11 Pages

NPB101_Bautista_Goldberg_Sp06_MT2

Course: NPB 101 NPB 101, Spring 2012
School: UC Davis
Rating:
 
 
 
 
 

Word Count: 2175

Document Preview

forms: Test |White = A | Purple = B | Salmon = C | Yellow = D | 101 MT2 Sp06 - Key Multiple Choice Identify the letter of the choice that best completes the statement or answers the question. Note: True-False order may be reversed, i.e. a. False b. True 1. Statement #1: Compared to the resting membrane potential, during the upstroke of the action potential there is an increase in the number of open Na and Ca...

Register Now

Unformatted Document Excerpt

Coursehero >> California >> UC Davis >> NPB 101 NPB 101

Course Hero has millions of student submitted documents similar to the one
below including study guides, practice problems, reference materials, practice exams, textbook help and tutor support.

Course Hero has millions of student submitted documents similar to the one below including study guides, practice problems, reference materials, practice exams, textbook help and tutor support.
forms: Test |White = A | Purple = B | Salmon = C | Yellow = D | 101 MT2 Sp06 - Key Multiple Choice Identify the letter of the choice that best completes the statement or answers the question. Note: True-False order may be reversed, i.e. a. False b. True 1. Statement #1: Compared to the resting membrane potential, during the upstroke of the action potential there is an increase in the number of open Na and Ca channels. Statement #2: During the upstroke of the action potential there are more open K channels than there are during the resting membrane potential. Statement #3: The plateau phase is terminated and final repolarization begins with inactivation of some of the open K channels. a. All three statements are true. b. All three statements are false. c. Only statement #1 is true. d. Only statements #1 and #2 are true. e. Only statements #1 and #3 are true. 2. You observe depolarization during a phase of an action potential. Statement #1: This depolarization could occur because there is either an absolute increase in inward current flow or a decrease in existing outward current flow. Statement #2: This depolarization could occur because there an absoltue decrease in inward current flow or an increase in outward current flow. a. Only statement #1 is true. b. Only statement #2 is true. c. Both statements are false. 3. Statement #1: Sympathetic stimulation to the pacemaker cells of the SA node increases the slope of the pacemaker potential (diastolic depolarization) and decreases the threshold for activation of phase 0, the upstroke. Statement #2: Sympathetic stimulation to the pacemaker cells of the SA node increases the slope of the pacemaker potential and decreases the maximum diastolic potential (MDP). Statement #3: Parasympathetic stimulation to the pacemaker cells of the SA node decreases the slope of the pacemaker potential and increases the maximum diastolic potential (MDP) by activating an acetylcholine K channel. a. All the statements are true. b. All the statements are false. c. Only statements #1 and #3 are true. d. Only statements #2 and #3 are true. e. Only statement #3 is true. 1 Name: ________________________ 4. Contractile energy for ejecting the stroke volume can be increased by Statement #1: an increase in venous return. Statment #2: an increase in sarcoplasmic Ca produced by an increase in muscle fiber length. Statement #3: an increase in contractility. a. All three statements are true. b. Only statements #1 and #3 are true. c. Only statement #1 is true. d. Only statement #3 is true. e. Only statement #2 is true. 5. Condition: The AV node is effectively refractory. a. You would expect activation of the His Bundle and Bundle Branch System and the ventricular muscle. b. You would expect activation of the ventricular muscle but not the His Bundle and Bundle Branch system. c. You would expect activation of the His Bundle and Bundle Branch system but not the ventricular muscle. d. You would not expect activation of either the His Bundle and Bundle Branch system or the ventricular muscle. 6. Statement #1: Increases in muscle fiber length increase sarcoplasmic calcium in both cardiac and skeletal muscle. Statement #2: Increases in sacroplasmic calcium increase the number of actin-myosin crossbridges mobilized in cardiac muscle. Statement #3: Increases in sarcoplasmic calcium do not change in the number of actin-myosin cross-bridges in skeletal muscle. a. All three statements are true. b. All three statements are false. c. Only the first statement is true. d. Only statements #1 and #2 are true. e. Only statements #2 and #3 are true. 2 Name: ________________________ 7. Which of the ECG tracings below show only a decrease in heart rate from control? Control A B a. b. c. d. Trace A Trace B Both traces A & B Neither trace A nor B. 8. Which of the following will decrease capillary filtration? Statement #1: A decrease in capillary oncotic (protein osmotic) pressure. Statement #2: An increase in interstitial fluid pressure. Statement #3: a decrease in the number of open capillaries (there is no change in arterial blood pressure). a. All three statements will true. b. All three statements are false. c. Only statement #1 is true. d. Only statements #2 and #3 are true. e. Only statement #3 is true. 3 Name: ________________________ 9. Condition: There is an increase in both sympathetic activity to the arterioles in skeletal muscle and an increase in skeletal muscle metabolism. Statement: You will observe a decrease in arteriolar resistance and an increase in blood flow to the skeletal muscle. a. The statement is true. b. The statement is false. c. You cannot determine if there is an increase in blood flow because you need to know the level of sympathetic activity and the level of metabolism. 10. Which point on the graph below represents an increase in contractility with no change in stroke volume from control? #1 Control 6 Stroke Volume #2 2 5 10 4 3 C 1 9 8 7 C= Control End Diastolic Volume a. b. c. d. e. 2 3 4 5 9 4 Cardiac Function Curves.101.06 Name: ________________________ 11. Use the concepts relating electrical to mechanical activity of the heart and blood flow through the heart. Question: Which of the following statements listing the sequence of events in the cardiac cycle is consistent with these concepts? (Note. some steps in the sequence may be omitted.) a. QRS complex, closure of the AV valves, onset of ventricular contraction, increase ventricular pressure, flow of blood into the aorta, opening of the aortic valve. b. QRS complex, onset of ventricular contraction, closure of the AV valves, increase ventricular pressure, flow of blood into the aorta, opening of the aortic valve. c. QRS complex, closure of the AV valves, onset of isovolumetric contraction, onset of ventricular contraction, opening of the aortic valve, flow of blood into the aorta. d. more than one of the sequences is correct. e. none of the sequences is correct. 12. Condition: There is a fall in blood pressure. The reflex compensation to return blood pressure to normal Statement #1: includes an increase in arterial volume. Statement #2: includes a decrease in activation and decrease in afferent firing of the carotid sinus baroreceptors producing a decrease in activation of the parasympathetic nervous system and a disinhibtion (reduction in inhibition) of the active sympathetic system. Statement #3: may include an increase in heart rate, a decrease in arteriolar resistance, a decrease in venous capacitance and an increase in venous return, and an increase in contractility. a. All three statements are true. b. All three statements are false. c. Only statement #1 is true. d. Only statements #1 and #2 are true. e. Only statements #1 and #3 are true. 13. Statement: Both at FRC and at the end of inspiration the transmural pressure for the lung is equal in magntiude and opposite in direct to the intrinisc forces of the lung, and the transmural pressure for the chest wall is equal in magnitude and opposite in direction to the intrinsic forces for the wall. a. chest Statement is true. b. Statement is false. 14. Condition: At FRC the intrinsic elastic recoil/surface tension forces for the lung are 2 inward. At FRC the intrinsic elastic forces for the chest wall are 2 outward. Question: What is the pleural pressure at FRC for this respiratory system? a. +4 b. -4 c. +2 d. -2 e. None of the above. 5 Name: ________________________ 15. Initial conditions: The airways in the lung are open to outside air. The ER/ST forces for the lung are 5 inward. The pleural pressure is +5. Question: As a consequence of these initial conditions, you will observe a. Inspiration b. Expiration c. No change in lung volume 16. Statement #1: Inspiration will continue until the ER/ST forces of the lung equal the increased transmural pressure for the lung. Statement #2: Passive (unforced) expiration will continue until the ER/ST forces of the lung are equal in magntiude and opposite in direction to the intrinsic forces of the chest wall. a. Both statements are true. b. Both statements are false. c. Only the first statement is true. d. Only the 2nd statement is true. 17. Statement: In the absence of an FRC, alveolar and pulmonary venous Po2 will increase with inspiration and decrease with expiration. a. Statement is true. b. Statement is false. 18. Statement: Surfactant reduces the intrinsic elastic forces for the lung decreasing the change in transmural pressure needed for inspiration. a. The statement is true. b. The statement is false. 19. Condition: There is a decrease in lung ventilation. There is no change in metabolism. As a consequence you would predict Statement set #1: a decrease in alveolar Po2 and an increase in alveolar Pco2. Pulmonary venous Po2 and Pco2 will equilibrate with alveolar Po2 and Pco2. Statement set #2: a decrease in alveolar Po2 with no change in alveolar Pco2. Pulmonary venous Po2 and Pco2 will equilibrate wth the alveolar Po2 and Pco2. Statement set #3: a decreae in alveolar Po2 and an increase in alveoarl Pco2. Pulmonary venous Po2 and Pco2 will not equilibrate with alveolar Po2 and Pco2. a. Only statement set #1 is true. b. Only statement set #2 is true. c. Only statement set #3 is true. d. None of the statement sets is true. 6 Name: ________________________ 20. Condition: Systemic arterial Po2 is 100 Torr and systemic arterial Pco2 is 40 Torr, the normal values for both. Statement: The content of oxygen/100 ml of blood is greater than that for carbon dioxide. a. The statement is true. b. The statement is false. 21. Condition: You have a unknown liquid. You do not know the properties of this liquid. You measure the partial pressures of oxygen and carbon dioxide in this liquid. You observe that the partial pressure of carbon dioxide is 2 times that of oxygen. Statement: You can conclude that content of oxygen in this liquid is greater than that of carbon dioxide. a. The statement is true. b. The statement is false. 22. Recall the oxyhemoglobin dissociation curve. Observation: There is a smaller decrease in the partial pressure of oxygen with decreases in oxygen content from 14 ml oxygen/100 ml of blood to 12 ml of oxygen/100 ml of blood than there is from 20 ml oxygen/100 ml of blood to 18 ml of oxygen/100 ml of blood. Statement: The smaller decrease in partial pressure is a consequence of less oxygen leaving the blood. a. The statement is true. b. The statement is false. 7 Name: ________________________ 23. Use this graph for this question: Excretion Rate mg/min A B C Plasma Concentration mg/ml Statement #1: Graph A indicates filtration, Graph B indicates secretion and Graph C indicates reabsorption. Statement #2: Graph A indicates reabsorption, Graph B indicates filtration and Graphs C indicates secretion. Statement #3: Graph A indicates secretion. Graph B indicates filtration and Graph C indicates reabsorption. a. Statement #1 is correct. b. Statement #2 is correct. c. Statement #3 is correct. d. None of the statments is correct. 24. Statement: For a substance that is reabsorbed, excretion into the urine will not occur until the filtered load (plasma concentration x GFR) exceeds the transport capacity of the nephrons. a. The statement is true. b. The statement is false. 25. Statement: Increasing efferent arteriolar resistance without changing afferent arteriolar resistance will increase GFR and decrease vasa recta blood flow. a. Statement is true. b. Statement is false. 8 Name: ________________________ 26. Blocking the Na/K ATP pump on the basolateral membrane of proximal tubules epithelial cells will Statement #1: decrease the reabsorption of Na from the proximal tubular fluid. Statement #2: decrease the reabsorption of glucose, amino acids and other solutes cotransported with Na. Statement #3: decrease the secretion of H+ into the proximal tubule. a. Only statement #1 is true. b. Only statement #2 is true. c. Only statements #1 and #2 are true. d. All three statements are true. e. All three statements are false. 27. Statement #1: Most of the glomerular filtrate is reabsorbed in the proximal tubule. Statement #2: In a healthy individual, all filtered glucose and amino acids are reabsorbed in the proximal tubule. Statement #3: While Na uses membrane transporters for reabsorption, Na does not have a transport maximum because it is also reabsorbed by the solvent drag. a. All three statements are true. b. All three statements are false. c. Only statements #1 and #2 are true. d. Only statement #1 is true. e. Only statement #2 is true. 28. Under conditions where there is a reduced circulating blood volume, Statement #1: there is an increase in GFR. Statement #2: there is stimulation of ADH secretion from the posterior pituitary through disinhibition (reduction of inhibition) from a decrease in afferent input from the volume receptors in the left atrium and pulmonary veins. Statement #3: there is an increase in aldosterone secretion from the adrenal cortex which increases Na transporters in the Loops of Henle, distal tubules and collecting ducts increasing water reabsorption. a. All three statements are true. b. All three statements are false. c. Only statements #2 and #3 are true. d. Only statement #3 is true. e. Only statements #1 and #3 are true. 29. Statement: Both ADH and aldosterone are secreted with increases in osmolality of the blood. a. Statement is true. b. Statement is false. 9 Name: ________________________ 30. Statement #1: The countercurrent flow through the vasa recta reduces, compared to a flow-through capillary system, the rate of washout of the medullary osmotic gradient. Statement #2: Under conditions where water is conserved, i.e. reduced water excretion, the rate of blood flow through the vasa recta is increased. a. Both statements are true. b. Both statements are false. c. Only statement #1 is true. d. Only statement #2 is true. 10 ID: A 101 MT2 Sp06 - Key Answer Section MULTIPLE CHOICE 1. 2. 3. 4. 5. 6. 7. 8. 9. 10. 11. 12. 13. 14. 15. 16. 17. 18. 19. 20. 21. 22. 23. 24. 25. 26. 27. 28. 29. 30. D A E A D A D D A C E D A D B A A A A B B B C A A D A A B C 1
Find millions of documents on Course Hero - Study Guides, Lecture Notes, Reference Materials, Practice Exams and more. Course Hero has millions of course specific materials providing students with the best way to expand their education.

Below is a small sample set of documents:

UC Davis - NPB 101 - NPB 101
NPB 101 Midterm 1 (S 2007)Multiple ChoiceIdentify the letter of the choice that best completes the statement or answers the question._1. Pick the TRUE statement about homeostasis:a.b.c.d._A goal of homeostasis is to counter changes in the set po
UC Davis - NPB 101 - NPB 101
NPB 101 Fall 2001Midterm IOctober 22,20011. The membrane potential of a cell at rest.a. can best be described as a potassium diffusion potential.b. is established primarily by a complex series of oxidation-reduction reactions.c. is oriented such tha
UC Davis - NPB 101 - NPB 101
topic #2:interstitial fluids in CNS & PNSchoroid plexusblood-brain barrierrecall that the nervous systema) transduces environmental stimuli into electrical signalsb) sends electrical signals to various tissuesrationale for todays lecture:a) these
UC Davis - NPB 101 - NPB 101
summary: we have learned1) how K ions pass through K channels2) how leak permeability to K and Na explain why E(rest) is around -70,rather than -90 mV (EK) or +60 mV (ENa)3) terms: spike (a.k.a., action potential), depolarization, hyperpolarization,r
UC Davis - NPB 101 - NPB 101
past few days1) how single neurons produce spikes2) how spikes propagate from axon hillocks to axon terminalsstarting today chemical synapsesin particular how does the axon terminal membrane potential change? how does this affect neurotransmitter re
UC Davis - NPB 101 - NPB 101
now know some mechanisms for signal flow through individual neurons signal transmissionconvergence & integrationtransmitter releasespike generationspike propagationpost-synaptic potentialsshort, medium & long distance effectsdivergenceFig 4-19n
UC Davis - NPB 101 - NPB 101
conduction velocity summaryhow fast can spikes travel?(i.e., how fast is conduction velocity)?Jan 21, 20126-100 mph (6 in optic nerve, 100 in skeletal muscle proprioreceptors)why isnt this faster?because the charge that enters at point A can notdep
UC Davis - NPB 101 - NPB 101
RENALsystemnpb101-w2012-ishidawhat are these structures made of?what do they do?how do they operate?kidneysform urineureterspassive flow to reservoirbladderurethracollect urine & micturatestrategy for studying renal system1) functions e.g.,
UC Davis - NPB 101 - NPB 101
1) 4 major structures: kidneys, ureters, bladder, urethra.2) retain important chemicals & avoid toxic changes in fluid compositionby controlling composition of filtrate & thus our blood.3) fluid balance achieved largely by balancing fluid intake & urin
UC Davis - NPB 101 - NPB 101
from yesterdaypassive movementconsequently: by the time blood reaches theefferent arteriole, there is no more concentrationgradient & no more net filtration pressuretherefore, we have to do work tomove X between peritubular capillary& tubule: movem
UC Davis - NPB 101 - 101
NPB 101 - Fall 2001Midterm IINovember 19, 20011. During the normal cardiac cycle the period of time that elapses between the closure of theaortic and pulmonic semilunar valves and the opening of the atrio-ventricular valves isa.b.c.d.e.part of v
UC Davis - NPB 101 - 101
UC Davis - NPB 101 - 101
UC Davis - NPB 101 - 101
UC Davis - NPB 101 - 101
UC Davis - NPB 101 - 101
UC Davis - NPB 101 - 101
recall from lecture #1circulatory heart, blood vessels, bloodtransports nutrients, O2, CO2,wastes, electrolytes, & hormonesthroughout the body.dig esti v eobtai ns nutr ie nts, w ate r, an d ele ctro ly te s f rom the e xterna l env ironm ent an dt
UC Davis - NPB 101 - 101
skeletal muscle - why study this next?1) used for many body functions2) controlled by the nervous system3) we can now understand the electrophysiology of musclesa)b)c)d)voltage-gated channels in muscletransmitter-gated channels @ neuromuscular ju
UC Davis - NPB 101 - 101
Synthesisofnorepinephrineandepinephrinefromtyrosine(Basic)overviewofadrenergicsubtypesofrelevanceforthecardiovascularsystem:1adrenergicreceptors:SAnode(AVnode)VentricularmyocytesAffinityforNEandEverysimilarEffectofNEandEviaB1thesame(increaseheartra
UC Davis - NPB 101 - 101
Cardiovascular system:Regulation of blood pressureLectures 22-23Recommended reading :Chapter 10: pp. 376-386Topics to cover in these lecturesMean arterial pressure (again)Short versus long term control of MAPIntegrating effects on cardiac output a
UC Davis - NPB 101 - 101
Cardiovascular system:I. The Blood Vessels and Control of Blood FlowLectures 19-21Dr. David Furlow 274 Briggse-mail: jdfurlow@ucdavis.eduoffice hours: T,R 4:10-5 at 2064 Sciences Lab BldgRecommended (not required) reading in Sherwood 7th edition:Ma
UC Davis - NPB 101 - 101
Response to hemorrhage worksheet1) Immediate Effects on Mean Arterial Pressure1A1BBlood volume1F1EMAPVenousreturnCardiacoutput1CEDV1DStrokevolumeMagnitude: - 30 mm Hg2) Short term responses to hypotension2A (from 1F)2BMAP2CSympathet
UC Davis - NPB 101 - 101
Response to hemorrhage worksheet1) Immediate Effects on Mean Arterial Pressure1A1C1BEDVBlood volume1F1EMAPCardiacoutput1DMagnitude: - 30 mm Hg2) Short term responses to hypotension2A (from 1F)2BMAP2CSympathetic outputto blood vesselsB
UC Davis - NPB 101 - 101
Overviewoflastlecture(2/8/12):1.Meanarterialpressure=CardiacoutputXtotalperipheralresistance(bothimportant)MAPsensedandtightlycontrolled:needstobehighenoughtoefficientlydrivebloodintotissuesandbacktoheartbutnottoohighMAPtoohigh(hypertension)=>damageve
UC Davis - NPB 101 - 101
The Endocrine SystemPart I: Introduction to the Endocrine SystemLectures 28-29Recommended reading:Sherwood 7th edition Chapter 4 pp. 113-129Chapter 18 pp. 661-670Topics to be covered in these lectures:General overview of endocrine cells and glands
UC Davis - NPB 101 - 101
NPB 101 - SYSTEMIC PHYSIOLOGYtodayintroduce course personnelhow to contact usoffice hourscourse logisticstextbook, readingsexams, gradingsmartsite, lecture slides, podcastsfirst lecturegoalstrategyorgan systems, cell typesexplanation of cours
UC Davis - NPB 101 - 101
yesterdaynervous system13 days, 50 min/ea. essentially one 11-hr lectureprimary interests are.a) what the nervous system responds tob) how it regulates tissues and organ systems (skeletal muscle, cardiac muscle, digestivesystem.)therefore, learn .
UC Davis - NPB 101 - 101
summaryoverall functionsafferent & efferent signalsreceptor ending, dendrite, axon, terminal,polarity, rest, response, neurotransmittertransduce stimuli1process signalsproduce involuntaryresponses2generate & controlbehavior4 cellsresponding
UC Davis - NPB 101 - 101
last weekoverall functionsafferent & efferent signalsreceptor ending, dendrite, axon, terminal,polarity, rest, response, neurotransmittertransduce stimuli1process signalsproduce involuntaryresponses2generate & controlbehavior4extract informa
UC Davis - NPB 101 - 101
visual systemintensitywavelengthspatio-temporal changesluminancecontrastsizeedgecolorflickermotiondirectionorientationtexturedepthorient head & eyes to track moving objectsimage stabilization during self-motionpupillary light reflexreset
UC Davis - NPB 101 - 101
UC Davis - NPB 101 - 101
where do the K ions bind?!look at the side view of a K channel, showing 4 ions inside the pore !Morais etal 01 Nature 414:37This is not a leak channel, but the amino acids thatbind the K ions are the same in leak channels. !Amino acid sequences shown
UC Davis - NPB 101 - 101
1)one spike @ one point along an axon2)multiple spikes @ one point along an axon3)one spike propagating along an axon1) one spike @ one point1)2)3)4)5)6)7)8)9)resting potential (Erest)Nernst equation for K ions (EK)Nernst equation for Na io
UC Davis - NPB 101 - 101
UC Davis - NPB 101 - 101
UC Davis - NPB 101 - 101
UC Davis - NPB 101 - 101
The Endocrine SystemPart IV: Thyroid and Adrenal GlandsLecture 38Recommended reading:Sherwood 7th edition Chapter 691-710Topics to cover in these lecturesThe thyroid glandAnatomySynthesis of thyroid hormonesRegulation of thyroid hormone synthesis
UC Davis - NPB 101 - 101
The Gastrointestinal SystemLectures 30 - 33Recommended readingSherwood 7th edition Chapter 16 pp. 589-637Topics to be covered in these lecturesOverview of the Gastrointestinal (Digestive) SystemA. Primary jobs of the GI systemB. Other functionsOve
UC Davis - NPB 101 - 101
the somatic motor nervous system controls our skeletal muscles1) what does this system consist of?2) what does it enable us to do?3) how does it work?1) organization parallel to ANS:afferent: cranial nerves & spinal nerves - dorsal roots, dorsal horn
UC Davis - NPB 101 - 101
1) Na-K ATPase is needed to form Na & K concentration gradients.2) Leak channels then create resting potential by allowing ions to flow.leakchannelsresting potentialonly K+EK (the K equilibrium potential) described by theNernst eq for K, regardless
UC Davis - NPB 101 - 101
The Endocrine SystemPart III: Hypothalamus and PituitaryLectures 36-37Recommended reading:Sherwood 7th edition Chapter 18 pp. 670-685Topics to be covered in these lecturesAnatomy of the pituitary glandPosterior pituitary gland/relationship to the h
UC Davis - NPB 101 - 101
The Endocrine SystemPart II: Endocrine Control of MetabolismLectures 34-35Recommended reading:Sherwood 7th edition Chapter 19 pp. 710726REQUIRED READING:Sherwood 7th edition Chapter 19 pp. 726- 737(Endocrine control of calcium homeostasis: Focus on
UC Davis - NPB 101 - NPB 101
past few lectures, we learned:1) we produce a liquid waste called urine2) we regulate the composition of the blood to retain and maintainwhats optimal3) we also adjust urine volume to balance fluid loss & intakehow can we adjust urine volumetoday -
UC Davis - NPB101 - NPB101
this lecture illustrates:1) the basic principles of this course: how organ systems work together tomaintain optimal conditions in our bodies for survival, & how thesework in response to major challenges2) the scope of the problem faced by the renal sy
UC Davis - NPB101 - NPB101
Reproductive System II:Female reproductive physiologyLectures 41-42Sherwood 7th edition Chapter 20 pp. 764-782Topics to be covered in these lecturesOogenesisThe ovarian cycleHormonal control of the ovarian cycleOverviewEarly follicular phaseLate
UC Davis - NPB101 - NPB101
Reproduc)ve System I: Overview of Reproduc)ve System Anatomy and Male reproduc)ve physiology Lectures 3940 Recommended reading: Sherwood 7th edi)on Chapter 20 pp. 741745, 749761 Topics to be covered in thes
UC Davis - NPB101 - NPB101
The Respiratory System Lecture 27 Recommended reading:Sherwood 7th edition Chapter 13 pp. 461-498Topics to cover in these lectures Hypoventilation versus HyperventilationRespiratory control centersMedullary control centersPons cont
UC Davis - NPB101 - NPB101
The number of molecules expired per breath by an adult human being isabout 1022. The entire atmosphere of earth contains about 1044 molecules.Thus, a single molecule is to a breath as that breath is to the earth satmosphere. Stated in more picturesque
UC Davis - NPB101 - NPB101
Hypoven(la(on: pCO2 higher, results in higher H+ =lower pH (acidosis) Hyperven(la(on: pCO2 lower, results in lower H+ =higher pH (alkalosis) Fig. 1331, p. 487 Chemical factors that play role in determining magnitude
NYU - ECON - V31.0010
Problem Set 2Due: February 24-25Intermediate Microeconomics, Spring 2011Prof.GemiciAnswer the questions below in as much detail as possible. Make sure youshow all calculations. You will not be given any credit for just writingdown the answer without
NYU - ECON - V31.0010
Problem Set 3Due: March 31-April 1Intermediate Microeconomics, Spring 2011Prof.GemiciAnswer the questions below in as much detail as possible. Make sure youshow all calculations. You will not be given any credit for just writingdown the answer witho
NYU - ECON - V31.0010
V31.0010 - Intermediate MicroeconomicsSpring 2011Instructor: Ahu Gemici, 19 W.4th St., Room 815Email: ahu.gemici@nyu.eduOffice Hours: Wednesday 12:30pm-2:30pmCOURSE DESCRIPTIONThe purpose of this course is to introduce the students to microeconomic
NYU - ECON - V31.0010
MIDTERM IPRACTICE QUESTIONSIntermediate Microeconomics, Spring 20101.The assumption that preferences are transitive requires the consumera)to rank any two baskets.b)to say that basket C is preferred to basket A if basket B is preferred tobasket A
NYU - ECON - UA.31
Industrial OrganizationFall 2011, Karl StorchmannExam #1Instructions: Please read all the questions carefully. You have 75 minutes to completethe exam. Answer all questions. The value of each question is indicated in parenthesis.Answer each question
NYU - ECON - UA.31
Industrial OrganizationPS #1, Suggested Answers(1) Assume a firms marginal production of capital is equal to 20.Its marginal product oflabor is equal to 10 and the user cost of capital is 5. The firm is producing at its long-runcost-minimizing level.
NYU - ECON - UA.31
Industrial OrganizationPS #2Suggested Answers(1) The beer industry is competitive and a Staten Island Micro Brewery brews 10,000bottles per year. Its average total cost is $0.50 per bottle. The market price for its beer is$2 per bottle.(a) What is t
NYU - ECON - UA.31
Industrial OrganizationPS #6 (Due Friday, Dec 16, 5pm, slip under my office door!DO NOT PUT INTO MY MAILBOX!)(1) Read the text Experts and Price Distortion.(a) What do the authors want to depict with the various ! figures?(b) What is the main reason
NYU - ECON - UA.31
Industrial OrganizationPS #3Suggested Answers(1) A demand function is given by Q=100-P.Calculate the price elasticity of demand at Q=20Answer: E=(dQ/dP) * (P/Q)= -(1) * (P/Q)at Q=20 P=80Thus E= -(1) * (80/20) = -4(2) A demand function is given by
NYU - ECON - UA.31
Industrial OrganizationProblem Set #4, AnswersDue on Wednesday, Nov 16, 2010, in class(1) A shop is located in the middle of Main Street, which is one mile long. Marginaltransportation cost is given by t=$80 per mile. The average production cost of th
NYU - ECON - UA.31
Industrial OrganizationProblem Set #5, AnswersGame Theory(1) Two competing firms are each planning to introduce a new product. Each will decidewhether to produce Product A, Product B or Product C. They will make their choices atthe same time. The res
NYU - ECON - UA.31
Basics of Regression Analysis Regression Analysis is aiming at quantifying a functional relationship between a dependent variable (y) and one ore more independent variables (x). For instance, assume the height