of sustained CTL responses. Antibody responses develop but the virus has been shown to evolve antigenic escape mutants relatively quickly (Farci et al., 2000). The role of CTL and antibody responses in HCV infection is not fully understood yet (Farci et al., 2000; Klenerman et al., 2000). According to one hypothesis, antibody responses have the potential to control infection but evolution of antigenic escape allows the virus to persist in the host. Alternatively, it can be argued that CTL responses are required to resolve the infection and that virus persistence is Published ahead of print on 22 April 2003 as DOI 10.1099/ vir.0.19118-0 caused by weak CTL responses. Persistent virus replication in the presence of an ongoing antibody response leads to the generation and selection of escape mutants. Here, a mathematical model is used to study the dynamics between HCV and both CTL and antibody responses. The dynamics during acute infection are rst examined. Next, chronic infection and the effect of virus evolution on pathology and disease progression are considered. METHODS Interactions between HCV and the immune system were studied with mathematical models. Interactions between replicating virus, liver cells and different types of immune responses (CTL and antibodies) are highly complex and non-linear. Thus, the outcome of infection is frequently counterintuitive and cannot be understood by verbal arguments. Mathematical models take us beyond verbal or graphical reasoning and provide a solid framework upon which to build experiments and generate hypotheses. The models are based on a set of assumptions that are spelled out clearly. The mathematical analysis allows us to follow these assumptions to their precise logical conclusions. Here, ordinary differential equations that describe the change of populations over time are considered. The following populations are examined: uninfected liver cells (x), free virus (v), infected liver cells (y), an antibody response (w) and a CTL response (z). The exact form of the equations will be described in the results section and the assumptions are 1743 0001-9118 G 2003 SGM Printed in Great Britain D. Wodarz Fig. 1. Schematic representation of the mathematical model. For explanation, see text. captured graphically in Fig. 1. Two sets of models are considered: the rst analyses the dynamics in the presence of a homogeneous virus population, whereas the second builds on this and includes virus evolution (i.e. mutation and selection). In particular, the evolutionary dynamics of antigenic escape are studied. RESULTS Dynamics between virus, CTL and antibodies A basic model that contains ve variables, susceptible host cells (x), infected cells (y), free virus (v), an antibody response (w) and a CTL response (z), is studied. It is explained graphically in Fig. 1 and given by a system of ordinary differential equations that describe the change of these populations over time. x=ldxbxv y=bxvaypyz v=kyuvqvw w=gvwhw z=cyzbz Susceptible host cells are produced at a rate l, die at a rate dx and become infected by virus at a rate bxv. Infected cells die at a rate ay and are killed by the CTL response at a rate pyz. Free virus is produced by infected cells at a rate ky, decays at a rate uv and is neutralized by antibodies at a rate qvw. Antibodies develop in response to free virus at a rate gvw and decay at a rate hw. CTLs expand in response to viral antigen derived from infected cells at a rate cyz and decay in the absence of antigenic stimulation at a rate bz. Infection 1744 requires that the basic reproductive ratio of the virus (R0=bkl/dau) is greater than one. In the absence of an immune response, the system converges to the following equilibria: x(0)=au/bk, y(0)= (lbkdau)/abk, v(0)=ky(0)/u, w(0)=0, z(0)=0. Now, one assumes that immune responses can potentially develop. This requires the following conditions: cy(0)>b and gv(0)>h. In this case, the three outcomes below can be observed. (i) The CTL response develops and the antibody response cannot become established. This is because the CTL response is strong and reduces virus load to levels that are too low to stimulate the antibody response. It is described by the following equilibria: x(1)=luc/(duc+bkb), y(1)=b/c, v(1)=ky(1)/u, w(1)=0, z(1)=(bx(1)v(1)ay(1))/py(1). This outcome is attained if gkb/uc<h and cbhl/[a(dg+bh)]>b. (ii) The antibody response develops and a sustained CTL response fails. This is because the antibody response is strong relative to the CTL response and reduces virus load to levels that are too low to stimulate the CTLs. This is described by the following equilibria: x(2)=lg/(dg+bh), y(2)=bhl/[a(dg+bh)], v(2)=h/g, w(2)=ky(2)uv(2)/qv(2), z(2)=0. It is attained if gkb/ uc>h and cbhl/[a(dg+bh)]<b. (iii) Both CTL and antibody responses develop. These equilibria are described by x(3)=lg/(dg+bh), y(3)=b/ c, v(3)=h/g, w(3)=ky(3)uv(3)/qv(3), z(3)=(bx(3)v(3) ay(3))/py(3). It is attained if gkb/uc>h and cbhl/ [a(dg+bh)]>b. These outcomes are thus governed by competition between CTL and antibody responses for the virus population. This is because the virus population is a resource that both CTL and antibodies require for survival. Competition can result Journal of General Virology 84 HCV dynamics and pathology either in the exclusion of one branch of the immune system or both branches may co-exist. Competition among immune responses has been documented experimentally (Borghans et al., 1999; Freitas & Rocha, 2000) and similar dynamics have been described by Arnaout & Nowak (2000). A note of clarication: while in the model, a response can go extinct because of competitive exclusion, this does not necessarily correlate with the absence of measurable responses in vivo. In practical terms, it means that one response is signicantly more dominant than the other. Many factors that are not included in the model, such as the spatial environment of the body, can result in the persistence of the competitively inferior and subdominant response at low levels. Dynamics of acute HCV infection This model assumes that, upon infection, the virus population is homogeneous and diversity has not accumulated yet. As the virus population grows, both CTL and antibody responses will start to expand. The outcome of the dynamics in acute infection depends on the relative strengths of the responses. According to the above analysis, three outcomes are possible (Fig. 2): (i) the CTL response is dominant relative to the antibody response and the CTLs will clear the infection; (ii) both the CTL and antibody responses are equally strong. This is also likely to result in resolution or clearance of infection; (iii) the CTL response is weak relative to the antibody response. Thus, the antibody response dominates. If one assumes that HCV is weakly cytopathic (Layden et al., 1999, 2000; Neumann et al., 1998), the antibody response is unlikely to clear the infection. The reason is that while free virus particles are removed, a relatively large pool of infected cells remains because they do not become killed. Hence, the result is persistent infection in the presence of an ongoing antibody response. If the virus does persist, the model suggests further that the host will be asymptomatic. The reason is that this scenario is associated with the dominance of an antibody response. The degree of pathology is measured by the number of liver cells. A persistent infection with a weakly cytopathic virus in the presence of an antibody response does not cause signicant tissue damage because there is little killing of virus-infected cells. To summarize, if the virus is assumed to be weakly cytopathic, the model suggests that a strong and sustained CTL response is required to clear the infection. CTLmediated clearance of infection can also be associated with the presence of antibody responses if these are sufciently strong. On the other hand, if CTL responses are weak, persistent infection in the face of a dominant and ongoing antibody response is observed. The model suggests further that this persistent infection is initially asymptomatic. The notion that sustained T cell responses are required to control Fig. 2. Dynamics during acute infection. (a) The CTL response is strong relative to the antibody response. Thus, a sustained CTL response develops while the antibody response does not become fully established. The outcome is virus clearance. (b) Both CTL and antibody responses are sufciently strong to become fully established. Again, the outcome is virus clearance. (c) The CTL response is weak relative to the antibody response. The result is persistent infection in the presence of an ongoing antibody response. The CTL response is not sustained. Parameters were chosen as follows: l=10; d=0?1; b=0?01; a=0?1; p=1; k=1; u=1; q=1; h=0?1; and b=0?1. (a) g=0?5, c=1; (b) g=1?5, c=1; (c) g=1, c=0?1. http://vir.sgmjournals.org 1745 D. Wodarz HCV infection is strongly supported by experimental and clinical studies (Cooper et al., 1999; Lechner et al., 2000c; Thimme et al., 2001). How virus evolution inuences the dynamics between HCV and the immune responses is investigated from acute infection through the chronic phase, assuming that the CTL response is weak. As outlined above, a weak CTL response Dynamics of chronic HCV infection To examine how this initially asymptomatic persistent infection can change, resulting in the development of liver pathology, the effect of virus evolution towards escape from antibody responses is examined. The following model extends the previous analysis to include virus escape from antibodies. n X i~1 x~j{dx{bx vi yi ~bxvi {ayi {pyi z vi ~kyi {uvi {qvi wi wi ~gvi wi {hwi z~cz n X i~1 yi {bz The model assumes that n virus variants can be generated. These variants vary in antibody epitopes. Antibody escape has been studied mostly in the context of the hypervariable region 1 but the model description applies to any mutation that confers resistance to antibodies. For simplicity, one may assume that the variants only differ in their antibody epitopes; otherwise, they are identical (for example, they replicate at the same rate). The results do not, however, depend on this simplication. Viruses of strain i are denoted by vi and cells infected with strain i are denoted by yi (i=1..n). Each virus strain can elicit an antibody response that is specic for this strain, wi. For simplicity, one may assume that the strength of the antibody response against the individual variants is identical. While the antibody response against the different variants is likely to be characterized by different efcacies, the dynamics in question are not changed by this simplication. A CTL response is also included in the model. It is assumed that the CTL response is cross-reactive and can recognize all antibody escape variants. For the present arguments, antigenic escape from CTL responses does not need to be considered in the model. 1746 Fig. 3. Chronic infection dynamics and virus evolution. The dynamics of virus population, antibody response and CTL response over time. It is assumed that the CTL response is weak. Thus, persistent infection develops in the presence of an ongoing antibody response. The presence of antibodies results in the emergence of antibody escape mutants. Each peak of the virus population corresponds to the emergence of a new escape mutant (shown in different colours). The antibody response adapts to these new variants by creating new specicities. As the virus population evolves towards increased diversity, the weak CTL response expands. This coincides with a reduction in antibody responses. Once the CTL response becomes more dominant, liver pathology can set in. A note on the side: as the virus population evolves over time and diversity develops, the individual variants settle at an equilibrium level that is lower than the peaks of the variants. Thus, if new virus variants are produced at a relatively fast rate, measurements of virus load might capture these peaks rather than the lower equilibrium level. Parameters were chosen as follows: l=1; d=0?1; b=0?03; a=0?1; p=1; k=2?5; u=2; q=1; g=2; h=0?1; c=0?1; and b=0?2. Journal of General Virology 84 HCV dynamics and pathology can result in persistent infection and this leads to the dominance of antibody responses (Fig. 3). Because of persistent replication, variants that escape the antibodies evolve. These new variants, in turn, elicit new antibody responses and, in this way, increased antigenic diversity develops over time (Fig. 3). The outcome of infection as a function of the number of virus strains, n, is given by the following equilibria: x(4)=lg/(dg+nbh), yi(4)=blh/ [a(dg+nbh)], vi(4)=h/g, wi(4)=kyi(4)uvi(4)/qvi(4), z(4)=0. Thus, as the virus population evolves, virus load increases slightly due to the accumulation of antigenic variants and the antibody response broadens as a result of this diversication. The overall number of liver cells is, however, predicted to remain constant, which corresponds to absence of pathology (Fig. 4). These dynamics change if the number of antigenic variants crosses a threshold given by n>badg/ ([bh(clba)]. If this condition is fullled, the CTL response can expand and increase in dominance relative to the antibody response (Fig. 3). Thus, while the CTL responsiveness is weak, the accumulation of mutants that escape from the antibodies increases antigenic drive and this promotes increased expansion of the weak CTL response. However, this CTL response contributes little to virus control. Instead, it marks the beginning of liver pathology (Fig. 4): CTLs kill the infected cells and can thus contribute to tissue damage (Chang et al., 1997). Invasion of the CTL response after accumulation of antigenic diversity is described by the following equilibria: x(5)=lg/(dg+nbh), yi(5)=b/nc, vi(5)=h/g, wi(5)=(kgbnuhc)/ncqh, z(5)= [nbh(lcab)dgab]/[pb(dg+nbh)]. The degree of pathology that results from CTL invasion is a function of the number of virus strains (Fig. 4). Continued escape from antibody responses shifts the balance between antibodies and CTLs further towards the CTLs. Since antibodies prevent and CTLs induce tissue pathology, the amount of liver damage increases with the accumulation of antibody escape variants. When the number of antigenic variants crosses a threshold, the CTL response attains maximum dominance relative to the antibody response. This threshold is given by n>gkb/ uch. At this point, CTL-induced pathology is expected to be at its maximum (Fig. 4). Furthermore, as this threshold is attained, virus evolution is expected to stop, because target cell limitation does not allow invasion of additional virus variants in the face of signicant liver destruction. Note in Figs 3 and 4 that there is no signicant change in virus load as the dynamics progress from the asymptomatic phase towards liver destruction. This suggests that the development of disease will not correlate signicantly with levels of virus load. DISCUSSION This paper has used mathematical models in order to examine the role of CTL and antibody responses in HCV dynamics and disease progression. Assumptions of the models are based on data from natural infection and the models explore the consequences of these assumptions for the acute phase and for disease progression in the context http://vir.sgmjournals.org Fig. 4. Outcome of chronic infection as a function of the number of antibody escape mutants, n. Equilibrium values of virus load, immune responses and the percentage of liver cells are plotted. Accumulation of virus diversity allows the CTL response to expand. CTLs can induce liver damage. As the number of antibody escape mutants increases, liver damage becomes stronger. This can correspond to disease progression and to an increase in liver damage over time. While the equilibrium values give us a good idea of how the outcome of infection depends on the number of antibody escape variants, the actual population sizes can be different if the escape dynamics are sufciently fast so that the equilibrium will not be visible (see Fig. 3). The general trend, however, remains robust. Parameters were chosen as follows: l=10; d=0?1; b=0?03; a=0?1; p=1; k=2?5; u=5; q=1; g=10; h=0?1; c=0?01; and b=0?2. of virus evolution. The model accounts for many observations about the dynamics between HCV and the immune system and gives rise to some new insights regarding the relationship between virus evolution, the balance of immune responses and pathogenesis. The model suggests the following patterns. CTL responses are required to clear the infection. If they fail to clear the infection, however, CTLs are responsible for causing liver pathology. Antibody responses are unlikely to clear the 1747 D. Wodarz infection. This is because the virus is thought to be weakly cytopathic and infected cells are not killed at fast a enough rate. Antibody responses are, however, responsible for preventing liver pathology and for keeping the persistent infection asymptomatic. Dominance of antibodies over CTLs ensures that CTL-induced liver destruction is avoided. In general, a weak CTL response can cause tissue destruction if virus replication is not slowed down (Wodarz et al., 2002). Non-lytic immunity slows down the replication kinetics of the virus and thus prevents the occurrence of tissue pathology (Wodarz et al., 2002). Therefore, the model suggests that following the acute phase, a persistent infection develops if CTL responses are weak. Furthermore, antibodies will initially dominate and this results in absence of symptoms. This dominance in the model is due to competition of the immune responses for the virus population. Virus evolution towards escape from antibody responses, however, allows the weak CTL response to increase relative to the antibody response. This is because accumulation of virus diversity increases the antigenic drive. Note that while this can cause pathology, the model suggests that the degree of increase in the number of CTLs is low because the response is weak. It might, therefore, be difcult to nd evidence for this in clinical data. Of further note is that non-specic T cells can also inltrate the liver and contribute to pathology and this has not been included in the model. The overall message of the model is that evolution of escape from antibodies paves the way for disease progression and liver pathology by shifting the balance of immunity in favour of lytic responses. This is supported by data from immunosuppressed patients who show faster disease progression (McCaughan & Zekry, 2000; Einav & Koziel, 2002). Such patients are characterized by a deciency of antibodies. The disease might be caused by weak CTL responses, which may be maintained after acute infection and cause progressive tissue damage. A possible scenario not captured in the model is that the inoculum upon infection is not a homogeneous virus population, but characterized by some degree of antigenic diversity. This might also speed up disease progression. The modelling framework helps us understand and interpret experimental data on immune responses against HCV. The role of CTLs and antibodies for the resolution of HCV infection is debated in the literature (Klenerman et al., 2000). Studies of the acute phase of the infection showed that both humans and chimpanzees who cleared the virus from blood developed strong and sustained CTL responses (Chang et al., 2001; Cooper et al., 1999; Lechner et al., 2000a, b, c; Thimme et al., 2001). In chimpanzee studies, CTLmediated clearance is associated with the absence of strong antibody responses (Cooper et al., 1999) and this supports the notion of competition between the two branches of the immune system. Humans and chimpanzees who developed persistent infection were characterized by an initial CTL response that was not sustained at high levels beyond the acute phase of infection (Cooper et al., 1999; Lechner et al., 1748 2000a, b, c; Thimme et al., 2001). Persistent infection has, however, been observed to be associated with vigorous antibody responses (Farci et al., 2000; Major et al., 1999), again pointing to the occurrence of competition. Thus, it was argued that a strong CTL response is crucial for the resolution of infection. The theoretical results presented here agree with this conclusion. On the other hand, it has been argued that antibody responses are crucial for deciding the outcome of infection (Farci et al., 2000). Farci et al. (2000) showed that patients who resolved the infection showed evolutionary stasis in the virus population. Patients who developed chronic infection showed accumulation of genetic variation in antibody epitopes. It was concluded that escape from antibody responses allows the virus to persist. The importance of virus evolution for persistence has also been stressed by others (Forns et al., 1999; Weiner et al., 1992). The theory presented here argues that antigenic escape might not be the reason for virus persistence, but the consequence of virus persistence. Continued productive infection in the presence of an immune response is the most efcient scenario for the evolution of antigenic escape (Wodarz & Nowak, 2000). This argument does not, however, diminish the importance of antibodies in HCV infection. If a persistent infection is established, the model suggests that antibodies are crucial for keeping the patient asymptomatic and that escape from antibodies allows the balance of immune responses to be shifted in favour of a weak CTL response, which causes liver pathology. Thus, the importance of different types of immune responses should be considered in a broader setting than just in the context of clearing virus during acute infection. The relative balance of antibody and CTL responses can be crucial for deciding whether the persistent infection remains asymptomatic or whether pathology is observed. A central concept in this analysis is that virus evolution towards escape from antibodies might drive disease progression. This concept is very difcult to test with data. Studies have quantied sequence diversity and the rate of virus evolution in patients who differ in the severity of liver disease (Cabot et al., 2000; Curran et al., 2002; Farci, 2001; Lyra et al., 2002; Major et al., 1999; Thomson et al., 2001). Even if virus evolution does drive disease progression as suggested here this does not mean that one would expect higher virus diversity or faster evolution in patients with severe compared to mild disease. The amount of virus diversity and the rate of evolution is a complex function of the degree of immune-mediated virus suppression, virus load and the number of susceptible host cells (Wodarz & Nowak, 2000). If virus load is suppressed efciently, reduced replication does not allow a fast accumulation of mutations. On the other hand, immune-mediated suppression of the virus allows for the co-existence of different antigenic variants (Regoes et al., 1998). If immune responses are diminished, however, competition between virus strains becomes an important factor that can lead to a reduction in virus diversity (Nowak et al., 1991). Moreover, as the number of susceptible cells becomes limiting for example, Journal of General Virology 84 HCV dynamics and pathology because of liver destruction virus evolution may slow down or stop because new antigenic variants cannot invade (Regoes et al., 1998). Therefore, if pathology develops as a result of virus evolution towards antigenic escape, it is possible that patients with severe disease show reduced levels of virus diversication and evolution compared to patients with milder disease. Data on virus diversity have given rise to different and contradictory results (Cabot et al., 2000; Curran et al., 2002; Farci, 2001; Lyra et al., 2002; Major et al., 1999; Thomson et al., 2001). Studies with HCV-infected patients report the emergence of antibody escape mutants early after infection (Farci et al., 2000), while data from the chimpanzee model argue against the frequent occurrence of antibody escape mutants during the early stages of the infection (Major et al., 1999). While the chimpanzee data argue against a role of escape for virus persistence, this study does not address the role of escape for disease progression, which occurs over a much longer period of time. Curran et al. (2002) reported a consistent accumulation of amino acid-changing substitutions in patients with mild liver disease. In patients with severe liver disease, however, they reported signicantly lower rates of virus evolution. The observation that the virus continuously evolves in patients with mild disease supports the notion that ongoing virus evolution can eventually shift the dynamics towards pathology. A reduced rate of evolution in patients with severe disease is also consistent with the theoretical arguments presented here. As severe pathology develops, the number of susceptible host cells is reduced and this can prevent invasion of further antigenic variants. The hypothesis that virus evolution can drive disease progression is supported further by the observation that the population diversity, as well as the ratio of amino acid changing to silent substitutions was higher in individuals with severe liver disease (Cabot et al., 2000; Curran et al., 2002). Similar patterns have been observed in studies of virus evolution following liver transplants in patients with mild and severe disease (Lyra et al., 2002). Investigation of the expected patterns of diversity and rates of evolution in patients with different severity of disease under various assumptions will benet from further mathematical modelling. Another factor that can inuence patterns of virus evolution is the ability of the specic immune responses to adapt to the changing virus population. The model assumes that new escape variants can always trigger new antibody specicities. Therefore, the virus continuously evolves away from the immune response. Clinical data from HCV-infected patients suggest that specic CD4 T helper cell responses are impaired (Lechner et al., 2000c). Helper cell impairment can, in turn, compromise the ability of the neutralizing antibody response to adapt to new virus variants (Klenerman et al., 2000). If this happens, virus evolution towards increased antigenic diversity in antibody epitopes is expected to stop. It is not clear for how long the antibody response can continue to adapt to the virus population. As the disease progresses, the antibody response is more likely to fail to adapt to the virus population. This could also http://vir.sgmjournals.org contribute to the reduced rate of evolution seen in HCVinfected patients with severe liver disease. It is an interesting observation that accumulation of antigenic diversity and the development of disease do not correlate with a signicant increase in virus load in the model. Upon development of symptoms, virus load may be relatively small: while CTLs induce pathology in the model, they can suppress viraemia to a certain degree at the same time. Variations in virus load observed between patients is thus unlikely to be due to differences in the amount of antigenic diversity and disease status but to differences in other host parameters. Hence, the model suggests that there is no obvious correlation between pathology and virus load. This is consistent with clinical data (de Araujo et al., 2002; Manzin et al., 1997; Pontisso et al., 1999; Puoti et al., 1999). Finally, it is important to note that a simplied scenario was used, as antigenic variation was included only in the context of antibody responses but not in the context of CTL responses. Once the weak CTL responses become more prevalent following virus evolution, escape from CTL responses is also very likely to occur. This can enhance virus replication and tissue pathology further. However, it is not essential for the shift in balance between antibody and CTL and is hence not essential for the initial occurrence of liver pathology. Conclusion In this paper, a theoretical framework that explores the role of virus evolution for disease progression in HCV infection is put forward. The models point to the importance of the balance of immune responses for determining whether a patient remains asymptomatic or whether pathology is observed. Virus evolution can shift the balance of immune responses from a state where antibody responses prevent the development...

Find millions of documents on Course Hero - Study Guides, Lecture Notes, Reference Materials, Practice Exams and more. Course Hero has millions of course specific materials providing students with the best way to expand their education.

Below is a small sample set of documents:

Emory - CD - 8
REPORTS36. 37. 38. 39. 40. agarose beads (2.5 l) were used in a standard RNAi reaction at 37C. G. Hutvagner, P. D. Zamore, unpublished data. E. Billy, V. Brondani, H. Zhang, U. Muller, W. Filipowicz, Proc. Natl. Acad. Sci. U.S.A. 98, 14428 (2001).
Emory - JULY - 7
R5 HIV productively infects Langerhans cells, and infection levels are regulated by compound CCR5 polymorphismsTatsuyoshi Kawamura*, Forrest O. Gulden, Makoto Sugaya*, David T. McNamara, Debra L. Borris*, Michael M. Lederman, Jan M. Orenstein, Peter
Emory - JULY - 7
Journal of General Virology (2003), 84, 16491661DOI 10.1099/vir.0.19110-0ReviewMechanisms of CD4+ T lymphocyte cell death in human immunodeciency virus infection and AIDSJudie B. Alimonti, T. Blake Ball and Keith R. FowkeDepartment of Medical
Emory - JUNE - 30
Rapid evolution of the neutralizing antibody response to HIV type 1 infectionDouglas D. Richman*, Terri Wrin, Susan J. Little*, and Christos J. Petropoulos*Departments of Pathology and Medicine, Veterans Affairs San Diego Healthcare System and the
Emory - JUNE - 16
International Immunology, Vol. 15, No. 7, pp. 861870 doi: 10.1093/intimm/dxg082 2003 The Japanese Society for ImmunologyLIGHT-deciency impairs CD8+ T cell expansion, but not effector functionJinqi Liu1, Clint S. Schmidt2, Feisha Zhao1, Angela J.
Emory - JUNE - 30
NEWS AND VIEWShas highlighted the existence of a functional barrier in the membrane of polarized neurons during development and underscores the importance of further studies on membrane heterogeneity for better understanding of neuronal functions.C
Emory - JUNE - 16
A role for Z-DNA binding in vaccinia virus pathogenesisYang-Gyun Kim*, Maneesha Muralinath, Teresa Brandt, Matthew Pearcy, Kevin Hauns, Ky Lowenhaupt*, Bertram L. Jacobs , and Alexander Rich**Department of Biology, Massachusetts Institute of Techno
Emory - JUNE - 16
International Immunology, Vol. 15, No. 7, pp. 885892 doi: 10.1093/intimm/dxg087 2003 The Japanese Society for ImmunologyEffector T cells have a lower ligand afnity threshold for activation than naive T cellsKazuhiko Kimachi1, Katsuji Sugie2 and
Emory - JUNE - 16
Protection and compensation in the influenza virus-specific CD8 T cell responseRichard J. Webby*, Samita Andreansky, John Stambas, Jerold E. Rehg, Robert G. Webster*, Peter C. Doherty, and Stephen J. TurnerDepartments of *Infectious Diseases, Immun
Emory - JUNE - 30
Stepwise cytoskeletal polarization as a series of checkpoints in innate but not adaptive cytolytic killing Christoph Wulng*, Bozidar Purtic, Jennifer Klem, and John D. Schatzle*Center for Immunology, Departments of Cell Biology and Pathology, Unive
Emory - JUNE - 16
A ligand-binding pocket in the dengue virus envelope glycoproteinYorgo Modis*, Steven Ogata, David Clements, and Stephen C. Harrison**Howard Hughes Medical Institute, Childrens Hospital and Harvard Medical School, 320 Longwood Avenue, Boston, MA 02
Emory - CD - 8
REPORTSRequirement for CD4 T Cell Help in Generating Functional CD8 T Cell MemoryDevon J. Shedlock and Hao Shen*Although primary CD8 responses to acute infections are independent of CD4 help, it is unknown whether a similar situation applies to s
Emory - JUNE - 16
Specific Nature of Cellular Immune Responses Elicited by Chimpanzees Against HIV-1Sunita S. Balla-Jhagjhoorsingh, Ernst J. Verschoor, Natasja de Groot, Vera J. P. Teeuwsen, Ronald E. Bontrop, and Jonathan L. HeeneyABSTRACT: Recent epidemiologic and
Emory - CD - 8
REPORTSindependent. It remains to be determined if help in this case involves direct CD40CD40L interaction between CD4 and CD8 cells, as suggested for TH-dependent antigens (6). Elucidation of the mechanism will help us better understand the develop
Emory - TUTHILL - 2
REPORTSnumber corresponds to a bulk resistivity of 2.4 10 6 ohm m for the silver nanowire. This nanowire is easily reproducible and has markedly higher conductivity than previously reported double-helix DNAtemplated silver nanowires (20). The 4 4 DN
Emory - SWANSON - 2
JOURNAL IMMUNOLOGYCUTTING EDGE Cutting Edge: Signaling and Cell Surface Expression of a H Chain in the Absence of 5: A Paradigm Revisited1Wolfgang Schuh,2Silke Meister,2 Edith Roth, and Hans-Martin Jack3 Pre-B cell receptor (pre-BCR) signals are
Emory - GILSON - 2
The Journal of ImmunologyIFN- Skews Monocyte Differentiation into Toll-Like Receptor 7-Expressing Dendritic Cells with Potent Functional Activities1Mohamad Mohty,* Alexandra Vialle-Castellano,* Jacques A. Nunes, Daniel Isnardon,* Daniel Olive,* an
Emory - SIEGEL - 2
JOURNAL IMMUNOLOGYCUTTING EDGE Cutting Edge: Effector Memory CD8 T Cells in the Lung Airways Retain the Potential to Mediate Recall Responses1Kenneth H. Ely, Alan D. Roberts, and David L. Woodland 2Previous studies have shown that long-lived memo
Emory - QUEREC - 2
Regulation of Dendritic Cell Migration to the Draining Lymph Node: Impact on T Lymphocyte Trafc and PrimingAlfonso Martn-Fontecha,1 Silvia Sebastiani,1 Uta E. Hpken,2 Mariagrazia Uguccioni,1 Martin Lipp,2 Antonio Lanzavecchia,1 and Federica Sallusto
Emory - CHOO - 2
IMMUNOBIOLOGYIL-15 induces antigen-independent expansion and differentiation of human naive CD8 T cells in vitroNuno L. Alves, Berend Hooibrink, Fernando A. Arosa, and Rene A. W. van Lier Recent studies in mice have shown that although interleuk
Emory - EVANS - 2
Immunity, Vol. 19, 413423, September, 2003, Copyright 2003 by Cell PressMolecular Characterization, Reactivation, and Depletion of Latent HIVDavid G. Brooks,1,2 Dean H. Hamer,4 Philip A. Arlen,1 Lianying Gao,2 Greg Bristol,2 Christina M.R. Kitchen
Emory - GRAY - 2
Veterinary Immunology and Immunopathology 93 (2003) 169176The role of WC1 gd T-cells in the delayed-type hypersensitivity (DTH) skin-test reaction of Mycobacterium bovis-infected cattleH.E. Kennedya, M.D. Welshb,*, J.P. Cassidyc, D.G. Brysonb, F.
Emory - IBS - 574
gernert@emory.edu_0002Alignment 1 Seqs: human/mouse Criteria: 75%, 100 bp Regions: 0 X-axis: human Resolution: 15 Window size: 100 bp gene exon UTR CNS mRNA Repeats: LINE LTR SINE RNA DNA OtherAF5q31/AF4100%75%05001000150020002500
Emory - IBS - 574
gernert@emory.edu_0003Alignment 1 Seqs: human/mouse Criteria: 75%, 100 bp Regions: 41 X-axis: human Resolution: 15 Window size: 100 bp gene exon UTR CNS mRNA Repeats: LINE LTR SINE RNA DNA OtherAF5q31/AF4100%75%05001000150020002500
Emory - IBS - 574
gernert@emory.edu_0001Alignment 1 Seqs: human/mouse Criteria: 75%, 100 bp Regions: 30 X-axis: human Resolution: 39 Window size: 100 bp gene exon UTR CNS mRNA Repeats: LINE LTR SINE RNA DNA OtherKIA0076CGI-22SRF_UNK.1100%75%0k1k2k3k
SUNY College of Environmental Science and Forestry - PRE - 2003
Honor Roll of Donors 2000-2001Inside ESF is published four times each year for alumni and friends of the SUNY College of Environmental Science and Forestry.SUNY-ESF 1 Forestry Drive Syracuse, NY 13210-2778 www.esf.edu President: Cornelius B. Murph
Emory - RSPATE - 2
ARTICLE IN PRESSJournal of Theoretical Biology 234 (2005) 201212 www.elsevier.com/locate/yjtbiFinding optimal vaccination strategies for pandemic inuenza using genetic algorithmsRajan Patel, Ira M. Longini Jr., M. Elizabeth HalloranDepartment o
Emory - IBS - 700
PileUp Name: VDR_HUMAN/232-394 Name: PPAT_HUMAN/285-444 Name: RXRA_HUMAN/270-429 Name: PRGR_HUMAN/720-884 Name: Q20832/185-380/VDR_HUMAN/232-394 DLVSYSIQKVIGFAK-MIPGFRDLTS-EDQIVLLKSSAIEVIMLRSNESFPPAT_HUMAN/285-444 FRSVEAVQEITEYAK-SIP
Emory - CS - 190
The Web: Concepts and TechnologyIntroduction to JavaScript Feb 31CS 584: Information Retrieval. Math &amp; Computer Science Department, Emory University Fall 2006Todays PlanJ Javascript (contd): p ( )Fixes Debugging Compilation vs. Interpretation
Emory - ZLIU - 5
Why Does the Cyclical Behavior of Real Wages Change Over Time?Kevin X. D. Huang Kansas City Fed CIRPEE (Canada) kevin.huang@kc.frb.org Zheng Liu Emory University CIRPEE (Canada) zliu5@emory.edu Revised: December 2003 Louis Phaneuf University of Qu
Emory - ZLIU - 5
Zheng LiuFederal Reserve Bank of San Francisco 101 Market Street, MS 1130 San Francisco, CA 94105 Telephone: (415) 974-3328 E- Mail: zheng.liu@sf.frb.org Homepage: http:/userwww.service.emory.edu/~zliu5/November 2008Citizenship: U.S. Marital Stat
Emory - ZLIU - 5
Inflation Targeting: What Inflation to Target?Kevin X.D. Huang Federal Reserve Bank of Kansas City February 2004 Zheng Liu Emory UniversityAbstract This paper derives a central bank's objective function and optimal policy rule for an economy with
Emory - ZLIU - 5
Zheng LiuContact Information Department of Economics Emory University 1602 Fishburne Drive Atlanta, GA 30322 Education November 2006Telephone: (404) 727-1128 Fax: (404) 727-4639 E- Mail: zheng.liu@emory.edu URL: http:/userwww.ser
Emory - ZLIU - 5
Impact of Uncertainty and Sunk Costs on Firm Survival and Industry DynamicsVivek Ghosal* School of Economics Georgia Institute of Technology Atlanta, GA 30332 Vivek.Ghosal@econ.gatech.eduSeptember 2002AbstractThis paper examines the role played
Emory - SALT - 2000
How a strong alliance of very different partners has helped to combat iodine deficiency through the Universal Iodization of Salt. Paper to be presented at the Salt 2000 Symposium, The Hague, Netherlands, May 2000 Mr. David J. Alnwick, Dr Werner Schul
Emory - AFRICA - 08
Fluctuating Grain Prices: g An Opportunity For FortificationHye Kim Cargill, Incorporated0FFI First Africa Flour Fortification Workshop Arusha, Tanzania1FFI First Africa Flour Fortification Workshop Arusha, TanzaniaGlobal Population: Inc
Emory - CS - 424000
CS424 Problem Set 2This homework is due by 11:59pm on Friday, 2/20 (PDA exercises due on Monday, 2/23). All work should be your own and governed by the Emory Honor Code. A portion of your grade (typically no more than 10%) depends upon the clarity
Emory - CHEM - 531
CHEMISTRY 531 EXAM II SOLUTIONS Problem 1 (40 pts)a) Why is the energy degeneracy of the hydrogen 2s and 2p orbitals lifted in atoms (other than hydrogenic ones)? Which energy is lower and why? Electron-electron repulsion is greater in the 2p orbita
Emory - CHEM - 430
GENERALARTICLERamachandran and his MapC Ramakrishnan IntroductionProfessor G N Ramachandran was one of the greatest scientists India has produced during the 20th century. During his research career spanning through four decades he has contribut
Emory - CHEM - 534
General Matrix Elements iq h Hint = i i mic i(1) (2)^ A = A0e cos( k r - t )= [e i(kr -t ) + e -i (kr -t ) ] /2So, the interaction is time dependent and of the form discussed in detail Thus, the 1st order perturbation theory result for the
Emory - CHEM - 531
More on Angular Momentum2 2 2 + cot + 12 2 = h sin = ih sin + cot cos = ih cos cot sin = ih 2L2 opLx Ly Lz()2 Eigenfunctions of LopFirst, Lz , L2 = 0 so eigs. of L z are eigs of L2 . op opLz m ( ) = m (
Emory - CHEM - 430
Constant temperature/constant pressure MD algorithms1. 2. 3. Constant temperature: what does it really mean? Why do &quot;constant temperature&quot; simulations Constant temperature methods 1. Andersen method: random velocity changes 2. Berendsen method: cont
Emory - CHEM - 531
Hydrogen AtomThe Hamiltonian in spherical polar coordinates isl2 h2 2 2 Ze 2 op H= ( 2 + )+ 2 r r r r 2r2where is the square of angular momentum operator l 2 . Note that the op potential depends only on r and so H commutes with l 2 and l z .
Emory - CHEM - 430
Chem 430, Guest lecture on Monte Carlo methods James Kindt, jkindt@emory.edu periodic boundary conditions choice of move sizeMotivations for classical simulation MD vs. MC Probabilities in the canonical (NVT) ensemble Importance sampling: a
Emory - CHEM - 534
Chemistry 534 Exam II Solutions1. In an octahedral complex of Co3+ (point group Oh) the ground electronic state transforms as A1g and is a singlet. [This central ion is surrounded by six ligands, e.g., Co3+(CO)6] a) Are transitions to the excited s
Emory - CHEM - 531
Perturbation Theory (contd)Insert( ( En = En0 ) + En1 ) + 2 E(n2 )(1)( ( n = n 0 ) + n1 ) + 2 (n2 )(2)into( H0 + V En ) n = 0and separate terms according to powers of .( ( 0 : H0 En 0 ) n 0 )(3)()3 by assumption(4)( ( (
Emory - CHEM - 534
Fundamentals of Quantization of Electromagnetic Radiations We have already introduced the H.O. picture of photons in a discussion of the Planck radiation law. To do this more rigorously we need to return to the H.O. and develop the quantum solutions
Emory - CHEM - 534
Details on Matrix Diagonalization FC = C Consider a 2x2 example: F 11 F21 F C11 C12 C11 C12 1 0 12 = F22 C21 C22 C 21 C22 0 2 F11 F21 F11 F21 F12 C11 C11 = 1 F22 C21 C21 F12 C12 C12 = 2 F22 C22 C22
Emory - CHEM - 534
CLEBSCH-GORDON COEFFICIENTS Classically two angular momenta add vectorially to form a resultant total angular momentum. Thus, classicallyj3 = j1 + j2 and each component adds as usual, i.e., j3x = j1x + j2x j3y = j1y + j2y and j3z = j1z + j2z Also,
Emory - CHEM - 534
ELECTRONIC SPECTROSCOPY (Study pp. 362-365 in MQM) As already described the matrix element for a ro-vibronic transition is given in the dipole approximation by of the texte' v' J' K' M' d evJKM = v' J' K' M' e'e vJKM ,where we have made the Born-O
Emory - CHEM - 531
CHEMISTRY 531 EXAM I SOLUTIONS1. Consider a particle of mass m in a two-dimensional box of dimensions Lx = Ly = La) Give the normalized wavefunctions in Cartesian coordinates, the energy eigenvalues, and the degeneracy of the first four energy le
Emory - CHEM - 534
The Photon GasThe total energy density (energy per unit volume) of an electromagnetic field is given by E(t) +B(t) , where E and B are the electric and magnetic fields. The sum of these terms is a constant (in the absence of absorption.) We can make
Emory - CHEM - 531
PERTURBATION THEORYAssume H can be written as = 0 + V Also, assume we know the eigenfunctions and eigenvalues of 0 . Thus, 0 ( 0 ) = E (k0 ) (0) k k (k 0 ) are termed the zero-order eigenfunctions;(0) E k are termed the zero-order eigenvalue
Emory - CHEM - 534
ELECTRONIC SPECTROSCOPY IIAs already described the matrix element for a ro-vibronic transition is given in the dipole approximation bye' v' J' K' M' d evJKM = v' J' K' M' e'e vJKM ,where we have made the Born-Oppenheimer approximation and(1)
Emory - CHEM - 531
Basics of QMClassical Recap p2 H H V +V(q); q = ; p= = 2m p q qH=Quantum Mechanics pop2 - one degree of freedom + V ( q ) ; pop = ih 2m qHop =h2 2 Hop = + V (q); pop = ih = ih( x + y + z) - 3dof 2m x y yThe Schrdinger equation(
Emory - CHEM - 534
EXAM I: SOLUTIONSChem 534 Spring 2002 Problem 1 a) b) In 3D there are 9 normal modes, of which 5 are of zero frequency. In 1D there are N normal modes, where N equals the number of atoms. Thus for CO2 there are 3 normal modes. The 6 missing modes a
Emory - CHEM - 534
Rovibrational transitions in Polyatomics Consider the dipole matrix element between two vibration/rotation states of a molecule v' J' M ' K ' vJMK , where v stands for the 3N-6 set of vibrational quantum numbers and the rotational notation is for a s
Emory - CHEM - 534
Extra lecture on vibrating-rotor Exact Hamiltonian in spherical polar coordinates2 jop ( , ) h 2 2 2 H= 2 2 +R + 2 + V ( R) , R R 2 R(1)where R is the diatom internuclear distance, and 0 R . Since V does not depend on asor , the exact w
Emory - CHEM - 534
LASERS IIThe Ruby laser is an example of a 3-level laser, even though 4 energy states were indicated. Explanation:3-level laser (minimum no. of levels)E3radiationless decayE2excitationlaser emissionE1Population inversion formed in level
Emory - CHEM - 534
Fermis Golden Rule Timedependent perturbation treatmentReview: A multi-Level System in an Electro-magnetic field Lets consider a multi-level system interacting with an electromagnetic field. Under the electric dipole approximation (to be defined i
Emory - CHEM - 534
NORMAL MODE ANALYSIS OF THE VIBRATIONS OF MOLECULES &amp; CLUSTERSI.Thoery of &quot;small amplitude&quot; vibrations Classical QuantumII.Examples HCO Si(100)-(2x1)III.What about anharmonicity and coupling? Thoery Some examplesVibrations: Normal