Course Hero has millions of student submitted documents similar to the one
below including study guides, practice problems, reference materials, practice exams, textbook help and tutor support.
Find millions of documents on Course Hero - Study Guides, Lecture Notes, Reference Materials, Practice Exams and more.
Course Hero has millions of course specific materials providing students with the best way to expand
their education.
Below is a small sample set of documents:
Kentucky - CS - 585
Basic BLAST Infohttp:/www.sp.uconn.edu/~mcb232vc/blast.htmlNLM Tutorialshttp:/www.ncbi.nlm.nih.gov/Education/blasttutorial.htmlhttp:/www.ncbi.nlm.nih.gov/Education/blasttutorial.htmlWU SLUhttp:/blast.wustl.edu/blast/~
Kentucky - CS - 585
CS-585 - Special Topics: Algorithms and Software for Bioinformatics Jerzy W. Jaromczyk Brief description for Summer 2007 Location: 265 FPAT and B-35 Young Library Time: MTWRF 8:00 AM to 10:00 AM Textbook: We will use tools, manuals, papers and resour
Kentucky - CS - 585
Class,this Memorial Day weekend is the second to the last weekend ofour semester.Judging by the results of the review that we held last Friday,the first part of the semester was successful. Although certainlynot all of you were equal in the nu
Kentucky - CS - 585
CS-585 Special Topics: "Algorithms and Software for Bioinformatics"4-weeks session, Dr. JaromczykMay 8 - June 5, 20078:00 AM to 10:00 AMCan be used by CS graduate and undergradute students. Backgroundin programming and algorithms is expected.D
Washington - P - 209
In-class activity 4 Sanocki, T. (2001). Interaction of scale and time during object identification. Journal of Experimental Psychology: Human Perception and Performance, 27(2), 290-302. In parentheses In text st 1 time (Sanocki, 2001) Sanocki (2001)
Kentucky - CS - 585
CS-585 Summer 2007 JWJ CS UK Assignment # 3 Due: In Class Learning objectives: Algorithms for sequencing and for global sequence alignment. Random properties of sequences. Specifications: 3-1 Consider the following SBH method. The DNA chip is designe
Kentucky - CS - 585
CS-585 Summer 2007 JWJ CS UK Longest Subsequence Learning objectives: Dynamic Programming Problem and its solution: Let S = (a1 , ., an ) be a sequence of n numbers. Provide a recursive formula for l(i), the length of the longest monotonically increa
Kentucky - CS - 585
Matt Ryavec <Matt.Ryavec@gmail.com>: Pairwise Global Alignment of Protein Interaction Networks by Matching Neighborh ood Topology by Rohit Singh, Jinbo Xu, and Bonnie Berger http:/www.cs.uky.edu/~jurek/cs585/cs585su07/RECOMB/READINGS-RECOMB/445300
Kentucky - CS - 585
CS-585 Summer 2007 JWJ CS UK Phylogenetic Trees - NJ algorithm1Algorithm: the Neighbor-Joining MethodInstance: a set L of n point and a matrix dij (symmetric) of additive distances. Question: What is the Phylogenetic tree based on the Neighbour
Kentucky - CS - 585
MVVSGAPPAL GGGCLGTFTS LLLLASTAIL NAARIPVPPA CGKPQQLNRV VGGEDSTDSEWPWIVSIQKN GTHHCAGSLL TSRWVITAAH CFKDNLNKPY LFSVLLGAWQ LGNPGSRSQKVGVAWVEPHP VYSWKEGACA DIALVRLERS IQFSERVLPI CLPDASIHLP PNTHCWISGWGSIQDGVPLP HPQTLQKLKV PIIDSEVCSH LYWRGAGQGP ITEDMLC
Kentucky - CS - 585
http:/swift.cmbi.ru.nl/gvteach/SBC/Run Clustal for this sequences.which residues in the alignment are best/worst conserved?Use the alignment scores to compute distances between sequences using the formula (100 - a[i,j]) / 100Find the parsimo
Kentucky - CS - 585
http:/swift.cmbi.ru.nl/gvteach/SBC/Use this similarity matrix to construct the phylogenetictree:100 33 33 46 6 20 2033 100 20 86 6 20 2633 20 100 33 13 6 646 86 33 100 0 6 26 6 6 13 0 100 46 4020 20 6 6 46 100 3320 26 6 26 40 33
Kentucky - CS - 585
CS-585 Summer 2007 JWJ CS UK Review for Sequence Alignments and Phylogenetic trees Answer the following questions. Write your answer in a file (MSoft document, for example) and then turn it in. A: These questions pertain to pairwise alignments and BL
Kentucky - CS - 585
Using the PAM250 matrix compute te score for the following alignment.The score is the sum of the pairwise scores.Score of an alignment is the sum of the scores of all pairs of residues in the alignmentsequence 1: TCCPSIVARSNsequence 2: SCCPSISA
Kentucky - CS - 585
http:/www.ebi.ac.uk/clustalw/>TLN itgtstvgvgrgvlgdqkninttystyyylqdntrgngiftydakyrttlpgslwadadnqffasydapavdahyyagvtydyyknvhnrlsydgnnaairssvhysqgynnafwngsqmvygdgdgqtfiplsggidvvahelthavtdytagliyqnesgaineaisdifgtlvefyanknpdweigedvytpgisgdslrsmsdpak
Kentucky - CS - 585
>crab_anapl ALPHA CRYSTALLIN B CHAIN (ALPHA(B)-CRYSTALLIN). MDITIHNPLIRRPLFSWLAPSRIFDQIFGEHLQESELLPASPSLSPFLMRSPIFRMPSWLETGLSEMRLEKDKFSVNLDVKHFSPEELKVKVLGDMVEIHGKHEERQDEHGFIAREFNRKYRIPADVDPLTITSSLSLDGVLTVSAPRKQSDVPERSIPITREEKPAIAGAQRK
Berkeley - I - 271
It took too much time to find I lost a lot of time trying to find I didn't like the way they organized the information I would organize in another way I would prefer to use a search tool instead of browsing their categories I frustrated, I did not fi
Kentucky - CS - 585
Network Legos: Building Blocks of Cellular Wiring DiagramsT.M. Murali and Corban G. Rivera660 McBryde Hall, Department of Computer Science, Virginia Polytechnic Institute and State University, Blacksburg VA 24061Abstract. Publicly-available data
Kentucky - CS - 585
A Feature-Based Approach to Modeling Protein-DNA InteractionsEilon Sharon and Eran SegalDepartment of Computer Science, Weizmann Institute of Science, Rehovot, 76100, Israel {eilon.sharon,eran.segal}@weizmann.ac.il http:/genie.weizmann.ac.ilAbstr
Kentucky - CS - 585
Network Motif Discovery Using Subgraph Enumeration and Symmetry-BreakingJoshua A. Grochow and Manolis KellisComputer Science and AI Laboratory, M.I.T. Broad Institute of M.I.T. and Harvard joshuag@cs.uchicago.edu, manoli@mit.eduAbstract. The stud
Kentucky - CS - 585
Framework for Identifying Common Aberrations in DNA Copy Number DataAmir Ben-Dor1, , Doron Lipson2 , Anya Tsalenko1 , Mark Reimers3 , Lars O. Baumbusch4 , Michael T. Barrett1,5 , John N. Weinstein3 , Anne-Lise Brresen-Dale4, and Zohar Yakhini1,2Agi
Kentucky - CS - 585
Estimating Genome-Wide Copy Number Using Allele Specific Mixture ModelsWenyi Wang1 , Benilton Carvalho2 , Nate Miller3 , Jonathan Pevsner4, Aravinda Chakravarti5, and Rafael A. Irizarry6,Department of Biostatistics, Johns Hopkins Bloomberg School o
Kentucky - CS - 585
GIMscan: A New Statistical Method for Analyzing Whole-Genome Array CGH DataYanxin Shi1 , Fan Guo1 , Wei Wu2 , and Eric P. Xing1,1School of Computer Science, Carnegie Mellon University, Pittsburgh, PA, 15213 epxing@cs.cmu.edu 2 Division of Pulmona
Kentucky - CS - 585
Production-Passage-Time Approximation: A New Approximation Method to Accelerate the Simulation Process of Enzymatic ReactionsHiroyuki Kuwahara1 and Chris Myers2School of Computing, University of Utah Salt Lake City, UT 84112, U.S.A. kuwahara@cs.uta
Kentucky - CS - 585
Shift-Invariant Adaptive Double Threading: Learning MHC II - Peptide BindingNoah Zaitlen1 , Manuel Reyes-Gomez2 , David Heckerman2 , and Nebojsa Jojic2,1University of California San Diego, La Jolla CA 92093, USA 2 Microsoft Research, Redmond WA 9
Kentucky - CS - 585
Reconstructing the Phylogeny of Mobile ElementsSean O'Rourke1, Noah Zaitlen2 , Nebojsa Jojic3 , and Eleazar Eskin41Dept. of Computer Science and Engineering, University of California, San Diego, La Jolla, CA 92092 sorourke@ucsd.edu 2 Dept. of Bio
Kentucky - CS - 585
Beyond Galled Trees - Decomposition and Computation of Galled NetworksDaniel H. Huson and Tobias H. Klpper oCenter for Bioinformatics (ZBIT), Tbingen University, u Sand 14, 72076 Tbingen, Germany uAbstract. Reticulate networks are a type of phylo
Kentucky - CS - 585
Variational Upper Bounds for Probabilistic Phylogenetic ModelsYdo Wexler and Dan GeigerDept. of Computer Science, Technion - Israel Institute of Technology, Haifa 32000, Israel {ywex,dang}@cs.technion.ac.ilAbstract. Probabilistic phylogenetic mod
Kentucky - CS - 585
Heuristics for the Gene-Duplication Problem: A (n) Speed-Up for the Local SearchMukul S. Bansal1 , J. Gordon Burleigh2 , Oliver Eulenstein1 , and Andr Wehe3 eDepartment of Computer Science, Iowa State University, Ames, IA, USA {bansal,oeulenst}@cs.
Kentucky - CS - 585
Support Vector Training of Protein Alignment ModelsChun-Nam John Yu1 , Thorsten Joachims1, Ron Elber1 , and Jaroslaw Pillardy21Dept. of Computer Science, Cornell University, Ithaca NY 14853, USA {cnyu,tj,ron}@cs.cornell.edu 2 Cornell Theory Cente
Kentucky - CS - 585
Tools for Simulating and Analyzing RNA Folding KineticsXinyu Tang, Shawna Thomas, Lydia Tapia, and Nancy M. AmatoParasol Lab, Dept. of Comp. Sci., Texas A&M University, College Station, TX 77843Abstract. It has recently been found that some RNA f
Kentucky - CS - 585
Multiple Sequence Alignment Based on Profile Alignment of Intermediate SequencesYue Lu1 and Sing-Hoi Sze1,2Department of Biochemistry & Biophysics 2 Department of Computer Science, Texas A&M University, College Station, TX 77843, USA1Abstract. D
Kentucky - CS - 585
Multivariate Segmentation in the Analysis of Transcription Tiling Array DataAntonio PiccolboniAffymetrix, Inc., 6650 Vallejo St. Suite 100, Emeryville, CA 94608 antonio piccolboni@affymetrix.comAbstract. Tiling DNA microarrays extend current micr
Kentucky - CS - 585
Rearrangements in Genomes with Centromeres Part I: TranslocationsMichal Ozery-Flato and Ron ShamirSchool of Computer Science, Tel-Aviv University, Tel Aviv 69978, Israel {ozery,rshamir}@post.tau.ac.ilAbstract. A centromere is a special region in
Kentucky - CS - 585
Identification of Deletion Polymorphisms from HaplotypesErik Corona1, Benjamin Raphael2 , and Eleazar Eskin3Dept. of Computer Science and Engineering, University of California, San Diego, La Jolla, CA 92092 ecorona@ucsd.edu 2 Dept. of Computer Scie
Kentucky - CS - 585
Free Energy Estimates of All-Atom Protein Structures Using Generalized Belief PropagationHetunandan Kamisetty, Eric P. Xing, and Christopher J. LangmeadComputer Science Department, Carnegie Mellon University, 5000 Forbes Avenue, Pittsburgh, PA 1521
Kentucky - CS - 585
Minimizing and Learning Energy Functions for Side-Chain PredictionChen Yanover1, Ora Schueler-Furman2, and Yair Weiss1School of Computer Science and Engineering, The Hebrew University of Jerusalem, 91904 Jerusalem, Israel {cheny,yweiss}@cs.huji.ac.
Kentucky - CS - 585
Protein Conformational Flexibility Analysis with Noisy DataAnshul Nigham1 and David Hsu2SingaporeMIT Alliance, Singapore 117576, Singapore anshulni@comp.nus.edu.sg National University of Singapore, Singapore 117543, Singapore dyhsu@comp.nus.edu.sg
Kentucky - CS - 585
Deterministic Pharmacophore Detection Via Multiple Flexible Alignment of Drug-Like MoleculesYuval Inbar1 , Dina Schneidman-Duhovny1 , Oranit Dror1 , Ruth Nussinov2,3 , and Haim J. Wolfson11School of Computer Science, Raymond and Beverly Sackler F
Kentucky - CS - 585
Design of Compact, Universal DNA Microarrays for Protein Binding Microarray ExperimentsAnthony A. Philippakis1,3,4,*, Aaron M. Qureshi1,5,*, Michael F. Berger1,4, and Martha L. Bulyk1,2,3,4,*1 Division of Genetics, Department of Medicine and Depart
Kentucky - CS - 585
Improved Ranking Functions for Protein and Modification-Site IdentificationsMarshall Bern and David GoldbergPalo Alto Research Center, 3333 Coyote Hill Rd., Palo Alto, CA 94304, USA bern@parc.com, goldberg@parc.comAbstract. There are a number of
Kentucky - CS - 585
Peptide Retention Time Prediction Yields Improved Tandem Mass Spectrum Identification for Diverse Chromatography ConditionsAaron A. Klammer, Xianhua Yi, Michael J. MacCoss, and William Stafford NobleGenome Sciences Department University of Washingt
Kentucky - CS - 585
A Fast and Accurate Algorithm for the Quantification of Peptides from Mass Spectrometry DataOle Schulz-Trieglaff1,2, Rene Hussong3 , Clemens Grpl2 , o Andreas Hildebrandt3 , and Knut Reinert2Max Planck Research School, Berlin, Germany trieglaf@inf.
Kentucky - CS - 585
Association Mapping of Complex Diseases with Ancestral Recombination Graphs: Models and Efficient AlgorithmsYufeng WuDepartment of Computer Science University of California, Davis Davis, CA 95616, U.S.A. wuyu@cs.ucdavis.eduAbstract. Association,
Kentucky - CS - 585
An Efficient and Accurate Graph-Based Approach to Detect Population SubstructureSrinath Sridhar1 , Satish Rao2 , and Eran Halperin3Computer Science Dept, Carnegie Mellon University srinath@cs.cmu.edu Computer Science Dept, University of California,
Kentucky - CS - 585
RB-Finder: An Improved Distance-Based Sliding Window Method to Detect Recombination BreakpointsWah-Heng Lee1,2 and Wing-Kin Sung1,2Genome Institute of Singapore National University of Singapore leewhc@gis.a-star.edu.sg, ksung@comp.nus.edu.sg2 1A
Kentucky - CS - 585
Comparative Analysis of Spatial Patterns of Gene Expression in Drosophila melanogaster Imaginal DiscsCyrus L. Harmon1 , Parvez Ahammad2 , Ann Hammonds1 , Richard Weiszmann3 , Susan E. Celniker3 , S. Shankar Sastry2 , and Gerald M. Rubin11 Departmen
Kentucky - CS - 585
RECOMB 2007 - LNBI 4453 CD-ROMPairwise Global Alignment of Protein Interaction Networks by Matching Neighborhood TopologyRohit Singh1, Jinbo Xu2, and Bonnie Berger*11ComputerScience and AI Lab., Massachusetts Institute of Technology rsingh@mit.
Kentucky - CS - 585
RECOMB 2007 - LNBI 4453 CD-ROMRB-Finder: An Improved Distance-Based Sliding Window Method to Detect Recombination BreakpointsWah-Heng Lee1,2 and Wing-Kin Sung1,21Genome 2NationalInstitute of SingaporeUniversity of Singapore leewhc@gis.a-star.
Kentucky - CS - 585
CS 585 Designing GamesSummer 2008JWJ-CS-UKFor CS 585 students only. Please do not distribute.=
Elon - CSC - 176
Security and Privacy Paranoia How much computer communication can be considered private? How likely are we to put important information on the internet? In email? We can't continue to use the computer for business transactions or person
Elon - CSC - 176
Program TranslationModule 6, Analytical EngineReview We have learned. about local applications, global applications, and the logical problem solving that programmers use to build themToday: How the Computer Works Binary Representation of D
Elon - CSC - 331
Exam 2 Review1. A sort whose main operation is finding whether or not 2 elements are <, >, or = is called.2. A sort in which equal elements stay in their original order is called.3. Give an example of an in-place sort.4. What is the runni
Elon - CSC - 331
CSC 331: Algorithm AnalysisCryptographyThe Rivest-Shamir-Adleman (RSA) cryptosystem, uses all the ideas we have talked about so far.Polynomial-time computability: modular exponentiation, greatest common divisor, primality testingExponential-t
Arizona - CE - 467
CE 467 Highway Safety and OperationsGroup exercise Effect of driver factors on safety Thu Sep 2, 2004Bill Hanson Ian Penn Bob SmithFactor Eyesight of driver Nearsightedness Farsightedness Focus time Peripheral vision Glare Recovery Light sensit
Arizona - CE - 467
Environmental Factors that Cause AccidentsFactorHeat Ice Wind Raingenerated by Tom, Judd and LisaExpected EffectRaises risk while driving Icy roads Low visibility from dust Low visibility, hydroplane, slick roads, flooding Low visibility, Less
Arizona - CE - 467
OPERATIONAL FACTORS AND SAFETYFactor Pedestrians walking in the roadway Expected Effect Pedestrian accidents Explanation Pedestrians are particularly vulnerable when sharing the road environment with motor vehicles. When mixing with traffic it is li
Arizona - CE - 467
Roadway and Roadsides Roadside SafetyFactor Expected Effect Proper Signalization Lower accident rate Lower speeds Speed Higher speed causes more accedients Lane Width Shoulder Width Access Tighter Lanes Smaller shoulder widths Explanation Proper pha
Arizona - CE - 467
DOT HS 809 481U.S. Department of Transportation National Highway Traffic Safety AdministrationTraffic Safety Facts 2001State Alcohol EstimatesA Public Information Fact Sheet on Motor Vehicle and Traffic Safety Published by the National Highway
Arizona - CE - 467
Vehicle FactorsFactor Expected Effect ExplanationConservation of momentum and energy There is a greater moment arm with a higher center of gravity A tall vehicle in a crash will traverse over a shorter vehicle roadFundamental Vehicle Characterist
Elon - CSC - 331
Greedy AlgorithmsCSC 331: Algorithm AnalysisGreedy AlgorithmsHuffman EncodingIn the MP3 audio compression scheme, a sound signal is encoded in three steps. Its is digitized by sampling at regular intervals, yielding a sequence of real numbers.