19 Pages

MOL457_2009_2

Course: MOL 457, Fall 2009
School: Princeton
Rating:
 
 
 
 
 

Word Count: 1263

Document Preview

Aspects MOL457Computational of Molecular Biology The Sequence Databases MOL457 Computational Aspects of Molecular Biology Types of Databases Nucleic Acid Genbank DNA Databank of Japan (DDBJ) European Molecular Biology Laboratory Database (EMBL) RefSeq RNA Protein Standalone Protein Identification Resource (PIR) UniProt Refseq - Protein Derived from translated nucleotide database Genpept TREMBL MOL457...

Register Now

Unformatted Document Excerpt

Coursehero >> New Jersey >> Princeton >> MOL 457

Course Hero has millions of student submitted documents similar to the one
below including study guides, practice problems, reference materials, practice exams, textbook help and tutor support.

Course Hero has millions of student submitted documents similar to the one below including study guides, practice problems, reference materials, practice exams, textbook help and tutor support.
Aspects MOL457Computational of Molecular Biology The Sequence Databases MOL457 Computational Aspects of Molecular Biology Types of Databases Nucleic Acid Genbank DNA Databank of Japan (DDBJ) European Molecular Biology Laboratory Database (EMBL) RefSeq RNA Protein Standalone Protein Identification Resource (PIR) UniProt Refseq - Protein Derived from translated nucleotide database Genpept TREMBL MOL457 Computational Aspects of Molecular Biology Primary and Secondary Databases Genbank DDBJ EMBL Primary Secondary PIR UniProt RefSeq GenPept TREMBL MOL457 Computational Aspects of Molecular Biology Database Formats Genbank is divided into 17 divisions Taxonomic reference PRI - primate sequences ROD - rodent sequences MAM - other mammalian sequences VRT - other vertebrate sequences INV - invertebrate sequences PLN - plant, fungal, and algal sequences BCT - bacterial sequences VRL - viral sequences PHG - bacteriophage sequences SYN - synthetic sequences MOL457 Computational Aspects of Molecular Biology Database Formats Genbank is divided into 17 divisions Classification reference UNA - unannotated sequences EST - EST sequences (expressed sequence tags) PAT - patent sequences STS - STS sequences (sequence tagged sites) GSS - GSS sequences (genome survey sequences) HTG - HTGS sequences (high throughput genomic sequences) HTC - HTC sequences (high throughput cDNA sequences) MOL457 Computational Aspects of Molecular Biology MOL457 Computational Aspects of Molecular Biology MOL457 Computational Aspects of Molecular Biology Entrez Genome The Genome database provides views for a variety of genomes, complete chromosomes, sequence maps with contigs, and integrated genetic and physical maps. The database is organized in six major organism groups: Archaea, Bacteria, Eukaryotae, Viruses, Viroids, and Plasmids and includes complete chromosomes, organelles and plasmids as well as draft genome assemblies. MOL457 Computational Aspects of Molecular Biology Sample Genbank Entry LOCUS AF111785 5925 bp mRNA linear PRI 01-SEP-1999 DEFINITION Homo sapiens myosin heavy chain IIx/d mRNA, complete cds. ACCESSION AF111785 VERSION AF111785.1 GI:4808814 KEYWORDS . SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Primates; Catarrhini; Hominidae; Homo. MOL457 Computational Aspects of Molecular Biology Sample Genbank Entry REFERENCE 1 (bases 1 to 5925) AUTHORS Weiss,A., McDonough,D., Wertman,B., Acakpo-Satchivi,L., Montgomery,K., Kucherlapati,R., Leinwand,L. and Krauter,K. TITLE Organization of human and mouse skeletal myosin heavy chain gene clusters is highly conserved JOURNAL Proc. Natl. Acad. Sci. U.S.A. 96 (6), 2958-2963 (1999) MEDLINE 99178997 PUBMED 10077619 REFERENCE 2 (bases 1 to 5925) AUTHORS Weiss,A., Schiaffino,S. and Leinwand,L.A. TITLE Comparative sequence analysis of the complete human sarcomeric myosin heavy chain family: implications for functional diversity JOURNAL J. Mol. Biol. 290 (1), 61-75 (1999) MEDLINE 99318869 PUBMED 10388558 REFERENCE 3 (bases 1 to 5925) AUTHORS Weiss,A. and Leinwand,L.A. TITLE Direct Submission JOURNAL Submitted (09-DEC-1998) MCDB, University of Colorado at Boulder, Campus Box 0347, Boulder, Colorado 80309-0347, USA MOL457 Computational Aspects of Molecular Biology Sample Genbank Entry FEATURES Location/Qualifiers source 1..5925 /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /chromosome="17" /map="17p13.1" /tissue_type="skeletal muscle" 1..5820 CDS /note="MyHC" /codon_start=1 /product="myosin heavy chain IIx/d" /protein_id="AAD29951.1" /db_xref="GI:4808815 MOL457 Computational Aspects of Molecular Biology Sample Genbank Entry /translation="MSSDSEMAIFGEAAPFLRKSERERIEAQNKPFDAKTSVFVVDPK ESFVKATVQSREGGKVTAKTEAGATVTVKDDQVFPMNPPKYDKIEDMAMMTHLHEPAV LYNLKERYAAWMIYTYSGLFCVTVNPYKWLPVYNAEVVTAYRGKKRQEAPPHIFSISD NAYQFMLTDRENQSILITGESGAGKTVNTKRVIQYFATIAVTGEKKKEEVTSGKMQGT LEDQIISANPLLEAFGNAKTVRNDNSSRFGKFIRIHFGTTGKLASADIETYLLEKSRV TFQLKAERSYHIFYQIMSNKKPDLIEMLLITTNPYDYAFVSQGEITVPSIDDQEELMA TDSAIEILGFTSDERVSIYKLTGAVMHYGNMKFKQKQREEQAEPDGTEVADKAAYLQN LNSADLLKALCYPRVKVGNEYVTKGQTVQQVYNAVGALAKAVYDKMFLWMVTRINQQL DTKQPRQYFIGVLDIAGFEIFDFNSLEQLCINFTNEKLQQFFNHHMFVLEQEEYKKEG IEWTFIDFGMDLAACIELIEKPMGIFSILEEECMFPKATDTSFKNKLYEQHLGKSNNF QKPKPAKGKPEAHFSLIHYAGTVDYNIAGWLDKNKDPLNETVVGLYQKSAMKTLALLF VGATGAEAEAGGGKKGGKKKGSSFQTVSALFRENLNKLMTNLRSTHPHFVRCIIPNET KTPGAMEHELVLHQLRCNGVLEGIRICRKGFPSRILYADFKQRYKVLNASAIPEGQFI DSKKASEKLLGSIDIDHTQYKFGHTKVFFKAGLLGLLEEMRDEKLAQLITRTQAMCRG FLARVEYQKMVERRESIFCIQYNVRAFMNVKHWPWMKLYFKIKPLLKSAETEKEMANM KEEFEKTKEELAKTEAKRKELEEKMVTLMQEKNDLQLQVQAEADSLADAEERCDQLIK TKIQLEAKIKEVTERAEDEEEINAELTAKKRKLEDECSELKKDIDDLELTLAKVEKEK HATENKVKNLTEEMAGLDETIAKLTKEKKALQEAHQQTLDDLQAEEDKVNTLTKAKIK LEQQVDDLEGSLEQEKKIRMDLERAKRKLEGDLKLAQESAMDIENDKQQLDEKLKKKE FEMSGLQSKIEDEQALGMQLQKKIKELQARIEELEEEIEAERASRAKAEKQRSDLSRE LEEISERLEEAGGATSAQIEMNKKREAEFQKMRRDLEEATLQHEATAATLRKKHADSV AELGEQIDNLQRVKQKLEKEKSEMKMEIDDLASNMETVSKAKGNLEKMCRALEDQLSE IKTKEEEQQRLINDLTAQRARLQTESGEYSRQLDEKDTLVSQLSRGKQAFTQQIEELK RQLEEEIKAKSALAHALQSSRHDCDLLREQYEEEQEAKAELQRAMSKANSEVAQWRTK YETDAIQRTEELEEAKKKLAQRLQDAEEHVEAVNAKCASLEKTKQRLQNEVEDLMIDV ERTNAACAALDKKQRNFDKILAEWKQKCEETHAELEASQKESRSLSTELFKIKNAYEE SLDQLETLKRENKNLQQEISDLTEQIAEGGKRIHELEKIKKQVEQEKSELQAALEEAE ASLEHEEGKILRIQLELNQVKSEVDRKIAEKDEEIDQMKRNHIRIVESMQSTLDAEIR SRNDAIRLKKKMEGDLNEMEIQLNHANRMAAEALRNYRNTQAILKDTQLHLDDALRSQ EDLKEQLAMVERRANLLQAEIEELRATLEQTERSRKIAEQELLDASERVQLLHTQNTS LINTKKKLETDISQIQGEMEDIIQEARNAEEKAKKAITDAAMMAEELKKEQDTSAHLE RMKKNLEQTVKDLQHRLDEAEQLALKGGKKQIQKLEARVRELEGEVESEQKRNVEAVK GLRKHERKVKELTYQTEEDRKNILRLQDLVDKLQAKVKSYKRQAEEAEEQSNVNLSKF RRIQHELEEAEERADIAESQVNKLRVKSREVHTKIISEEIISEE MOL457 Computational Aspects of Molecular Biology Sample Genbank Entry BASE COUNT 1890 a 1300 c 1613 g 1122 1 atgagttctg actctgagat ggccattttt ggggaggctg ctcctttcct 61 ccgaaagtct gaaagggagc gaattgaagc ccagaacaag ccttttgatg ccaagacatc agtctttgtg 121 gtggacccta aggagtcctt tgtgaaagca acagtgcaga gcagggaagg ggggaaggtg 181 acagctaaga ccgaagctgg agctactgta acagtgaaag atgaccaagt cttccccatg 241 aaccctccca aatatgacaa gatcgaggac atggccatga tgactcatct acacgagcct 301 gctgtgctgt acaacctcaa agagcgctac gcagcctgga tgatctacac ctactcaggc 361 ttgttctgtg tcactgtcaa cccctacaag tggttgccag tgtataatgc agaagtggtg 421 acagcctacc gaggcaaaaa gcgccaggaa gccccacccc acatcttctc catctctgac 481 aatgcctatc agttcatgct gactgatcgg gagaatcagt ctatcttgat caccggagaa 541 tctggcgcag ggaagactgt gaacaccaag cgtgtcatcc agtactttgc aacaattgca 601 gttactgggg agaagaagaa ggaagaagtt acttctggca aaatgcaggg gactctggaa 661 gatcaaatca tcagtgccaa ccccctactg gaggcctttg gcaacgccaa gaccgtgagg 721 aatgacaact cctctcgctt tggtaaattc atcaggatcc acttcggtac cacagggaaa 781 ctggcttctg ctgatattga aacatatctt ctggagaagt ctagagttac tttccagcta 841 aaggctgaaa gaagctatca tattttttat cagatcatgt ctaacaagaa gccagatcta 901 attgaaatgc tcctgatcac caccaaccca tacgattatg ccttcgtcag tcaaggggag 961 atcacagtgc ccagcattga tgaccaagaa gagttgatgg ctacagatag tgccattgaa 1021 attctgggct ttacttcaga tgaaagagtg tccatctata agctcacagg ggctgtgatg 1081 cattatggga acatgaaatt caagcaaaag cagcgtgagg agcaagctga gccagatggc MOL457 Computational Aspects of Molecular Biology UniProt Entry ID AC DT DT DT DE GN OS OC OC OX MY1D_HUMAN STANDARD; PRT; 674 AA. O94832; 28-FEB-2003 (Rel. 41, Created) 28-FEB-2003 (Rel. 41, Last sequence update) 28-FEB-2003 (Rel. 41, Last annotation update) Myosin Id (Fragment). MYO1D OR KIAA0727. Homo sapiens (Human). Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Primates; Catarrhini; Hominidae; Homo. NCBI_TaxID=9606; MOL457 Computational Aspects of Molecular Biology UniProt Entry CC CC CC CC CC CC CC CC CC CC CC CC CC CC CC CC CC CC CC -!- FUNCTION: MYOSINS ARE ACTIN-BASED MOTOR MOLECULES WITH ATPASE ACTIVITY. UNCONVENTIONAL MYOSINS SERVE IN INTRACELLULAR MOVEMENTS. THEIR HIGHLY DIVERGENT TAILS ARE PRESUMED TO BIND TO MEMBRANOUS COMPARTMENTS, WHICH WOULD BE MOVED RELATIVE TO ACTIN FILAMENTS (BY SIMILARITY). -!- SUBUNIT: Binds to calmodulin (By similarity). -!- TISSUE SPECIFICITY: Expressed in many tissues. Highest levels in brain, followed by lung and ovary; expression is lowest in spleen. -!- SIMILARITY: Contains 1 myosin-like globular head domain. -!- SIMILARITY: Contains 2 IQ domains. -------------------------------------------------------------------------This UniProt entry is copyright. It is produced through a collaboration between the Swiss Institute of Bioinformatics and the EMBL outstation the European Bioinformatics Institute. There are no restrictions on its use by non-profit institutions as long as its content is in no way modified and this statement is not removed. Usage by and for commercial entities requires a license agreement (See http://www.isb-sib.ch/announce/ or send an email to license@isb-sib.ch). -------------------------------------------------------------------------- MOL457 Computational Aspects of Molecular Biology UniProt Entry DR DR DR DR DR DR DR DR DR DR DR DR KW KW FT FT FT FT EMBL; AB018270; BAA34447.1; -. HSSP; P08799; 1MND. Genew; HGNC:7598; MYO1D. MIM; 606539; -. InterPro; IPR000048; IQ_region. InterPro; IPR001609; myosin_head. Pfam; PF00612; IQ; 2. Pfam; PF00063; myosin_head; 1. PRINTS; PR00193; MYOSINHEAVY. SMART; SM00015; IQ; 1. SMART; SM00242; MYSc; 1. PROSITE; PS50096; IQ; 1. Myosin; ATP-binding; Actin-binding; Calmodulin-binding; Repeat; Multigene family. NON_TER 1 1 DOMAIN <1 350 MYOS...

Find millions of documents on Course Hero - Study Guides, Lecture Notes, Reference Materials, Practice Exams and more. Course Hero has millions of course specific materials providing students with the best way to expand their education.

Below is a small sample set of documents:

Holy Cross College - M - 244
y&amp;yygVy0 v t cfw_pWy'gu yy'ygg Cg' 8t bCggCg ygypg g!giyyp yyg pgVcfw_dWy ypcfw_PpVyWV`!g |x |v ~| z ~ Wg 2 uuVcfw_ltpcfw_| g2yEVcfw_yC!pgyp s t ~v xs | z wvts iVg~'RCVWcfw_scfw_0lt2cfw_yxgur p`p pRgg'yp 'yp s | z wvts ip~0lt2cfw_yxgur c p `cRqVon
NYU - M - 125
1.Let f x = x + A cos x, where A 0 is constant.2For what values of A is this function concave down everywhere? Solution: f is concave down everywhere if f 00x 0 for all x. f 00x = 2 , A cos x is, however, always positive for some values of x whenever c
Rutgers - ITI - 230
Chapter 7: Identifying Needs and Establishing Requirements What are the user needs What are the different types of requirements, and how do they relate to user needs What are some different ways to gather data about needs and requirements How to analyze
University of Texas - I - 180
180J Introduction to Information StudiesInformation Studies: Whither and WhenceMary Lynn Rice-Lively School of Information Fall 2005 http:/www.ischool.utexas.edu/~180ml/Tunes: Loose Connections Loose Associations Square One : Coldplay : X&amp;Y Come Away
University of Illinois, Urbana Champaign - PHYS - 151
Same Question, Three MethodsA physics student tosses ball of mass 10kg straight up with an initial velocity of 8m/sec. In the below questions, you may neglect the very small friction from air resistance. Look at period of time from just after it leaves h
Stanford - QNTS - 1016
1 2 3 4 5 6 7 8WEISS &amp; YOURMAN JORDAN L. LURIE (130013) LEIGH A. PARKER (170565) 10940 Wilshire Boulevard Los Angeles, CA 90024 Telephone: 310/208-2800 Facsimile: 310/209-2348 WEISS &amp; YOURMAN JOSEPH H. WEISS 551 Fifth Avenue, Suite 1600 New York, NY 1017
UAB - CS - 593
S H w w u SI H w w u xDYu q&quot;tqYy u9 Yuqxyy ukgYEy8qYxjxyrYWkRDPIyxvYy &quot;uYSvT&amp;qAXt!&quot; sqYyr9x5vvuqY VjxyBiu$XrpX&amp;q &quot;yxjX r &amp; uYquX #qp&quot;qikQ 6BrDYr r&quot;$YjY qYvVuqYyjTuy$BrjXXY 2 5 4 S H yuYS urj3FudRhgfem#dc53YuqY&amp;q&quot;fbrDYuu(q&quot;VYyYWijj2 SX H 2 kRD`XYXEXPXWXP
Fayetteville State University - MAILER - 5400
EDF 5400Albert Oosterhof Lectures and Labs. Purpose Lecture meetsLab meets Tuesday or Thursday Tuesdays/Thursdays, 1:30 to 3 pmLabs not interchangeableSection 1: Tuesdays 12:30 to 1:20 pm Section 2: Thursdays 12:30 to 1:20 pmInitial reading a
UCSC - CMPE - 080
Internet AccessLAN to PoP (Point of Presence) (T1 or better) Modem to ISP (to PoP) POTS modem (56 Kb/sec max.) ISDN (2@ 6)4Kb/sec (A)DSL: 6.144 Mb/sec down, 576Kb/sec up Cable modem (via CATV) WirelessWirelessMobile internet access (ubiquitous / nomadi
UMass (Amherst) - RESEC - 112
Class Outline: ResEc112, May 8, 20071. Today: finish up logical design of CD database, form teams and pick projects, begin conceptual design of Guatemala project with collaborative quiz 2. Download database from course website 3. Will allow revisions of
Oregon State - ANS - 310
Livestock FeedingnChange in What We DonIntroductionn nNomadic Agrarian Urban&lt;2% of US population involved in producing food Changes in way livestock are fednKnowledge continues to increasen nLand Grant Institutions Private companiesPer Capita
Dallas - GAP - 017500
Generic Autonomous Platform for Sensor Systems(GAP4S) Project Description Goals and Expected ResultsThe generic autonomous platform for sensor systems, GAP4S, project aims at the development of a generic platform for sensor systems with on-board micro-b
SHSU - MATH - 143
Math 143 Fall, 2005 Quiz 20 - 8.7Name: SolutionsComplete the following problems. Show all work to receive full credit. x around a = 0. 1-x1. Find the Taylor series for f (x) = f (x) =(1 - x) - x(-1) 1-x+x 1 = = = (1 - x)-2 2 2 (1 - x) (1 - x) (1 - x)2
Oakland University - ME - 463
Trade Study: Design of Support Strut Used in Capping SystemMichael G Mack AME 40463 Senior Design Project Group B3: Product PackagingUniversity of Notre Dame Department of Aerospace and Mechanical EngineeringFebruary 28, 2008AbstractThe purpose of th
Tennessee - MATH - 151
Linear Regression and Correlation Notes Suppose there is a data set of n data points (x i , y i ) where you have plotted these using a scatter plot and it appears that a linear relationship between them is reasonable. Then the least-squares line (regressi
UCSD - BGGN - 220
www.sciencemag.org/cgi/content/full/313/5786/533/DC1Supporting Online Material forActivated Signal Transduction Kinases Frequently Occupy Target GenesDmitry K. Pokholok, Julia Zeitlinger, Nancy M. Hannett, David B. Reynolds, Richard A. Young* *To whom
St. Anselm - NR - 5181
Directions to Head Start1. Take a right out of campus onto Saint Anselm Dr. 2. At stop sign take right onto Rockland Ave, follow to end 3. At the end there is a stop light (Bank of NH on left) take a right onto S. Main St. 4. At first set of lights on Ma
Wesleyan - GRK - 202
Worksheet 5: Medea Sections 11, 12 (lines 488521) (3 expressed subjects; 17 main verbs) prw talanaw Pelidaw; kalw g' n ka&lt; tay' f' mn, OE kkist' ndrn, on payn djaint m' okoiw oen patra kat prodvkaw mw, kain d' ktsv lxh, ktanon. padvn gegtvn: efi gr sy' pa
Fayetteville State University - MAILER - 5400
Supplement 6 EDF 5400 Oosterhof Pretest Scores X 7 5 4 3 1 Posttest Scores Y 9 13 5 7 1=z X zY NX 7 5 4 3 1 Y 9 13 5 7 1 7.00 4.47r=zzX 1.34 0.45 0.00 -0.45 -1.34 0.00 1.00X Yzn 1zY 0.45 1.34 -0.45 0.00 -1.34 0.00 1.00 zXzY 0.60 0.60 0.00 0.00 1
Rochester - CSC - 256
Operating Systems4/14/2004Concurrent Online ServersConcurrent Online ServersServers thataccept concurrent requests (potentially high concurrency) serve online users (interactive responses) Web server: online server that implements HTTP More complex o
Iowa State - MAY - 0711
Highway Deer Identification System Project PlanMay 07-11 Client:Senior Design Advisor: Dr. Degang Chen Team Members: Tony DeLouis Matt Bonneau Nathan Schoening Steven Schreiber REPORT DISCLAIMER NOTICEDISCLAIMER: This document was developed as a part o
Stanford - ERTS - 1034
1 2 3 4 5 6 7 8KEKER &amp; VAN NEST, LLP ROBERT A. VAN NEST - #84065 JAN NIELSEN LITTLE - #100029 MICHAEL D. CELIO - #197998 710 Sansome Street San Francisco, CA 94111-1704 Telephone: (415) 391-5400 Facsimile: (415) 397-7188 Attorneys for Defendants LAWRENCE
San Diego State - BIO - 210
E X E R C I S EOther MicroscopesOBJECTIVESAt the conclusion of the exercise, you should.21. understand the difference between brightfield, darkfield, phase, and fluorescent microscopy. 2. know the purpose and characteristics of electron microscopes (
Bethel VA - CS - 404
'$All-Pairs Shortest Paths All-Pairs Shortest PathsInput: A directed graph G = (V, E) where each edge (vi, vj ) has a weight w(i, j). Output: A shortest path from u to v, for all u, v V . Weight of path: Given a path p =&lt; v1, ., vk &gt;, its weight is:k1
Penn State - SER - 163
APPENDIX B Brief outline for each course topic Week 1: Introduction to Mixed Methods Research The first class of the semester will serve as a brief introduction to mixed methods research. The course will be a combination of discussion and lecture. After a
Bethel VA - CS - 404
'$Driving directions Driving directionsFrom Austin to Athens many possible routes:&amp; CS404/504Computer Science Design and Analysis of Algorithms: Lecture 14 1%'$Problem: Single-Pair Shortest Path Problem: Single-Pair Shortest PathInput: A directe
University of Toronto - DGP - 384
CSC384: Lecture 11Last time D-separation and inference in belief networks Today Variable elimination; decision making; utility theory Readings:Today: 10.3, 10.4 (utility theory) Next week: 10.4 (decision trees and decision nets)Announcements: Check ou
Iowa State - NR - 45342
September, 2006 Greetings,When it's harvest time, the pressure is on. Good weather and daylight hours always seem to be at a premium. Harvest can be a dangerous season. National Farm Safety &amp; Health Week is September 17-23 and serves to remind us that it
Iowa State - CHEM - 332
Seat No. _ Circle your recitation number and time: (1) Mon. 2 pm (2) Mon. 4 pm (3) Tues. 9 am (4) Tues. 11 am (5) Tues. 12 pmName_ (Please print your name and circle your last name)CHEMISTRY 332 EXAM V Friday, December 2, 2005I. II. III. IV. V.(22 poi
University of North Carolina, Wilmington - CHM - 495
The binding specificity of certain proteins for calcium over other more abundant group 1A and 2A metal ions is explored. Special attention is paid to the amide backbone bond to the calcium ion through the peptide bond carbonyl. Our hypothesis is based upo
UCF - CAP - 6135
Paper Presentation CAP 6135OutlineReview - DNS Proposed Solution Simulation Results / Evaluation DiscussionPage 2Domain Name System - DNSDNS is a name resolution service which resolves host names into IP address DNS is a distributed database applicat
Hudson VCC - PSS - 221
History and Origin History and Origin PresentationTemperate zone, deciduous trees Origin in areas with cold winters Mechanisms for winter dormancy and spring budbreak and flowering Generally adapted for animal dispersal Colorful fruit Often seeds are poi
Mississippi State - ECE - 4532
CD Organizer SystemSenior Design I Instructor: Dr. Joe Picone Team MembersDr. Noel Schulz Team AdvisorBrandt Howell Team LeaderChintu Patel Caymran Cummings Umut KayaAbstractIn this project we will:Construct rack to hold CDs Use a RS232 driv
Michigan State University - RICHA - 457
Poetry Day 1: Poetic Form(70 pts total)Poetry: language condensed for artistic effect. Take the following paragraph and re-write it in the space below to look more like you think a poem should look (10 pts). HINT: before you start writing, read the para
Clarkson - ME - 411
INTRODUCTION TO HEAT TRANSFER (ME 411)Summer 2003Lecture Number VAli R. MazaheriCourse webpage: www.clarkson.edu/~mazahear/MAIN/ME411Department of Mechanical and Aeronautical Engineering Clarkson UniversityUnsteady State Conduction (Transient Heat T
Rochester - CSC - 256
Outline Background Protection and Isolation Recent Software InnovationsProtection and Extension in the Microsoft Singularity Operating SystemMichael Spear csc 256/456 25 April 2007 Singularity End to End System Trust -vs- Verification Safe Microkern
Cal Poly Pomona - EGR - 403
Project OverviewPersonal Investment Options Flying: Timeshare v. CommercialEGR 403 Team 6 Andrew Muller, Andrew Pagsisihan , Brian Taylor, Chau Dang, and Omar CastilloDescriptionMid-sized International Company Offices in Los Angeles, New York and Lond
Carnegie Mellon - ANDREW - 213
15213 Recitation 9Eugene Marinelli Section E 3/26/07 OutlineAnnouncements Course material Exam questions AnnouncementsQuiz this week (usual due date) fuselab due next Tuesday (4/3) Next exam is April 10 OutlineAnnouncements Course material
Washington University in St. Louis - CIS - 788
ISDNISDNBy Thomas A. Fine, (fine@cis.ohio-state.edu) ABSTRACT: Described here are the basics of ISDN, including much pracitical information for the consumer, as well as some fairly technical descriptions of ISDN, and finally some discussion on where ISD
New Mexico - P - 102
Chapter 6 Momentum Impulse Impulse Changes Momentum Bouncing Conservation of Momentum CollisionsMomentum: Inertia in motion - or - mass in motion . Carries the notion of both mass (inertia) and velocity (motion) Momentum = mass x velocity (momentum is i
Oregon - EG - 595
Perspectives 595G, Linguistic Perspectives on English Grammar, ENG 595G, 2007 Study Questions #4Due in your first class section, week 5 (Tuesday, Oct. 30th or Friday, Nov. 2rd) Reading: Berk, Chapters 2 and 3NOTE: There is a lot of detailed information
UMBC - EN - 699
EN 699 Old English Vocabulary for Quiz 5 Words that are fair game for Quiz 5 (Oct. 29) on ch. 8 of Reading Old English: r (prep.) before r m e (conj.) before b odan (strong 2) command b tan, b ton (prep.) without b tan, b ton (conj.) unless cuman (strong
Texas San Antonio - CRIM - 3113
SIGMUND FREUDPSYCHOANALYTICPsycho-Biological Unconscious Libido Blockage Mechanisms Pathologies In Personality Base In Mechanisms
Stanford - JDSU - 1023
Case 4:02-cv-01486-CWDocument 1569Filed 10/01/2007Page 1 of 21 MICHAEL J. SHEPARD (Bar No. 91281) HOWARD S. CARO (Bar No. 202082) 2 HELLER EHRMAN LLP 333 Bush Street 3 San Francisco, CA 94104-2878 Telephone: (415) 772-6000 4 Facsimile: (415) 772-6268
U. Houston - BIOINFO - 1301
getting started with myitlabbefore you registerBefore you register, be sure you have: A valid email address Course ID from your instructor Student access coderegistering for myitlab1. Start your browser and go to www.myitlab.com. 2. Click the Student
University of Illinois, Urbana Champaign - BRL - 473
Helmholtz Resonator (sec 10.8)Neck: Area S, Length L ! &gt; L Rigid walled cavity of volume VLooking more closely at the neck. Vibrating gas &quot;plug&quot; with &quot;effective mass&quot; = ! oSl' where l' &gt; L, and where l' = effective length.S = !a2L = Actual lengthl' =
Rochester - PHY - 235
Physics 235 Chapter 13 Continuous Systems; WavesChapter 13In previous Chapters we have focused on the description of rigid bodies, which are systems of particles whose relative positions are fixed, independent of the overall motion of the system. Most b
University of South Dakota - EDER - 893
EDER 893 Summer 2008 Test 1 In all cases, show your work, explain your assumptions, and annotate your printouts. Don't forget this:Also, provide an APA-style write-up of the results including the steps you took, the logic you used to arrive at your conclu
UNL - M - 203
Part A Choose one of the following four options. (And dont forget to do Part B!) (1) Think of a novel real-world problem for which a graph might be useful for nding a solution. The book has given us several examples such as the meter maid problem, the sno
UNI - CS - 062
Session 7 Introduction to InheritanceAccumulator Example a simple calculator app classes needed: AdderApp - contains main AddingFrame - GUI CloseableFrame - allows X button Accumulator - internal representation and implementation of the accumulatorAdd
Harvard - COMP - 232
NAME_ Wentworth Institute of TechnologyDivision of Professional and Continuing StudiesCOMP232 Section 71 - Computer Programming with Java II - Fall, 2003P1 P2 TotalFinal Open Book1.In the paint method of a class that extends JFrame, write a code fra
Slippery Rock - CPSC - 150
Lecture 8.4Event Handling Design Using EventButtonInheritance for Event HandlingSomeclassesincludetheirowneventhandlermethod(s). Suchclasses. 1)inherittheclasswiththeeventhandler 2)overridetheeventhandlerinthesubclassExamplepublicclass Director exten
Slippery Rock - CPSC - 150
Lecture 3.1Using Graphics with JFramejavax.swing.JFrame- int x - int y - int width - int height - Color backColor constructor + JFrame(String) update + void add(java.awt.Component, int) + void remove(java.awt.Component) + void repaint( ) + void setBack
University of Scranton - CMPS - 202
XMLWhat it is and how it worksWhat is XML?eXtensible Markup Language XML was designed to describe data and to focus on what data is. HTML was designed to display data and to focus on how data looks.What is XML? XML is a markup language much like HTM
Hobart and William Smith Colleges - GEO - 240
Geoscience 240 Using the Vreeland SpectroscopeMineralogySAFETY ISSUES! o Eye damage: Splinters in eye from sample preparation-WEAR GOGGLES o Eye damage: Never look at the arc directlymake sure specimen chamber door is closed! o Burns: Samples and resist
Bluffton University - PHY - 202
PHY 202 Astronomy Chapter 11 - Jupiter Words gas planet differential rotation bands great red spot Galilean Moons Io Europa Ganymede Callisto Big Moons In Solar System. Ganymeade 5270 km diam Titan 5150 Callisto 4800 Io 3640 Earth Moon 3476 Europa 3130 Id
San Jose State - MS - 101
Worksheet #7Polynomial Addition and Multiplication ProblemsE. White Fall 2004 Simplify each of the following problems. (1) 2 x 3 x (4) 3 x + 4 y 8 x + 4 y (7) 9 z + 4 x 22 z 11 x (10) (x + y ) (13) 3 x y 2 x2 y + 4 x y 2 5 x y (16) x (2 x + 1)2(2) 3 x
Oregon - M - 243
Quiz # 2 04/15/08Name: Directions: Make sure to read each problem carefully. Make sure to show all of your work to receive full credit. Problem 1. Suppose a school administers a test to its students measuring intelligence. The resulting data is normally
CSU Bakersfield - GS - 390
Car Loan-Typical used car loan as of May 20, 2004-Example shown was from Kern Schools Calculation Total Cost 15500 Used Interest rate 8.75 Based on credit score(FICA) and New vs Used. Ppoint higher for A or A+ increases with c Payment $320 We used a typic
Iowa State - EE - 418
EE/CprE 418 Fall 2005 Working with TDR and Slotted line Please note: When you are in the lab we would like you to do the following 1. Please be courteous, there are more than a few of us and in a very small area with sensitive equipment. 2. Please be pati
Western Kentucky University - TXT - 323
Bush Rejects Rise in Payroll Tax to Underpin Social SecurityDecember 9, 2004 By DAVID STOUT WASHINGTON, Dec. 9 - A showdown between the White House andCongressional Democrats over Social Security seemed certaintoday as President Bush ruled out a payr