23 Pages

Lecture08_26Apr11

Course: BIS 101, Spring 2012
School: UC Davis
Rating:
 
 
 
 
 

Word Count: 267

Document Preview

26, BIS101 April 2011 Bacterial Genetics II Strain A B C D Does it form a conjugation tube? yes yes yes no glucose y es y es y es no Growth in minimal media containing: lactose glucose/met glucose/met/str lactose/met/str yes yes no no yes yes no no yes yes no no no no yes yes Growth in media containing: Mating AXD BXD CXD glucose/str yes no no From Transduction Handout glucose/met/srp /str yes yes yes...

Register Now

Unformatted Document Excerpt

Coursehero >> California >> UC Davis >> BIS 101

Course Hero has millions of student submitted documents similar to the one
below including study guides, practice problems, reference materials, practice exams, textbook help and tutor support.

Course Hero has millions of student submitted documents similar to the one below including study guides, practice problems, reference materials, practice exams, textbook help and tutor support.
26, BIS101 April 2011 Bacterial Genetics II Strain A B C D Does it form a conjugation tube? yes yes yes no glucose y es y es y es no Growth in minimal media containing: lactose glucose/met glucose/met/str lactose/met/str yes yes no no yes yes no no yes yes no no no no yes yes Growth in media containing: Mating AXD BXD CXD glucose/str yes no no From Transduction Handout glucose/met/srp /str yes yes yes lactose/str no no no lactose/met/str no no yes Are these cells Donors? yes yes no Transformation Bacteriaphage Bacteriaphage Bacteriaphage QuickTime and a decompressor are needed to see this picture. Bacteriaphage Bacteria phage T4 1.7 X105 bp genome encodes about 300 gene products (E. coli = 4.6 X106 bp) Generalized Transduction Co-transduction DNA Qualities necessary for the structural features of the genetic material: 1. Must informational have content (to encode for proteins) 2. Must allow for faithful replication during each cell division 3. Must have physical and chemical stability 3. Must be able to change (e.g. by mutation- more in Chapter 14). DNA is the Genetic Material Griffith, 1928 DNA is the Genetic Material Avery, MacLeod and McCarty, 1944 DNA is the Genetic Material Hershey-Chase, 1952 Rosalind Franklin Franklins X-ray diffraction pattern of DNA James Watson and Francis Crick 1962 Nobel Prize in Physiology or Medicine The Structure of DNA Qualities necessary for the structural features of the genetic material: 1. Must have informational content (to encode for proteins) 2. Must allow for faithful replication during each cell division 3. Must have physical and chemical stability 3. Must be able to change (e.g. by mutation- more in Chapter 14).
Find millions of documents on Course Hero - Study Guides, Lecture Notes, Reference Materials, Practice Exams and more. Course Hero has millions of course specific materials providing students with the best way to expand their education.

Below is a small sample set of documents:

UC Davis - BIS - 101
BIS101Apr 28, 2011DNADNAJames Watson and Francis Crick1962 Nobel Prize inPhysiology or MedicineWatson and CrickQualities necessary for the structural features of the geneticmaterial:1. Must have informational content (to encode for proteins)2.
UC Davis - BIS - 101
BIS 1015 May 11RNA TranscriptionRegulated Gene Expression in Eukaryotesgene 1gene 1KidneyBrainEarA zebrafish embryo (15 hour post-fertilization)Genome size and Gene NumberOrganismGenome Size(Bases)EstimatedGenesGenes/1 million bpHuman (H
UC Davis - BIS - 101
BIS 10110 May 11RNA TranscriptionMidterm 2 review:Wednesday, May 116:10- 8:00 pmGietd 1003Draper Extra OH:*Wednesday, May 112:00- 3:00 pmLife Science 3002*No Office Hour Friday, May 13The Genetic CodeMissense Mutations in Conserved DomainstR
UC Davis - BIS - 101
BIS 10117 May 11Regulation ofGene ExpressionPart 1: ProkaryotesRegulated Gene Expressiongene 1gene 1KindeyBrainEarA zebrafish embryo (15 hour post-fertilization)Allosteric effectors bind to regulatory proteinsFigure 10-3The Lac operonFigure
UC Davis - BIS - 101
BIS 10119 May 11Regulation ofGene ExpressionPart 2: Eukaryotestrp mRNA leader sequence contains an attenuatorregion and two Trp codonsTrp TrpHandoutMetMechanism of Attenuation: trp OperonTrpTrpHandoutLeader Peptides of Amino Acid biosynthesi
UC Davis - BIS - 101
BIS 10124 May 09Dr. Drapers Office Hour this week:Wednesday, May 253:00-4:00 pm Life Science Rm. 3002Regulation of gene expression by microRNAsRegulation of gene expression by miRNAsRecombinant DNA TechnologyRecombinant DNA Technology: CloningRes
UC Davis - BIS - 101
BIS 10126 May 11Drapers Office Hour NEXT week:Wednesday, June 12:00-3:00pmLife Science Rm. 3002Friday, June 33:00-4:00pmScience Lab 3061Final ReviewSession:Friday June 32:10- 4:00 pmKleiber 3Automated DNA SequencingWhole Genome Shotgunappr
UC Davis - BIS - 101
BIS 10131 May 11Drapers Office Hour NEXT week:Wednesday, June 12:00-3:00pmLife Science Rm. 3002Final ReviewSession:Friday June 32:10- 4:00 pmKleiber 3Mapping with Molecular MarkersFigure 12-10Mapping with Molecular MarkersFigure 12-12Mappin
UC Davis - BIS - 101
BIS 1013 May 11Genetic Fine StructureRNA TranscriptionGenetic Fine Structure AnalysisSeymour BenzerQuickTime and adecompressorare needed to see this picture.What is the elemental unit of heredity?What is the fundamental nature of mutation?What
UC Davis - ECN - 1
University of California, DavisDepartment of EconomicsECONOMICS 1AWinter 2010Hilary HoynesFirst Midterm ExamTotal points=100 points, ANSWER ALL QUESTIONS(45 points for Multiple Choice and 55 points for short answer)Last Name:First Name:Your Stud
UC Davis - ECN - 1
Department of EconomicsUniversity of California, DavisECONOMICS 1ASpring 2010L. Jay HelmsFirst Midterm Exam Version BFirst Name:Last Name:Your Student ID Number:Please check your registered section number:[]B01Mr. Jeremy MoultonM 6:10-7Wellm
UC Davis - ECN - 1
University of California, DavisDepartment of EconomicsECONOMICS 1AWinter 2011Hilary HoynesFirst Midterm ExamTotal points=100 points, ANSWER ALL QUESTIONS(45 points for Multiple Choice and 55 points for short answer)Last Name:First Name:Your Stud
UC Davis - NPB 101 - 101
NPB 101 Sa mple FinalMultiple ChoiceIdentify the letter of the choice that best co mpletes the s tatement or ans wers the question._1. Select the incorrect statement regarding the plasma membrane.a. selectively controls movement o f molecules b etwee
UC Davis - NPB - 101
Midterm 3 - NPB 101Guidelines: (1) Write your name and provide your student ID# on the front of your scantron. (2) Sign your scantron. (3) Indicate on the front of your scantron that you are using Testform A.* Multiple Choice Identify the letter of the
UC Davis - NPB 101 - 101
March 5, 2009Sample midterm questions on the endocrine system.Correct ans wers are highlighted in bold.18. The effective plas ma concentration of a hormon e is normally regulated by app ropriate adjustmentsin the hormonesa. rate of synthesis.b. exte
UC Davis - NPB 101 - NPB 101
Test Form: A101Sp08GoldbergSectofFinalMultiple ChoiceIdentify the choice that best completes the statement or answers the question._1. For a Purkinje fiber action potential,Statement #1: during the upstroke, inward current flow is carried by both Na
UC Davis - NPB 101 - NPB 101
NPB 101 Final 2007Multiple ChoiceIdentify the letter of the choice that best completes the statement or answers the question._1. Which type of chemical bonds does pancreatic amylase target?_a. alpha-1,4 glycosidic linkagesc. alpha-1,6 glycosidic li
UC Davis - NPB 101 - NPB 101
1.The lipid bilayer of the cell membranea.b.*c.d.e.is due primarily to the presence of cholesterol.is due to the presence of hydrophilic and hydrophobic groups on themembranes triglycerides.is formed as a result of the arrangement of phosphate
UC Davis - NPB 101 - NPB 101
1. Consider a sample of normal human blood that contains approximately 60%plasma. This blood woulda.b.c.d.e.have a hematocrit of about 40.would contain about 40% erythrocytes by volumewould contain about 40% platelets by volume.Would contain abo
UC Davis - NPB 101 - NPB 101
ID: ANPB101MT2Sum08Multiple Choice/True-FalseIdentify the choice that best completes the statement or answers the question._1. During the upstroke of the Purkinje fiber cardiac action potentialStatement #1: Inward current flow is carried by both Na
UC Davis - NPB 101 - NPB 101
UC Davis - NPB 101 - NPB 101
!"#$%"&'()*+&,-".#,)%./)012)3"(-&/4)56)78-9)5:6);<=9))59)>)?@-"&#-)A@,),+%&/&()(@4@$&)"#)2/.8@B,)@/&@9)!A@-)C&A@D"./@')(&%"8"&#8E)F.+'()E.+)&G?&8-H))@9 I#@C"'"-E)-.)+#(&/,-@#(),?&8A9)!" #$%&'(!)*(*'%(+,-./(012%(3,(/%3/%"(89 I#@C"'"-E)-.),?&@J9)(9
UC Davis - NPB 101 - NPB 101
NPB 101 Midterm 1_2006Answer SectionMULTIPLE CHOICE1.2.3.ANS: DThe response is in a homeostatic loop will always counter the change that occurs within the system. It isdesigned to prevent significant change from the set point value. Generally, the
UC Davis - NPB 101 - NPB 101
Test forms: |White = A | Purple = B | Salmon = C | Yellow = D |101 MT2 Sp06 - KeyMultiple ChoiceIdentify the letter of the choice that best completes the statement or answers the question.Note: True-False order may be reversed, i.e. a. False b. True1
UC Davis - NPB 101 - NPB 101
NPB 101 Midterm 1 (S 2007)Multiple ChoiceIdentify the letter of the choice that best completes the statement or answers the question._1. Pick the TRUE statement about homeostasis:a.b.c.d._A goal of homeostasis is to counter changes in the set po
UC Davis - NPB 101 - NPB 101
NPB 101 Fall 2001Midterm IOctober 22,20011. The membrane potential of a cell at rest.a. can best be described as a potassium diffusion potential.b. is established primarily by a complex series of oxidation-reduction reactions.c. is oriented such tha
UC Davis - NPB 101 - NPB 101
topic #2:interstitial fluids in CNS & PNSchoroid plexusblood-brain barrierrecall that the nervous systema) transduces environmental stimuli into electrical signalsb) sends electrical signals to various tissuesrationale for todays lecture:a) these
UC Davis - NPB 101 - NPB 101
summary: we have learned1) how K ions pass through K channels2) how leak permeability to K and Na explain why E(rest) is around -70,rather than -90 mV (EK) or +60 mV (ENa)3) terms: spike (a.k.a., action potential), depolarization, hyperpolarization,r
UC Davis - NPB 101 - NPB 101
past few days1) how single neurons produce spikes2) how spikes propagate from axon hillocks to axon terminalsstarting today chemical synapsesin particular how does the axon terminal membrane potential change? how does this affect neurotransmitter re
UC Davis - NPB 101 - NPB 101
now know some mechanisms for signal flow through individual neurons signal transmissionconvergence & integrationtransmitter releasespike generationspike propagationpost-synaptic potentialsshort, medium & long distance effectsdivergenceFig 4-19n
UC Davis - NPB 101 - NPB 101
conduction velocity summaryhow fast can spikes travel?(i.e., how fast is conduction velocity)?Jan 21, 20126-100 mph (6 in optic nerve, 100 in skeletal muscle proprioreceptors)why isnt this faster?because the charge that enters at point A can notdep
UC Davis - NPB 101 - NPB 101
RENALsystemnpb101-w2012-ishidawhat are these structures made of?what do they do?how do they operate?kidneysform urineureterspassive flow to reservoirbladderurethracollect urine & micturatestrategy for studying renal system1) functions e.g.,
UC Davis - NPB 101 - NPB 101
1) 4 major structures: kidneys, ureters, bladder, urethra.2) retain important chemicals & avoid toxic changes in fluid compositionby controlling composition of filtrate & thus our blood.3) fluid balance achieved largely by balancing fluid intake & urin
UC Davis - NPB 101 - NPB 101
from yesterdaypassive movementconsequently: by the time blood reaches theefferent arteriole, there is no more concentrationgradient & no more net filtration pressuretherefore, we have to do work tomove X between peritubular capillary& tubule: movem
UC Davis - NPB 101 - 101
NPB 101 - Fall 2001Midterm IINovember 19, 20011. During the normal cardiac cycle the period of time that elapses between the closure of theaortic and pulmonic semilunar valves and the opening of the atrio-ventricular valves isa.b.c.d.e.part of v
UC Davis - NPB 101 - 101
UC Davis - NPB 101 - 101
UC Davis - NPB 101 - 101
UC Davis - NPB 101 - 101
UC Davis - NPB 101 - 101
UC Davis - NPB 101 - 101
recall from lecture #1circulatory heart, blood vessels, bloodtransports nutrients, O2, CO2,wastes, electrolytes, & hormonesthroughout the body.dig esti v eobtai ns nutr ie nts, w ate r, an d ele ctro ly te s f rom the e xterna l env ironm ent an dt
UC Davis - NPB 101 - 101
skeletal muscle - why study this next?1) used for many body functions2) controlled by the nervous system3) we can now understand the electrophysiology of musclesa)b)c)d)voltage-gated channels in muscletransmitter-gated channels @ neuromuscular ju
UC Davis - NPB 101 - 101
Synthesisofnorepinephrineandepinephrinefromtyrosine(Basic)overviewofadrenergicsubtypesofrelevanceforthecardiovascularsystem:1adrenergicreceptors:SAnode(AVnode)VentricularmyocytesAffinityforNEandEverysimilarEffectofNEandEviaB1thesame(increaseheartra
UC Davis - NPB 101 - 101
Cardiovascular system:Regulation of blood pressureLectures 22-23Recommended reading :Chapter 10: pp. 376-386Topics to cover in these lecturesMean arterial pressure (again)Short versus long term control of MAPIntegrating effects on cardiac output a
UC Davis - NPB 101 - 101
Cardiovascular system:I. The Blood Vessels and Control of Blood FlowLectures 19-21Dr. David Furlow 274 Briggse-mail: jdfurlow@ucdavis.eduoffice hours: T,R 4:10-5 at 2064 Sciences Lab BldgRecommended (not required) reading in Sherwood 7th edition:Ma
UC Davis - NPB 101 - 101
Response to hemorrhage worksheet1) Immediate Effects on Mean Arterial Pressure1A1BBlood volume1F1EMAPVenousreturnCardiacoutput1CEDV1DStrokevolumeMagnitude: - 30 mm Hg2) Short term responses to hypotension2A (from 1F)2BMAP2CSympathet
UC Davis - NPB 101 - 101
Response to hemorrhage worksheet1) Immediate Effects on Mean Arterial Pressure1A1C1BEDVBlood volume1F1EMAPCardiacoutput1DMagnitude: - 30 mm Hg2) Short term responses to hypotension2A (from 1F)2BMAP2CSympathetic outputto blood vesselsB
UC Davis - NPB 101 - 101
Overviewoflastlecture(2/8/12):1.Meanarterialpressure=CardiacoutputXtotalperipheralresistance(bothimportant)MAPsensedandtightlycontrolled:needstobehighenoughtoefficientlydrivebloodintotissuesandbacktoheartbutnottoohighMAPtoohigh(hypertension)=>damageve
UC Davis - NPB 101 - 101
The Endocrine SystemPart I: Introduction to the Endocrine SystemLectures 28-29Recommended reading:Sherwood 7th edition Chapter 4 pp. 113-129Chapter 18 pp. 661-670Topics to be covered in these lectures:General overview of endocrine cells and glands
UC Davis - NPB 101 - 101
NPB 101 - SYSTEMIC PHYSIOLOGYtodayintroduce course personnelhow to contact usoffice hourscourse logisticstextbook, readingsexams, gradingsmartsite, lecture slides, podcastsfirst lecturegoalstrategyorgan systems, cell typesexplanation of cours
UC Davis - NPB 101 - 101
yesterdaynervous system13 days, 50 min/ea. essentially one 11-hr lectureprimary interests are.a) what the nervous system responds tob) how it regulates tissues and organ systems (skeletal muscle, cardiac muscle, digestivesystem.)therefore, learn .
UC Davis - NPB 101 - 101
summaryoverall functionsafferent & efferent signalsreceptor ending, dendrite, axon, terminal,polarity, rest, response, neurotransmittertransduce stimuli1process signalsproduce involuntaryresponses2generate & controlbehavior4 cellsresponding
UC Davis - NPB 101 - 101
last weekoverall functionsafferent & efferent signalsreceptor ending, dendrite, axon, terminal,polarity, rest, response, neurotransmittertransduce stimuli1process signalsproduce involuntaryresponses2generate & controlbehavior4extract informa
UC Davis - NPB 101 - 101
visual systemintensitywavelengthspatio-temporal changesluminancecontrastsizeedgecolorflickermotiondirectionorientationtexturedepthorient head & eyes to track moving objectsimage stabilization during self-motionpupillary light reflexreset
UC Davis - NPB 101 - 101
UC Davis - NPB 101 - 101
where do the K ions bind?!look at the side view of a K channel, showing 4 ions inside the pore !Morais etal 01 Nature 414:37This is not a leak channel, but the amino acids thatbind the K ions are the same in leak channels. !Amino acid sequences shown
UC Davis - NPB 101 - 101
1)one spike @ one point along an axon2)multiple spikes @ one point along an axon3)one spike propagating along an axon1) one spike @ one point1)2)3)4)5)6)7)8)9)resting potential (Erest)Nernst equation for K ions (EK)Nernst equation for Na io
UC Davis - NPB 101 - 101
UC Davis - NPB 101 - 101
UC Davis - NPB 101 - 101
UC Davis - NPB 101 - 101
The Endocrine SystemPart IV: Thyroid and Adrenal GlandsLecture 38Recommended reading:Sherwood 7th edition Chapter 691-710Topics to cover in these lecturesThe thyroid glandAnatomySynthesis of thyroid hormonesRegulation of thyroid hormone synthesis