Course Hero has millions of student submitted documents similar to the one
below including study guides, practice problems, reference materials, practice exams, textbook help and tutor support.
Find millions of documents on Course Hero - Study Guides, Lecture Notes, Reference Materials, Practice Exams and more.
Course Hero has millions of course specific materials providing students with the best way to expand
their education.
Below is a small sample set of documents:
UCSD - BIBC - 100
The absorption spectra of hemoglobin changes upon binding oxygen
UCSB - PHYS - PHY 191
C/CS/Phys 191 Fall 2005Spin manipulation II (resonance), quantum gates on spins 10/20/05Lecture 161 ReadingsLiboff, Introductory Quantum Mechanics, Ch. 11 Stolze and Suter, Quantum Computing, Ch. 10 Nielsen and Chuang, Quantum Computation and Quantum
UCSB - PHYS - PHY 191
C/CS/Phys 191 Fall 2005Deutsch and Deutsch-Josza algorithmsLecture 1710/25/051 ReadingsBenenti et al., Ch. 3.9 - 3.9.2 Stolze and Suter, Quantum Computing, Ch. 8.2 - 8.2.5) Nielsen and Chuang, Quantum Computation and Quantum Information, Ch. 1.4.3, 1
N.C. State - ECG - 590
North Carolina State University Department of Economics Fall 2008 ECG 590I Asset Pricing SYLLABUS Class Day and Time: Tu&Th 1:30 - 2:45 PM Cox Hall, Room 209 Instructor: John Seater Of ce: 4146 Nelson Hall Tel: 919-513-2697 Email: john_seater@ncsu.edu Web
N.C. State - ECG - 590
Notes on Ordinary Differential and Difference EquationsbyJohn J. SeaterJune, 2002ORDINARY DIFFERENTIAL EQUATIONSDEFINITIONS Def A differential equation is an equation that involves derivatives of a dependent variable with respect to one or more indep
Colorado - PHYS - 2010
Physics 103 Exam 1October 2, 2003Name_ ID #_ Section #_ TA Name_ Fill in your name, student ID # (not your social security #), and section # (under ABC of special codes) on the Scantron sheet. Fill in the letters given for the first 5 questions on the S
Colorado - PHYS - 2010
Physics 103 Exam 1October 3, 2002Name_ ID #_ Section #_ TA Name_ Fill in your name, student ID # (not your social security #), and section # (under ABC of special codes) on the Scantron sheet. Fill in the letters given for the first 5 questions on the S
Colorado - PHYS - 2010
PHYS2010 FINAL EXAM, VERSION 0001, SPRING 20061Useful Constants Sea level atmospheric pressure: 101 kPa = 1.01 105 N/m2 Density of water: 1.00 g/cm3 = 1000 kg/m3 Universal gravitational constant: G = 6.6710-11 m3 /(kg s2 ) = 6.6710-11 N m2 /kg2Problem
Colorado - PHYS - 2010
PHYS2010 EXAM 3, VERSION 0001, SPRING 20061The following three questions refer to a satellite of mass m in a circular orbit at a height h above the earth's surface. Assume h is on the order of a few hundred miles, so the satellite is free of any effects
Colorado - PHYS - 2010
Physics 103 Exam 1October 2, 2003Name_ ID #_ Section #_ TA Name_ Fill in your name, student ID # (not your social security #), and section # (under ABC of special codes) on the Scantron sheet. Fill in the letters given for the first 5 questions on the S
Colorado - PHYS - 2010
Physics 103 Exam 1October 3, 2002Name_ ID #_ Section #_ TA Name_ Fill in your name, student ID # (not your social security #), and section # (under ABC of special codes) on the Scantron sheet. Fill in the letters given for the first 5 questions on the S
Colorado - PHYS - 2010
N-1Newton's Laws: Forces and MotionA force is a push or a pull. Force is a vector. It has a size and a direction. Forces add like vectors, not like scalars. Example: Two forces, labeled F1 and F2, are both acting on the same object. The forces have the
Colorado - PHYS - 2010
General Physics I - 1D MotionMotion = change in position (x) Distance (d) = total path lengthScalar = magnitude only (speed) Vector = magnitude and direction (velocity) = indicated in BOLD type Displacement: x [m] = x2 - x1 Speed and velocity: (+ or -)
UCSD - BIBC - 100
Fig. 5-23 LehnFour beta strands from each of the variable domains (VH and VL) each form half of a beta barrelFig. 15-12 B and TSpace-lling model of the hypervariable regions of an Fab fragmentB and T 15-13Complex between lysozyme (antigen - in green)
Maryland - CHEM - 132
CHEM 131 - Dr. Eichhorn Fall 2005 - Exam II October 21, 2005 1.Name_(2pts) circle your correct section # and discussion time. 3522 (Th 12:30) 3527 (Th 2:00) 3531 (Tu 12:30) 3537 (Th 3:30) 3541 (Th 2:00) 3521 (Th 12:30)3517 (Tu 3:30) 3518 (Tony, Tu 3:30
UCSD - BIBC - 100
Protein Structure and Function in the Immune SystemFig. 15-1 B and TIg (immunoglobulin) structureB and T Fig 15-2Fig. 15-3 B and TFig. 5-24 LehnAntibody diversity is generated rst by gene rearrangementB and T Fig 15-5VHVLCH 1CLFig. 15-6 B and
UCLA - CEE - 11024155
Chapter 2Kinematics of Particles2.1 2.2 Some other stuff Cartesian Coordinates892.2.1 GOAL: Plot the path of someone following a map's directions. DRAW:Figure 1: Paths from map SOLVE: Figure 1 shows the two cases. (a) shows the map's original directi
UCLA - CEE - 11024155
Chapter 3Kinetics of Particles3.1 Cartesian Coordinates1233.1.1 GOAL: Determine via numerical integration how far a sliding bowl travels. GIVEN: Initial velocity of the bowl, inclination of the surface, coefficient of friction. DRAW:ASSUME: The bowl
UCLA - CEE - 11024155
Chapter 5Multiparticle Systems5.1 Force Balance and Linear Momentum1315.1.1 GOAL: Find center of mass of two particles. GIVEN: Position and mass of particles. DRAW:FORMULATE EQUATIONS: rG = SOLVE: rG = 1 [(2 kg)(4 m) + (3 kg)(4 i m)] (5 kg) = 1.6 m +
UCLA - CEE - 11024155
Chapter 9Vibratory Motions9.1 Undamped, Free Response for Single Degree of Freedom Systems739.1.1 GOAL: Find coefficients for complex exponential representation of a sinusoid. GIVEN: Coefficients of the cosine and sine terms FORMULATE EQUATIONS: We'll
UCLA - CEE - 11024155
Mathematics | Perspective Time | Space DESMA 9: Art, Science and Technology"the further art advances the closer it approaches science, the further science advances the closer it approaches art." Buckminster Fuller, 1938TODAY 4/9/07: Quick Review of last
UCLA - CEE - 11024155
Industrialization, Robotics, Kinetic / robotic art DESMA 9: Art, Science and TechnologyImagination is more important than knowledge. For knowledge is limited to all we now know and understand, while imagination embraces the entire world, and all there ev
UCLA - CEE - 11024155
Biology, Networks, Natural Systems, Artificial LifeDESMA 9: Art, Science and TechnologyWe are now in transition from an object-oriented to a systems-oriented culture. Here change emanates, not from things, but from the way things are done. Jack Burnham,
UCSD - BIBC - 100
Fig. 4-27 LehnFig. 4-27 LehnFig. 6-2 B and TMolten GlobuleFinal folded formFig. 6-5 B and TFig. 4-29 LehnFig. 4-28 LehnCrowded cytoplasm(tRNA in blue, ribosomes in green, proteins in red)Molecular Chaperones function analogously to human counter
UCSD - BIBC - 100
Protein Kinase Domain Alignments (all of the N lobe, part of the C lobe) < 1> P l oop < - 2 - - > < - - 3-><- B-> A002101_Rsk3 43 ISNHVKEGFEKADPSQFELLKVLGQGSYGKVFLVRKVTGSDAGQLYAMKVLKKATLKVRD A001562_Msk1 32 RTANLTGHAEKVGIENFELLKVLGTGAYGKVFLVRKISGHDAGKLYAM
UCSD - BIBC - 100
Lehn. Fig. 3-16Lehn Fig. 12-24Fig. 18-11 B and T>gi|156365516|ref|XP_001626691.1| predicted protein [Nematostella vectensis] MSFSYYTNTSSQSLARPLSAPILDEAFQAHGQSG HRFVRKTFTRPTYCHHCTDMLWGFTNQGFMCDVC NFVTHDRCMIFVTIPCVSIATTLVKIPVAHTWSG LSFSFRKKFCSVCRRRLEDIPA
North Texas - POLI SCI, - 3310
EUROPEAN DISCOVERY AND COLONIZATION I. Why did Europeans go to the New World? A. Gold B. Glory C. God II. Most exploration sponsored by national governments A. Spain B. Portugal C. France D. England III. English colonization A. Three geographical areas of
UCSD - BIBC - 100
Fig. 4-6 LehnAlpha helix stability affected by: Electrostatic repulsion or attraction between charged side chains Repulsion between bulky side chains Interactions between residues 3 - 4 apart Whether or not pro/gly present Amino acids at ends interacting
UCSD - BIBC - 100
Lehn. Fig. 3-9Lehn. Fig. 3-10In a highly basic solution (pH 13), the dominant form of glycine is: A) NH3+-CH2-COOH B) NH2-CH2-COOH C) NH2-CH3+-COOD) NH2-CH2-COOE) NH3+-CH2-COO-Fig. 3-12 LehnLehn. Fig. 3-13Lehn 3-14Lehn. Fig. 3-16Lehn 3-1402_31_pro