1 Page

Notes for Men who stare at goats

Course: ECON 101, Fall 2011
School: Allan Hancock College
Rating:
 
 
 
 
 

Word Count: 374

Document Preview

cultivateextrasensoryperceptionthatwouldallowtheU.S.armytowinwarsnonviolently.Billnowhasa secretmissioninIraq,andallowsBobtocomealong.Astheduogetsintoaseriesofmisadventures,Lynshares withBobthecolorfthimselfintothecountryuntilhechancesuponLyn.It turnsoutLynspentdecadesaspartoftheNewEarthArmywholivedanewagelifestyleinanattemptto Whatdoesthismean?First,givemeabriefdescriptionofthetext(nomorethanonepage)...

Register Now

Unformatted Document Excerpt

Coursehero >> California >> Allan Hancock College >> ECON 101

Course Hero has millions of student submitted documents similar to the one
below including study guides, practice problems, reference materials, practice exams, textbook help and tutor support.

Course Hero has millions of student submitted documents similar to the one below including study guides, practice problems, reference materials, practice exams, textbook help and tutor support.
cultivateextrasensoryperceptionthatwouldallowtheU.S.armytowinwarsnonviolently.Billnowhasa secretmissioninIraq,andallowsBobtocomealong.Astheduogetsintoaseriesofmisadventures,Lynshares withBobthecolorfthimselfintothecountryuntilhechancesuponLyn.It turnsoutLynspentdecadesaspartoftheNewEarthArmywholivedanewagelifestyleinanattemptto Whatdoesthismean?First,givemeabriefdescriptionofthetext(nomorethanonepage) TheMenWhoStareatGoatsbeginsasheartbrokenreporterBobWiltonheadsofftoimbedhimselfwith troopsastheIraqWarstarts,butWiltoncan'tgeulhistoryoftheNewEarthArmyandchroniclesthenefariousmachinationsofLarry HooperwhosejealousyofLyn'sremarkableskillbroughtanendtothegroup. thenexplainhowitcouldbeusedforthiscourse(howwouldyouteachit)?wherewouldyouplaceitinthe course? ThismoviecanbeusedintheConstructivismUnit.IwouldtalkaboutspecificallytheHumanNatureofCon structivism. whichconceptsmightthistextreinforceorexpose? thenatureofparticularhumanbeingsorgroupsofpeopleareproductsofculturalandsocialcircumstances. Nothingispredeterminedpriortosociety.Thereisnosuchthingashumannature. SomemovieexamplescanbetheEarthArmybeingagroupthatisaproductofIdeaandthesepeopleare thoughttothinkacertainwayandactacertainway. "MotherEarth,youaremylifesupportsystem.AsasoldierIwilldrinkyourbluewater,liveinsideyourred clayandeatyourgreenskin.HelpmetobalancemyselfasyouholdandbalancetheEarth,theseaandthe spaceenvironments.Helpmetoopenmyheartknowingtheuniversewillfeedme.Ipraymybootswillalways kissyourfaceandmyfootstepsmatchyourheartbeat.Carrymybodythroughspaceandtime.Youaremycon nectiontotheuniverseandallthatcomesafter.Iamyoursandyouaremine.Isaluteyou."ThisSalutecanbe seenasaconstructivismHumanNatureIdea.
Find millions of documents on Course Hero - Study Guides, Lecture Notes, Reference Materials, Practice Exams and more. Course Hero has millions of course specific materials providing students with the best way to expand their education.

Below is a small sample set of documents:

Allan Hancock College - ECON - 101
Question #3 Where would you place this in the course?The Men Who Stare at Goats, Should be used in the Constructivism Unit. Spe cifically When discussing Epistemology which means Theory of knowledge; How youknow what you know For example in the film Spa
Allan Hancock College - ECON - 101
Reviewer WorksheetName of reviewer:Elisabeth Orloff1. Name of the writer and title of the paperDefensive Realism in ActionMijoi Mitchell2. Film under review: Dr. Strangelove scene: Cant find a specific Scene3. Is there a central claim, argument, or
Allan Hancock College - ECON - 101
Nevin TawilENG 10211/21/11Sixteen and Pregnant!Television has become a huge integral part of homes in the modern world, and it is extremely hard to imagine life without television. It provides entertainment to people of all ages especially children an
Allan Hancock College - ECON - 101
Hahn 1Cory HahnProfessor NoschkaEnglish 10222 november 2011Drama With the LawNobody ever wants to deal with the law and the legal issues that arise with the lawand that is no different in the movie, The Lincoln Lawyer. Although if someone is intro
Rutgers - BIO - 113
Can you read this?Biology 113Winter, 2007OSU-Mansfield CampusStephen T. Abedonabedon.1@osu.eduBio 113 BasicsHow to do well: Conscientiously read your text before lectures Learn from your text, use PowerPointpresentations (i.e., lectures) to help
Rutgers - BIO - 113
Biology 113Winter, 2007OSU-Mansfield CampusStephen T. Abedonabedon.1@osu.eduCan you read this?If you cant read thisthen you really oughtto move to a new seat!How about now?If you cant read thisthen you really oughtto move to a new seat!About
Rutgers - BIO - 113
Important Point:Chapter 1a:Exploring Life(sections 1.1, 1.2, 1.6)You will be responsible for these on the firstmidterm exam (1.1, 1.2, 1.5, 1.6, 2, 3, 4, 5, 6)Section 1.5 of chapter 1 we will cover duringthe first first labTo view lecture notes go
Rutgers - BIO - 113
Chapter 1a:Exploring Life(sections 1.1, 1.2, 1.6)Important Point:First Things First Today we will cover chapters 1, 2, & maybe 3 These are an intro to biology and a review ofgeneral and water chemistryplease readthese chapters You will be respons
Rutgers - BIO - 113
Important Point:"Scientists are critical realists. John Polkinghorne"Science is properly described as organizedskepticism, a realm in which nothing is to beaccepted without question. Philip W. Andersonnevertheless, and probably quite accurately,Marg
Rutgers - BIO - 113
Chapter 1b:Exploring Life(section 1.5)Important Point:What is Science? ".science is simply common sense at its best; thatis, rigidly accurate in observation and merciless tofallacy in logic." Thomas Henry Huxley, 1880 "Scientists are critical real
Rutgers - BIO - 113
Chapter 1c:Exploring Life(section 1.5, first lab)ExperimentationAsking Good QuestionsForming HypothesesTesting HypothesesAs you can see by our continued emphasis of thisthird section on testing hypotheses, a great deal ofa scientists time is spen
Rutgers - BIO - 113
Chapter 1c:Exploring Life(section 1.5, first lab)Experimentation Asking Good Questions Forming Hypotheses Testing Hypotheses As you can see by our continued emphasis of thisthird section on testing hypotheses, a great deal ofa scientists time is
Rutgers - BIO - 113
Energy =capacity to doworkElectron clouds can become largeTo increase in size, energy must be absorbedThe different states of potential energy thatelectrons have in an atom are called energy levels.Campbell & Reece (2005) p. 36Elements in BodyNot
Rutgers - BIO - 113
Chapter 2:The ChemicalContext of LifeElements in BodyTraceelements arefound insmalleramounts butneverthelessare essentialto a healthfulexistenceAtomic ModelsNote electroncloudMore Models of AtomsNote electron cloudNoteelectroncloudEne
Rutgers - BIO - 113
HOCHHMethane: Replace C with O and 2xH with2 x Electron Pairs and you have Water!Water molecules adhere to othermolecules (adhesion)Liquid water effects hydrophobicexclusionLiquid water has high specific heatLiquid water has high heat of vapori
Rutgers - BIO - 113
Chapter 3:Water and theFitness of theEnvironmentH2O & Polar CovalenceH2O Bent GeometryHHOCHHMethane: Replace C with O and 2xH with2 x Electron Pairs and you have Water!H2O & Hydrogen BondsMaximum offour H bondsH2O Properties from H Bonds
Rutgers - BIO - 113
Important Point:Chapter 4:Carbon and theMolecularDiversity of LifeIsomers arecompounds thatshare molecularformulas but differ insome way in termsof their structureBut only HydrocarbonDerivatives are Abundant in LifeRepresentational ModelsRot
Rutgers - BIO - 113
Chapter 4:Carbon and theMolecularDiversity of LifeImportant Point:Hydrocarbons areCarbon ChemistrySimplerIsomers arecompounds thatshare molecularformulas but differ insome way in termsof their structureBut only HydrocarbonDerivatives are Ab
Rutgers - BIO - 113
Polymers / MonomersPolymers, Monomers, and LipidsDehydration (Polymer) Synthesispolymerpolysaccharidecategory ofbiomoleculesmonomercarbohydrates monosaccharidespolypeptidesproteinsamino acidspolynucleic acidsRNA & DNAnucleotidesHydrolysisPo
Rutgers - BIO - 113
Chapter 5a:The StructureandFunction ofMacromolecules(Carbohydrates)Important Point:Polymers / Monomers Many macromolecules consist of polymers A polymer is a large molecule built up fromsmaller building block molecules Monomers (a.k.a., subunit
Rutgers - BIO - 113
Polymers, Monomers, and LipidsSaturated & Unsaturated F.A.Steroid hormoneSex hormoneTestosteroneEstrogenWaxesLardOmega-3-fatty acidsFree fatty acidsButterMargarineOlive oilFlax seed oilToasted Sesame oilBile saltsVegetable shorteningHydro
Rutgers - BIO - 113
Chapter 5b:The StructureandFunction ofMacromolecules(Lipids)Polymers, Monomers, and Lipidspolymercategory ofbiomoleculesLipids possespolysaccharide carbohydratesnumerous C-H bonds(i.e., they are verypolypeptidesproteinshydrocarbon-like)po
Rutgers - BIO - 113
Chapter 5c:The StructureandFunction ofMacromolecules(Proteins)Polymers, Monomers, and Lipidspolymercategory ofbiomoleculesmonomerpolysaccharidecarbohydratesmonosaccharidespolypeptidesproteinsamino acidspolynucleic acidsRNA & DNAnucleoti
Rutgers - BIO - 113
Polymers, Monomers, and LipidsChapter 5d:The Structure andFunction ofMacromolecules(Nucleic Acids)polymercategory ofbiomoleculesmonomerpolysaccharidecarbohydratesmonosaccharidespolypeptidesproteinsamino acidspolynucleic acidsRNA & DNAnuc
Rutgers - BIO - 113
Important Point:Surface-to-Volume RatioMost Cells are SmallChapter 6:A Tour of the CellFrog eggs 100-times &chicken egg 1000times larger than mostplant and animal cellsMore Size ComparisonsNote relative sizeof nucleated cellsany onecellembody
Rutgers - BIO - 113
Chapter 6:A Tour of the CellImportant Point:Most Cells are SmallFrog eggs 100-times &chicken egg 1000times larger than mostplant and animal cellsNote relative sizeof nucleated cellsNote relative size ofbacteria (~1/10 sizeof animal/plant cells)
Rutgers - BIO - 113
Important Point:Fluid Mosaic ModelThe ability of the cell todiscriminate in its chemicalexchanges with theenvironment is fundamentalto life, and it is the plasmamembrane that makes thisselectivity possible.For more on this history, see: http:/www
Rutgers - BIO - 113
Chapter 7:MembraneStructureand FunctionImportant Point:Lipid BilayerThe ability of the cell todiscriminate in its chemicalexchanges with theenvironment is fundamentalto life, and it is the plasmamembrane that makes thisselectivity possible.Fl
Rutgers - BIO - 113
Important Point:Chapter 8:And Introductionto MetabolismCatabolic reactions are energy yieldingThey are involved in the breakdown ofmore-complex molecules into simplerones1st & 2nd Laws of ThermodynamicsEnergy can betransferred ortransformed but
Rutgers - BIO - 113
Chapter 8:An Introductionto MetabolismImportant Point:Metabolism (Overview) Metabolism = Catabolism + Anabolism Catabolic reactions are energy yielding They are involved in the breakdown ofmore-complex molecules into simplerones Anabolic reactio
Rutgers - BIO - 113
Important Point:Chapter 9:Cellular RespirationBioenergeticsOxidation and ReductionHarvestingChemical EnergyHydrocarbon Oxidation to CO2Oxidation is the Loss of ElectronsE.g., something that is oxidized in the course of achemical reaction with Ox
Rutgers - BIO - 113
Chapter 9:Cellular RespirationHarvestingChemical EnergyImportant Point:BioenergeticsOxidation and Reduction Oxidation is the Loss of Electrons E.g., something that is oxidized in the course of achemical reaction with Oxygen has had electronsstol
Rutgers - BIO - 113
Important Point:Chapter 9:PhotosynthesisHowever, the above is a bit of a lieThese areautotrophsBioenergeticsDiversity of PhotosynthesizersBioenergeticsPhotosynthesis Rxn Overview1Thylakoids aremembrane-boundorganelles inside of amembrane-bou
Rutgers - BIO - 113
Chapter 9:PhotosynthesisImportant Point:BioenergeticsPhotosynthesis Rxn OverviewHowever, the above is a bit of a lieDiversity of PhotosynthesizersThese areautotrophsBioenergeticsChloroplast (a plastid)Thylakoids aremembrane-boundorganelles in
Rutgers - BIO - 113
Important Point:These communications are deliberatelyinitiated, received, and interpreted in order toincrease the physiological coordination of thecells in multicellular organismsWe will consider in particular those eventsthat follow the reception o
Rutgers - BIO - 113
Chapter 11:Cell CommunicationImportant Point:Signal-Transduction Emphasis This chapters emphasis is on signals that arereleased from one cell and allowed to freelydiffuse to a second (or more) recipient cell(s) These communications are deliberately
Rutgers - BIO - 113
Important Point:Chapter 12:The Cell CycleProkaryotes are comparatively simple, with onlyone chromosome, so have a relatively easy timesorting daughter chromosomes to daughter cellsEukaryotes, with their longer DNA and multiplechromosomes, dont have
Rutgers - BIO - 113
Chapter 12:The Cell CycleImportant Point:Chromosome Sorting The goal of cell division typically is to equallypartition two more-or-less identical copies ofgenetic material between two daughter cells Prokaryotes are comparatively simple, with onlyo
Rutgers - BIO - 113
Important Point:Eukaryote chromosomes come in pairs(homologues)Homologous Chromosome PairsCreated by mitosisalone (awww, alittle baby clone)Autosomes and Sex ChromosomesDiploidyAsexual ReproductionChapter 13:Meiosis andSexual CyclesNormal hum
Rutgers - BIO - 113
Chapter 13:Meiosis andSexual CyclesImportant Point:Asexual ReproductionCreated by mitosisalone (awww, alittle baby clone)Homologous ChromosomePairs Eukaryote chromosomes come in pairs(homologues) Normal humans have 46 chromosomes in 23 pairs
Rutgers - BIO - 113
Important Point:Chapter 14:Mendel andthe Gene IdeaGregor MendelThe best way to gain anunderstanding of geneticsis to work with it. Thefundamental principlesdiscussed (below) willbecome clear to you, andyou will grasp them moresurely, if you ca
Rutgers - BIO - 113
Chapter 14:Mendel andthe GeneIdeaImportant Point:Doing Well in 113! Do you feel that you knew the material going in to thelast exam? At what level do feel you knew the material? Familiar with it in a general way? Able to recognize specifics if y
Rutgers - BIO - 113
Important Point:Chromosomal Basis of InheritanceChapter 15:The ChromosomalBasis of InheritanceIndependent AssortmentNotice that one-half ofthe offspring are expectedto inherit a phenotype thatmatches one of heparental types. p. 278,Campbell & R
Rutgers - BIO - 113
Important Point:Chromosomes consist of both DNA and ProteinDNA was discovered before its role in hereditywas understoodPeople had a sense that chromosomesembodied inheritance before they understoodthat DNA was the hereditary materialPeople did not
Rutgers - BIO - 113
Important Point:Flow of InformationDNADNA = ReplicationDNARNA = TranscriptionRNAProtein = TranslationRNADNA = Reverse TranscriptionProtein RNA or DNA: DOES NOT HAPPEN!Nucleic acid sequence is most readilytranslated into protein sequenceBut pr
Rutgers - BIO - 113
Chapter 17:From Geneto ProteinImportant Point:Flow of Information DNA DNA = Replication DNA RNA = Transcription RNA Protein = Translation RNA DNA = Reverse Transcription Protein RNA or DNA: DOES NOT HAPPEN! Nucleic acid sequence is most readily
Rutgers - BIO - 113
Important Point:Microbiology is the science that studiesmicroorganismsMicroorganisms, roughly, are those living thingsthat are too small to be seen with the naked eyeMicroorganisms cannot be distinguishedphylogenetically from Macroorganisms, e.g.,i
Rutgers - BIO - 113
Chapter 18:The Genetics ofViruses andBacteriaImportant Point:What is Microbiology? Microbiology is the science that studiesmicroorganisms Microorganisms, roughly, are those living thingsthat are too small to be seen with the naked eye Microorgan
Rutgers - BIO - 113
Important Point:Chapter 19:EukaryoteGenomesOrganization, Regulation,and EvolutionMetazoan Phenotypic ComplexityControl of Gene ExpressionDifferent celltypes expressdifferent genesIn general,organisms areable to modifytheir phenotypein respo
Rutgers - BIO - 113
Chapter 19:EukaryoteGenomesOrganization, Regulation,and Evolution(through section 19.2 only)Important Point:Metazoan Phenotypic ComplexityDifferent celltypes expressdifferent genesPhenotypic Plasticity To survive, organisms must be able to ada
Rutgers - BIO - 113
Important Point:Cloning Step in OverviewDNA technology is the chemical manipulation of thegenotypes and resulting phenotypes of organismssuch that living organisms are modifiedAlternatively, no-longer-living organisms or their nolonger-living parts m
Rutgers - BIO - 113
Chapter 20:DNA Technologyand GenomicsImportant Point:DNA Technology DNA technology is the chemical manipulation ofthe genotypes and resulting phenotypes oforganisms such that living organisms are modified Alternatively, no-longer-living organisms
Rutgers - BIO - 113
Can you read this?Chapter 22:Decent withModification:A DarwinianView of LifeIf you cant read thisthen you really oughtto move to a new seat!Important Point:How about now?The material we cover in Bio 114 is very different from thatcovered in Bi
Rutgers - BIO - 113
Chapter 22:Decent withModification:A DarwinianView of LifeCan you read this?If you cant read thisthen you really oughtto move to a new seat!How about now?If you cant read thisthen you really oughtto move to a new seat!Important Point:Darwini
Rutgers - BIO - 113
Important Point:Chapter 23:The Evolution ofPopulationsA polymorphism ismore than one allelepresent at a givenlocus within a singlepopulation oforganismsGene PoolsPolymorphismA gene pool is the sumof alleles at all lociwithin a populationPop
Rutgers - BIO - 113
Chapter 23:The Evolution ofPopulationsImportant Point:Gene PoolsA gene pool is the sumof alleles at all lociwithin a populationOne species, but membersare more likely to matewithin their herd than theotherPolymorphismA polymorphism ismore th
Rutgers - BIO - 113
Biological Species ConceptBiological Species ConceptReproductive IsolationNot necessarily easy to applyMorphological Species ConceptPhenotypic differencesPaleontological Species ConceptFossil speciesMorphologicalEcological Species Conceptsimila
Rutgers - BIO - 113
Chapter 24:The Originof SpeciesSpecies and SpeciationSpeciation isthe formation ofa new speciesfrom an older,immediatelyancestralspeciesIt is not enough to explain how adaptationsevolve in a population Evolutionary theory mustalso explain how
Rutgers - BIO - 113
Macroevolutionary RelatednessChapter 25:Phylogeny andSystematicsShown is a phylogenetic treeTaxonomy is the ordered division oforganisms into categories basedon similarities and differences. p. 495,Campbell & Reece (2005)Phylogenies areevolution
Rutgers - BIO - 113
Origin of Life (overview)An overview of the logic of the origin of lifeWhere did the earth of Earth/what is the historyof lifes origins?How is it possible that life could form?Why doesnt life arise de novo today?FossilizationHow do fossils form?Wh
Rutgers - BIO - 113
Common Bacterial ShapesCutting Board (Eubacteria)Morphological DiversityWhat are Prokaryotes?Chapter 27:ProkaryotesSee text for a betterlook at these, but noneed to memorizethese or associatedinformationSpirochete1Cyanobacteria (blue-green al