30 Pages

D_Models_and_Modeling

Course: EARTH 437, Fall 2009
School: W. Alabama
Rating:
 
 
 
 
 

Word Count: 1171

Document Preview

and MBDCI Models Modeling in Geomechanics Maurice Dusseault Models and Modeling MBDCI Models and Modeling A "Model" is a simplified version of reality Complexity, heterogeneity have been reduced Small-scale details have been omitted Complex behavioral laws have been "linearized" Boundary conditions have been simplified "The right horse for the right...

Register Now

Unformatted Document Excerpt

Coursehero >> Alabama >> W. Alabama >> EARTH 437

Course Hero has millions of student submitted documents similar to the one
below including study guides, practice problems, reference materials, practice exams, textbook help and tutor support.

Course Hero has millions of student submitted documents similar to the one below including study guides, practice problems, reference materials, practice exams, textbook help and tutor support.
and MBDCI Models Modeling in Geomechanics Maurice Dusseault Models and Modeling MBDCI Models and Modeling A "Model" is a simplified version of reality Complexity, heterogeneity have been reduced Small-scale details have been omitted Complex behavioral laws have been "linearized" Boundary conditions have been simplified "The right horse for the right course" The o o model should not be too complex Computational time increases (parametric analysis hard) It becomes difficult to understand the results Also, it should not be too simple! Models and Modeling MBDCI To Model is to Understand... Models and Modeling MBDCI Types of Models... Conceptual model Based on physical understanding of the process Geological models Lithostratigraphic model Structural geological model Depositional model 3-D "whole-earth" data base model, etc., etc. Mathematical or Numerical model Material behavior model And so on and so forth... Models and Modeling MBDCI Conceptual Models Precede Reality Horizontal wells in Venezuela for heavy oil development, Conoco-Phillips Real installation - 2003 Conceptual model - 1999 Models and Modeling MBDCI Simple Stratigraphic Model (Alberta Oil Sands) Surficial deposits Casing shear locations ~650 m Models and Modeling Colorado shales Grand Rapids Formation Clearwater Formation McMurray Fmn. Oil Sands Limestones Sequence of sands, shales, etc. MBDCI Estuarine Accretion Model A conceptual model to explain estuarine sedimentation processes No scale Models and Modeling MBDCI Geological Models: Logs Rocks REG. TIPO ER-EO ER-EO B-SUP B-6/9 C-1 ER-EO B-SUP REG. TIPO ER-EO C-3 C-4 C-5 C-6 C-4 C-5 C-6 B-SUP B-6/9 C-1 C-2 C-7 B-6/9 C-1 C-2 C4 C-5 3 C- B-6/9 C-1 C-2 GUAS C-7 C-6 C-7 C-3 C-4 C-5 C-6 C-7 C-3 -2 C C-3 C-4 C-2 3 C-5 C-2 C 4 C- -5 C-3 C -4 C-6 C C-5 C-7 -6 C C-7 GUASARE GUASARE SVS-337 FALLA ICOTEA SVS-30 Models and Modeling GUASARE FA LLA VLE -40 0 SMI 2-D structural section model PDVSA MBDCI Model of Fault Traces BLQ. XIV BLOQUE IX BLOQUE X In the centre of Lake Maracaibo, Venezuela Only the fault traces at the reservoir depth are shown Fault-block controlled oil field (Lago Medio) In fact, faults are far more complex... Splay structures En-echelon faults Gouge zones...... Models and Modeling PDVSA MBDCI Geophysical and Geological Models ConocoPhillips Stratigraphy Models and Modeling MBDCI Campos Basin Model, Brasil Models and Modeling MBDCI Numerical Models This mesh is part of a geomechanics model for numerical - analysis The smallest grid block is 50 50 100 m size A lab specimen perhaps only 50 50 100 mm!! Clearly, the numerical model is a simplification of a complex reality... Sandia Nat'l Labs Models and Modeling MBDCI Mathematical Modeling & Scale 5 5 3 km = 75 109 m3 8 15 15 m = 2370 m3 1 1 5 m = 5 m3 Rock sample = 0.001 m3 Models and Modeling MBDCI Model of "Stacked" Solution Caverns Circular shapes assumed, allowing a 1-D (radial) model. Also, details are ignored... "Reality", from sonar scan (ignored) Models and Modeling Terralog Technologies Inc. Model for creep analysis of gas storage caverns in salt MBDCI A Reservoir Isopach Model Y coordinate distance feet X coordinate distance feet Terralog Technologies Models and Modeling Inc. 0.0 2.0 4.0 6.0 8.0 10.0 Net sand thickness in feet MBDCI Seismic Model Channel structures Models and Modeling MBDCI 3-D "Whole Earth" Model Well path Stratigraphic surfaces Based on geophysical logs + core Models and Modeling data + high-resolution surface seismic Bill Huang, 2003, Chevron MBDCI Casing Deformation Problem tubing Reality casing cement Terralog Technologies Inc. Mathematical Model (FEM) Concept Models and Modeling Mathematical models are based on concepts that are models of reality MBDCI Detail in Representation Ekofisk geological model 19 18 5 km model size Goal was to simulate Overall reservoir Seafloor behavior subsidence... Numerical model had 67 41 24 elements Four materials No discontinuities Hypo-elastic model Models and Modeling Chin et al. 2003 ConocoPhillips MBDCI Ekofisk Model Results Models and Modeling Chin et al. 2003 ConocoPhillips MBDCI Model Complexity The Ekofisk model had 66,000 elements, but... Well over 1 million degrees of freedom A highly complex material behavior law (Chalk) Properties that are functions of and p Full flow-coupling to geomechanics behavior o Using a finite difference flow simulator in parallel Compaction bridging effects (some heterogeneity) For one solution (i.e. one set of parameters) 30 year simulation, >600 iterations, 1.5 hours CPU Models and Modeling And, the results were quite good... MBDCI Material Behavior Models Scale issues, representativeness, scatter of data, similarity to stress path in the field, etc., etc., are all relevant issues in material models. stress (1 3) sudden yield sudden yield stress (1 3) Lab test - curve strain - a Model used in calculations strain - a +ve V -ve Models and Modeling +ve V strain - a -ve strain - a MBDCI How Do We "Model" This Rock Mass? Joints and fractures often dominate flow and deformation behavior Representative testing is generally never possible So, of what value is an extremely complex behavioral law based on small test specimens? n 100 mm A large core specimen A core "plug" 1m Machu Picchu, Peru, Inca Stonecraft rock Models and Modeling MBDCI Local, Reservoir and Regional Scales Regional Scale Stresses o o ~100 km Basin scale: 50 km to 1000 km Often called "far-field stresses" ~4 km Reservoir Scale Stresses o o o A reservoir, or part of a reservoir Scale from 500 m to several km Salt dome region: 5-20 km affected zone Borehole region: 1-5 m Drawdown zone (well scale) 100-1000 m Local Scale Stresses o o ~400 m Models and Modeling Small Scale Stresses (less than 10-20 cm) MBDCI Granular Models Rocks are heterogeneous at all scales (microns to kilometers) In granular media, macroscopic stresses are transmitted through grain contact forces (fn, fs) fs = shear force fn = normal force Models and Modeling MBDCI Granular Models Most behavior aspects of granular media can be emulated in a 2-D model with only a few thousand elliptical "grains"! A 3-D model with 10,0...

Find millions of documents on Course Hero - Study Guides, Lecture Notes, Reference Materials, Practice Exams and more. Course Hero has millions of course specific materials providing students with the best way to expand their education.

Below is a small sample set of documents:

W. Alabama - EARTH - 437
EARTH 437 ROCK MECHANICS FINAL EXAMINATIONSaturday April 03, 2004Instructions: You are permitted calculators, geometry sets, and all necessary pens and pencils. You are not allowed books other than the examination booklets and the examination sheet
W. Alabama - EARTH - 437
EARTH 437ROCK MECHANICSAssignment #1:Design Approaches and Uncertainty in Rock EngineeringFor assignments in EARTH 437, follow conventional engineering standards. Short, wellpresented answers are preferred. Point form, a neat list, a diagram or
W. Alabama - EARTH - 437
. Instructor: Maurice B. DusseaultEARTH 437 ROCK MECHANICS FINAL EXAMINATIONTuesday, December 14, 1993Instructions: You are permitted calculators, geometry sets, and all necessary pens and pencils. You are also allowed books other than the examin
W. Alabama - CS - 456
Last time Message Integrity Authentication Key distribution and certification24-1This time Firewalls Attacks and countermeasures Security in many layers24-2Chapter 8 roadmap8.1 What is network security? 8.2 Principles of cryptography 8
W. Alabama - CS - 456
Last time BGP policy Broadcast / multicast routing Spanning trees Source-based, group-shared, center-based Reverse path forwarding, pruning Tunneling Link virtualization Whole networks can act as an Internet link layer ATM, MPLS12-1This
W. Alabama - CS - 456
Last time P2P Security Intro Principles of cryptography23-1This time Message integrity Authentication Key distribution and certification23-2Chapter 8 roadmap8.1 What is network security? 8.2 Principles of cryptography 8.3 Authenticati
W. Alabama - ECE - 493
Example Given two jobs, J1(0 / 3 / 10 / 6) and J2(2 / 2 / 8 / 5). Please verify their schedulability and illustrate with a conventional scheduling diagram. In addition, please design at least one additional job to achieve 100% processor utilization.
W. Alabama - CS - 848
Online Recovery in Cluster DatabasesBy W. Liang and B. Kemme McGill University Presenter: Leong Fong January 28, 2009 CS 848Outline Introduction Background Information Motivation Distributed Recovery Evaluation Conclusion Remarks Quest
East Los Angeles College - EC - 201
EC 2010 THE UNIVERSITY OF WARWICK Summer Examinations 2003/2004 Macroeconomics 2 Time allowed: 3 Hours Candidates should attempt BOTH questions in SECTION A and ONE question from each of SECTIONS B and C. All four questions are of equal weight. Read
W. Alabama - BIOL - 370
Epithelial Transport of Salts and WaterREVIEW FROM LAST LECTURE: 1) MEMBRANES Lipid Bilayer and Membrane Proteins Stable Intracellular Condition Ionic Steady State (electrochemical gradient) 2) MEMBRANE TRANSPORT MECHANISMS PASSIVE TRANSPORT Dif
East Los Angeles College - EC - 119
EC1190 THE UNIVERSITY OF WARWICK Summer Examinations 2005/2006 MATHEMATICS FOR ECONOMISTS Time allowed: 3 hours Answer SIX questions. If you answer more than the required 6 questions, you will only be given credit for your best 6 answers. The numbers
W. Alabama - BIOL - 240
Lecture 89.6. Quorum Sensing 9.11. Other Global Control Networks 9.14. RNA Regulation and Antisense RNA 9.15. Riboswitches 9.16. Attenuation 9.5. Two Component Regulatory Systems 9.7. Regulation of ChemotaxisQuorum sensing: a type of control syst
East Los Angeles College - EC - 119
EC119 Summer Exam 2004-5 These are solution sketches , not full solutions.1. (a) (i) p q p. q . p . p. q T T T F T T F F F F F T T T T F F T T T (ii) . (p. q) . p . . q (i) At least one person does not . (ii) . (. n : p(n) . . n : . p(n), so . n . .
Allan Hancock College - PSB - 2003259
House of Assembly No 55As laid on the table and read a first time, 12 November 2003South AustraliaProfessional Standards Bill 2003A Bill ForAn Act to provide for the limitation of liability of members of occupationalassociations in certain
W. Alabama - BIOL - 240
Lecture 1110.11 10.12 10.13 10.14 10.19 Conjugation: Essential Features The Formation of Hfr Strains and Chromosome Mobilization Complementation Transposons and Insertion Sequences Genetic Map of the Escherichia coli Chromosometransfer of plasmid
W. Alabama - BIOL - 240
Lecture 1913.1 13.3 13.4 13.5 Phylogenetic Overview of the Archaea Extremely Halophilic Archaea Methane-Producing Archaea: Methanogens Thermoplasmatalesuniversal phylogenetic tree (tree of life):phylogenetic tree of the Archaeaextreme halophil
W. Alabama - POLISCI - 226
226 Notes - Locke [1]John Locke - 1632-1704226 Notes - Locke [2]Locke's life in brief: Born of Puritan parents (1632) Father fought in the civil wars, on the Parliamentary side (Cromwell's) studied philosophy and then medicine at Oxford
East Los Angeles College - CH - 923
R/Bioconductor Installation instructionsMartin Edwards, Samuel Robson, Heather Turner, Hugo van den Berg, Helen BirdR is a programming language, with many useful statistical functions included. One can gain additional functionality for microarray d
East Los Angeles College - CH - 923
AccessionScoreCountCol-0038Col-0113Col-022Col-030Col-040Col-109Col-1113Col-1215Col-138Col-141Kas-1028Kas-1116Kas-123Kas-130Kas-140Kas-208Kas-216Kas-228Kas-2311Kas-2412Cvi06Cvi116Cvi
W. Alabama - ECE - 493
Tutorial 10Derek Wright Wednesday, March 30th, 2005Nano-BioSystems Neuro-Electronic Interfacing Biomaterials DNA MicroarraysNeuro-Electronic Interfaces Focuses on interfacing between neurons and electronic circuits Circuits use electrons a
W. Alabama - PHIL - 673
Presentation: Neurosemantics. 1. Putting the paper in to context: The questions that underlie, and unite each of the readings in this class. How does this paper naturalize mental meaning? How does this paper deal with the problem of misrepresentation
W. Alabama - CE - 265
Civ E 265 MaterialsMid-Tem Exam Fall 2004 SolutionsA. General 1. a) What is the difference between an element, a compound, and a molecule? [4] An Element is a "pure" substance composed of like atoms and appears on the periodic table (e.g. Au, Al, H
W. Alabama - ENVE - 577
UNIVERSITY OF WATERLOO Department of Civil Engineering ENV E 477: ENGINEERING FOR SOLID WASTE MANAGEMENT Final Examination Winter 2003 3 hours Open Book Prof. J.F. SykesNOTES: Read the exam carefully before attempting the questions; the exam reflec
W. Alabama - ENVE - 100
Report Structure Env E 100Front Cover Letter of Submittal Title Page Acknowledgements Summary Table of Contents List of Figures List of Tables 1.0 Introduction 2.0 Data Collection 3.0 Remediation of Laurel Lake 4.0 Laurel Lake Expansion 5.0 Treatm
East Los Angeles College - CH - 920
MOAC Module 920 `Introduction to Cellular Processes'This module aims to introduce you to basic cell biology and biochemistry. Since it is not possible to communicate all the required information on this broad area in only 4 weeks we aim to enable yo
W. Alabama - CIVE - 353
CIVE 353 - Geotechnical Engineering I ASSIGNMENT 4De p a r t m e n t o f Ci v i l En g i n e e ri n gPosted Date: Monday February 6, 2006 Due Date: Wednesday February 15, 2006 @ 4pm in soil lab1. A soil sample was taken from the site of a propos
W. Alabama - CIVE - 353
CIVE 353 - Geotechnical Engineering I ASSIGNMENT 1De p a r t m e n t o f Ci v i l En g i n e e ri n gPosted Date: Tuesday January 11, 2006 Due Date: Wednesday January 18, 2006 @ 4pm in the COURSE BOX in the soils lab 1. How do geotechnical enginee
W. Alabama - CIVE - 752
CIV E 752 Trenchless Technology TopicsDepartment of Civil EngineeringCourse OutlineInstructor: Dr. Mark Knight E-mail: maknight@uwaterloo.ca Course Website: UW ACE - 752 Course WebsiteOffice: E2-2343A Telephone: ext. 6919Objective: Over the
W. Alabama - CIVE - 375
CivE 375Assignment # 1 SolutionsWinter 2009Question 1 Given: Campground occupancy = 200 persons/day between 40 tent/trailer sites and 20 lodge units + a coffee shop and visitor center Use Table 1.6 to estimate water demand Assume: Maximum occup
W. Alabama - CIVE - 375
CivE 375 Lab #3 Marking Scheme Lab Day:_ Group:_For this lab, you will present your final results in the Supplemental Questions section. Section Mark i Comments Title Page /1 Supplemental summary data sheet (in #1) Questions1 - plot & breakpoint 2
W. Alabama - PSYCH - 353
Making Sense of the World Why Do We Need Concepts?Too much information to treat each piece individually Concepts are necessary for effective communication It is useful to group similar things together Concepts allow us to go beyond the information
W. Alabama - PSYCH - 353
Automatic Processing What is automatic processing? Lack of awareness Lack of intention Lack of control Lack of effort What about unconscious processing? What about implicit/explicit processing?Lack of Awareness Remember those Nisbett & Wils
W. Alabama - PSYCH - 353
Person Perception Asch's Gestalt Model of Person Perception intelligent, skillfull, industrious, cold, determined, practical, cautious intelligent, skillfull, industrious, warm, determined, practical, cautious Things that matter in perception
W. Alabama - ECE - 104
Goldenmean search, Newton's method, Quadratic optimization, Gradient descent and help session ECE104, Week 8 Farzaneh Kohandani 1Optimization, GoldenMean searchLet's assume we use = - 1 0.6180 a 0 0 0 0 c1 0.3820 0.2361 0.1459 0.0902
W. Alabama - ECE - 380
Root Locus and Lead Controllers Consider the previous exampleK ( s + 4) GH ( s ) = s( s + 1 + 2 j )( s + 1 - 2 j ) X O X X2jj2j Add a pole/zero combination at s = 6 , 1 . O X 4 The new asymptote intersects the real axis at [(0 116) (4 1)]
W. Alabama - ECE - 104
Matlab ReviewKhadijeh Bayat ECE 104 University of WaterlooOutline This tutorial will cover: Matrices Accessing matrix entries Matrix functions Element-wise operations Polynomials in Matlab: Constructing polynomials in Matlab Some operatio
W. Alabama - ECE - 204
Tutorial 5 1. Perform three iterations of the algorithm for finding the maximum - 3 4 0 eigenvalue of a matrix M = 4 3 starting with the vector v1 = 1 . Will this iteration process converge? 2. Calculate the 1- and infinity-norms of the
Allan Hancock College - EMDGR - 2008477
[pic]Export Market Development Grants Regulations 2008Select Legislative Instrument 2008 No. 140 as amendedmade under theExport Market Development Grants Act 1997This compilation was prepared on 22 July 2008taking into account amendments
East Los Angeles College - CS - 252
CS2520 UNIVERSITY OF WARWICK Department of Computer Science Second Year Winter Examinations 2008/09 Fundamentals of Relational DatabasesFEEDBACK FOR STUDENTS by Hugh DarwenTime allowed: 1.5 hours This is a closed book exam. No information sources
W. Alabama - ECE - 327
Release Notes For ModelSim SE/PE 5.7d Copyright Model Technology, a Mentor Graphics Corporation company, 2003 - All rights reserved. May 15 2003 __ Produc
W. Alabama - ECE - 327
Release Notes For ModelSim SE/PE/LE 6.0 Copyright Mentor Graphics Corporation 2004 All rights reserved. This document contains information that is proprietary to Mentor
W. Alabama - ECE - 327
1621611571611621601631551561611561571571521541561581601671661651721751701721751671611481401191069792979610110510511010810510910910610810910911010810610811111111811912212212212413012312713
W. Alabama - ECE - 427
Design PatternsUniversity of Waterloo E&CE 427 2001 Fall Lec-03(U of Waterloo E&CE 427 2001 Fall) copyright Mark Aagaard 2001 permission is granted to reproduce without modificationStorage: Dual-Port Memory Array Can read from two addresses at
W. Alabama - ECE - 427
# ATTENTION ENGINEERS!# Do NOT edit this file and check it in. The Docs group is responsible# for maintaining this file. Send all changes to docs@model.com.## help command command help# The entries in this file have the form of a Tcl list.
Allan Hancock College - MCA - 200447
Western Australia Magistrates Court Act 2004 Western Australia Magistrates Court Act 2004 CONTENTS Part 1 - Prelimina
Allan Hancock College - DDRB - 2004440
House of Assembly No 25As laid on the table and read a first time, 13 October 2004South AustraliaDirect Democracy (Citizen-Initiated Referendums) Bill 2004A Bill ForAn Act to enable the electors of South Australia to initiate referendums on
East Los Angeles College - EC - 928
Assessment E928Prepare two short reviews of journal papers, one selected from S. Mukand's reading list, and one from E. Proto's reading list avoiding papers marked with two asterisks (*)Word limit:1,500 words each (3,000 words in total.)
W. Alabama - ECE - 250
ECE 250 Data Structures and AlgorithmsDequesDouglas Wilhelm Harder Department of Electrical and Computer Engineering University of WaterlooCopyright 2006-8 by Douglas Wilhelm Harder. All rights reserved.Deque ADT Idea: A doubly-ended queue
W. Alabama - ECE - 250
ECE 250 Data Structures and AlgorithmsMerge SortDouglas Wilhelm Harder Department of Electrical and Computer Engineering University of WaterlooCopyright 2006 by Douglas Wilhelm Harder. All rights reserved.Merge Sort The next sorting algorith
W. Alabama - ECE - 477
Chapter 4Photonic SourcesContents Review of Semiconductor Physics Light Emitting Diode (LED) - Structure, Material,Quantum efficiency, LED Power,Modulation Laser Diodes - structure, Modes, Rate Equation,Quantum efficiency,Resonant frequenci
UPenn - VHM - 802
Solution file for additional exercise 12.3-(see additional exercise 12.1 for discussion of model, design and notation)MTB > WOpen "C:\DATA.AVC\teaching\vhm802\09P\hs12_3.dat";SUBC> FType;SUBC> Text;SUBC> VNames;SUBC> None;SUBC>
UPenn - VHM - 802
Solution file for 5.7.4 and 6.7.4 (RC)-Data: measurements of iron in the livers of white rats.Rats were randomly allocated to 5 diets (A-E), with 10 rats per diet.The data constitute 5 independent samples with continuous outcome, and the model
W. Alabama - CS - 482
Sequence Alignment1It's pretty cheap to sequence DNA at this point; hundreds of genomes have been sequenced, and another thousand or so are in the process. Sequence is much cheaper In 2008, a few dollars per reaction (a few hundred bps) But s
W. Alabama - CS - 482
Introduction1Lecture 1Topics for this week: Course logistics A very little bit of background Sequence alignment 482/682 will be noticeably different from last year: The instructor has changed and they are specialized in different areas in
W. Alabama - CS - 482
SPI DER list en t o bot h par t ies!The solut ion when t her e is no pr ot ein dat abase and no per fect MS/MS.~pr ot ein DBdat abase sear chESIGNEVRde novo sequencingEISGNEVR SIpr ot ein DBhomology searchEAK S: M a et . al, Rapid
W. Alabama - CS - 482
Quick Review of Gene Prediction1Gene Prediction We have learned the HMM model to use codon bias to do a gene prediction. There are other "signals" of genes that should be taken into account for a more accurate prediction. In general these si
W. Alabama - CS - 482
>seq1mglseaewqlvlhvwakveadlsghgqeilirlfghpetlekfdkfkhlkseaemkasedlkkhghtvltalggilkkkghheaelkplaqshatkhkipikylefisdaiihvlhskhpsdfgadaqgamtkalelfrkdiaakykelgfhg>seq2mgdgewqlvlnvwgkveadipghgqevlirlfkghpetlekfdkfkhlksedemkasedlkkhgatvltalggilkkkghh
Allan Hancock College - ENGG - 4801
School of Information Technology & Electrical EngineeringTransmission System Pricing for A Competitive Electricity MarketAuthor: Benson Heng Li GeneWhy the existence of transmission pricing ?"Prices are an essential component of efficient transm
UPenn - VHM - 802
Solution file for exercise 9.5.2 in RC-Data: measurements of effectiveness of a spray to kill flies, at different breeding mediums(for the flies) and at different concentrations of the spray. Notation: y_i = number of dead flies for i'th experim
W. Alabama - STAT - 231
Section 2 (Chipman)-IDLab1Test1Lab2Lab3Lab4Test2Lab5Lab%Test%Course-MAXIMUM12292220373110100.0100.0100- 0002451192620183625.51090.686.0860006061310221718131070.158.959001098411021.51718352
W. Alabama - STAT - 231
Printing ExamplePosted on Website this afternoon.A large company has an in-house printing operation. It is suggested that printing costs can be reduced by out-sourcing to an external printing house. To investigate this possibility, a study is