27 Pages

BUS3026W_APRIL+TEST_2007

Course: FINANCE 3044, Spring 2006
School: University of Cape Town
Rating:
 
 
 
 
 

Word Count: 3755

Document Preview

DONOTTURNOVERTHEPAGEUNTILINSTRUCTED UNIVERSITYOFCAPETOWN SCHOOLOFMANAGEMENTSTUDIES FINANCE2CLASSTEST BUS3026W APRIL2007 TotalMarks:120 Time:2hours INSTRUCTIONS: TODOSO ANSWERALLQUESTIONS ANSWEREACHSECTIONINADIFFERENTBOOK NO QUESTIONS WILL BE ANSWERED DURING THE EXAM. CLEARLY STATE ANY ASSUMPTIONS MADE INANSWERINGEACHQUESTION. Examiners:F.Toerien R.Kruger SECTIONA:MCQ Marking: [30MARKS]...

Register Now

Unformatted Document Excerpt

Coursehero >> Other International >> University of Cape Town >> FINANCE 3044

Course Hero has millions of student submitted documents similar to the one
below including study guides, practice problems, reference materials, practice exams, textbook help and tutor support.

Course Hero has millions of student submitted documents similar to the one below including study guides, practice problems, reference materials, practice exams, textbook help and tutor support.
DONOTTURNOVERTHEPAGEUNTILINSTRUCTED UNIVERSITYOFCAPETOWN SCHOOLOFMANAGEMENTSTUDIES FINANCE2CLASSTEST BUS3026W APRIL2007 TotalMarks:120 Time:2hours INSTRUCTIONS: TODOSO ANSWERALLQUESTIONS ANSWEREACHSECTIONINADIFFERENTBOOK NO QUESTIONS WILL BE ANSWERED DURING THE EXAM. CLEARLY STATE ANY ASSUMPTIONS MADE INANSWERINGEACHQUESTION. Examiners:F.Toerien R.Kruger SECTIONA:MCQ Marking: [30MARKS] 3marksforacorrectanswer markforanincorrectanswer 0marksfornoanswer 1) Whichofthefollowingstatementsrelatingtosecuritiestradingis/arecorrect? i) Anadvantageofalimitorderisthatitisnotaffectedbytransactionscosts. ii) Inshareissues,theunderwritersarecompensatedthoughunderwriterspreadsand underwriterfees(theexplicitcoststotheissuingcompany). iii) Inafirmcommitmentscenario,abusinessexistingshareholdersarethemain loserswhenanewshareissueinthebusinessisoverpriced. a) b) c) d) e) i. ii. iii iandii iiandiii 2) Thestandarddeviationofaportfoliois i) thesquarerootoftheweightedsumofcovariances,witheachweighttheproduct oftheproportionsofthepairofassetsinthecovarianceterm. ii) aweightedaverageoftherisksoftheconstituentsecurities,iftheyareperfectly negativelycorrelated. iii) always less than a simple weighted average of the risks of the constituent securities. iv) ameasureofthetotalriskoftheportfolio. a) b) c) d) e) iandiionly iiandiiionly i,iiandivonly iandivonly ii,iiiandivonly 3) Whichofthefollowingstatementsis/areincorrect? i) ThePICmanagespublicsectorpensionfunds. ii) Itisillegaltotradeinequitiesbasedonanyformofnonpublicinformation. iii) During a closed period, the management of a company may not speak to investmentanalysts. a) b) c) d) e) i. ii iii iiandiii All3statementsarecorrect 4) Aninvestmentwithapositiveriskpremiumwouldbeacceptablefor a) b) c) d) e) ariskaverseinvestorandarisklover. ariskaverseinvestorandariskneutralinvestor. ariskaverseinvestoronly. ariskaverseinvestor,riskneutralinvestorandrisklover. ariskneutralinvestorandarisklover. 5) Whichofthefollowingarenotclassifiedastightlyheldshares? a) b) c) d) e) Familyholdings. Strategicholdings Shareincentiveschemes. PICholdings. Parastatalholdings. 6) Theoptimalriskyportfoliois i) thesameforanyinvestor,regardlessofriskaversion. ii) theportfolioontheefficientportfolioopportunitysetthathasthehighestreward tovariabilityratio. iii) atangentpointtotheefficientportfolioopportunityset. iv) determinedbyacapitalallocationdecision. a) b) c) d) i,iiandiiionly i,iiiandivonly ii,iii,andivonly iiandiiionly e) i,ii,iiiandivonly 7) Whichofthefollowingstatementsis/arecorrect? i) InTopDownanalysis,theEconomicAnalysishelpsthemanagerofabalanced funddecideontheweightings ofthedifferentindustrysectors(financials, industrialsetc.)inhis/herequityportfolio. ii) Rand appreciation against the US$ is good for a South African retailer that importsTaiwanesemadecomputerequipmentpricedinUS$. iii) Itisnearlyimpossibletofindgoodequityinvestmentsindecliningindustries. a) b) c) d) e) i. ii. iii iandii iiandiii 8) WhichofthefollowingassumptionsaretruefortheCAPMmodel? i) ii) iii) iv) Therearemanyinvestors,eachwithasmallinitialendowment. Investorsmayborrowandlendatdifferentrates. Investorsonlytradeinpubliclytradedassets Investorspaytaxesbutincurnotransactioncosts a) b) c) d) e) iandiionly i,iiandiiionly ii,iiiandivonly iandiiionly alloftheabove 9) ThefollowinginformationappliestoAlphadex: The total dividend payment for 2007 (one year from now) is expected to be R725,000,andthetotaldividendfor2008willprobablybeR760,000. Thereafterdividendswillgrowat5%peryear. Therequiredrateofreturnonequityis12%. ThetotalmarketvalueofthedebtofAlphadexisR4,900,000. Whichofthefollowingnumbersisclosesttothevalueofthebusiness(allnumbersarein 000s)? a) b) c) d) e) 9,370 10,340 12,650 14,270 15,240 10) Whichofthefollowingstatementsarefalse?(Thisquestionwasscrapped) i) Stockswithabetaofzeroofferanexpectedrateofreturnofzero. ii) TheCAPMimpliesthatinvestorsrequireahigherreturntoholdhighlyvolatile securities. iii) Youcanconstructaportfoliowithbetaof0.75byinvesting75%ofthe investmentbudgetinTBillsandtheremainderinthemarketportfolio. iv) Theriskpremiumonanindividualsecurityisafunctionofitscovariancewiththe market. a) b) c) d) e) ionly iandiionly iiandiiionly iiandivonly alloftheabove 11) GiventhefollowingforBennyandCo(allnumbers,exceptshareprice,inmillions): Tax: Depreciationandamortisation: Interestpaid: Netearningsaftertax: Marketvalueofthecompanysdebt: Assets Liabilities Goodwill Debtors Numberofsharesinissue: Currentshareprice: R45 R70 R80 R120 R1,200 R1,580 R675 R75 R60 265 880cps Which ofthefollowingis closesttothe(i)Enterprise Value:EBITDA multiple (EV:EBITDA),and(ii)Price:tangiblenetassetvalue(P:TNAV)ofthecompany? a) b) c) d) e) (i) (i) (i) (i) (i) 9.8 10.2 10.6 11.2 12.2 (ii)3.0 (ii)2.8 (ii)3.0 (ii)2.8 (ii)3.0 12) WithinthecontextoftheCAPM,assume: Expectedreturnonthemarket=15% ExpectedrateofreturnonXYZ=17% Riskfreerate=8% BetaofXYZ=1.25 Whichoneofthefollowingiscorrect? a) b) c) d) e) XYZisoverpriced XYZisfairlypriced XYZsalphais0.25% XYZsalphais0.25% Noneoftheabove 13) Whichofthefollowingstatementsis/arecorrect? i) Discountmodelsarepopularwithequityanalystsasanequityvaluationtool. ii) AlowP/Eratiosindicatesthatacompanysshareischeapanditshoulddefinitely bebought. iii) AdisadvantageofthePrice:SalesRatioisthatsalesdonotnecessarilyimplythat acompanyismakingprofits. a) b) c) d) e) i. ii. iii iandii iiandiii 14) Allofthefollowingarewaysinwhichmanagementcanincreasecurrentearnings, except: a) Capitalisingoperatingcosts. b) Increasing the discount rate used to value future defined benefit pension liabilities. c) Aggressiverecognitionofuncertainrevenues. d) Increasingprovisions. e) Depreciating a large new asset using straight line depreciation instead of an accelerateddepreciationmethod(e.g.,sumoftheyeardigits). 15) AccordingtoCAPM,theexpectedrateofreturnonaportfoliowithabetaof1.0and alphaof0is: a) b) c) d) e) BetweenrMandrf Theriskfreerate,rf B(rMrf) Theexpectedreturnonthemarket,rM Noneoftheabove 16) Whichofthefollowingstatementsis/arecorrect? i) Underinflationaryconditions,theearningsunderaLIFOsystemwillbehigher thanunderFIFO. ii) A company with regular (guaranteed) income, will have a higher quality of earningsthananequivalentcompanythatdoesnot. iii) TheReturnonEquitythataninvestorrequiresconsistsoftheinvestorsriskfree rateplusariskpremium. a) b) c) d) e) i,iiandiii. ionly. iandii. iiandiii. iionly. 17) Allofthefollowingstatementsarecorrectintechnicalanalysis,except: a) Bullsforcesharepriceshigher. b) Ahighliquidityinaspecificsharemakesiteasiertogetoutofapositioninthat share. c) Supportlevelsareformedwherebearsconsistentlycomeintothemarket. d) A trend is considered to be more reliable if it is supported by high trading volumes. e) Arisingtrendconsistsofaseriesofrisingresistancelevels. 18) Thefollowingtableshowsriskandreturnmeasuresfortwoportfolios: Portfolio R AllShareIndex ForecastReturn 11% 14% StandardDeviation 10% 12% Beta 0.5 1.0 WhenplottingportfolioRrelativetotheSML,itlies: a) b) c) d) OntheSML BelowtheSML AbovetheSML Insufficientdatagiven 19) Whichofthefollowingstatementsis/arecorrect? i) Technicalanalystsconsideradoublebottomsharepricepatterntobeavery bearishindicator. ii) Technical analysts generally ignore companyspecific information when analysingashareandpredictingitsfutureperformance. iii) Contrarianssellwhenpricemomentumisdownwards. a) b) c) d) e) ionly. iandii. iionly. iiandiii. iiionly. 20) ThefollowinginformationappliestoGeminiCorp.: Percentagedebt(@marketvalue): Interestrateondebt: PercentageEquity(@marketvalue): Requiredreturnonequity: Freecashflowgrowthrate(toinfinity): Taxrate: 30% 10% 70% 15% 5% 30% BasedontheinformationaboveandtheSinglePeriodFCFEModel,whatwillbethe denominatorintheformularequiredtocalculateGeminisFreeCashFlowtoEquity: a) b) c) d) e) 8%. 9%. 10%. 14%. 15%. SECTIONB:CALCULATIONQUESTIONS [30MARKS] Question21 Given the following information for Jupiter Traders, calculate the Present Value of GrowthOpportunities(PVGO)persharethatthemarketiscurrentlyassigningtothis firm.Showallcalculations. Currentshareprice: Expectedearningsnextyear: BetaforGemini: Marketreturn: Riskfreerate: 775cps 65cps 0.75 15% 8% [4marks] Question22 ABCLtdiscurrentlytradingatapriceofR28pershare.Youforecastthatthesharewill tradeatapriceofR30byyearendandthatadividendofR2willbepaidduringthat period. Youranalysisofthemarketindicatesthatthemarketriskpremiumis8%andtherisk freerateis5%.ABCsbetarelativetothemarketis1.3. Assuming you already manage a welldiversified portfolio of shares, would you add ABCtoyourportfolio?Whyorwhynot?Drawagraphandplottheforecastsharereturn relativetotheSMLtoillustrateyouranswer. [8marks] Question23 ThefinancialstatementsofCrookes&Swindleshowthefollowing: Reportednet(aftertax)earnings:R42million R 20 million of research expenses was capitalised to intangible assets at the beginningofthefinancialyear. Thecompanystaxrateis30% Intangibleassetsareamortisedover5years. Sharesinissue:25million What is the value per share if an appropriate historical P/E multiple is 8x and you considerthecapitalisationoftheresearchexpensestohavebeenunjustified. [4marks] Question24: Supposethattheriskpremiumonthemarketportfolioisestimatedat8%withastandard deviationof22%.Whatistheriskpremiumonaportfolioinvested25%inGMand75% inFord,iftheyhavebetasof1.10and1.25respectively. [3 marks] Question25 ThefinancialstatementsofHentuHoldingsshowthefollowing: st Interimfor1 half2006 Finalfor2006 Interimfor1sthalf2007 Earnings 188cps 422cps 238cps Dividend 49cps 215cps 144cps Thecurrentsharepriceforthecompanyis2400cps. a) Determinethecurrentdividendyieldforthecompany [2] b) DeterminetheP/Eratiotheshareiscurrentlytradingon Question26 [1] Giventhefollowinginformation: EquityFund BondFund ExpectedReturn 21% 15% StandardDeviation 28% 18% Thecorrelationbetweenthefundreturnsis0.2.Youplantoinvest20%intheriskfree assetand80%intheoptimalriskyportfoliocomprisingtheabovefunds.Theriskfree rateis5%. Whataretheinvestmentproportionsintheoptimalriskyportfolio?Whatproportionof yourtotalcapitalallocationshouldbeinvestedintheequityfundandthebondfund? [4marks] Question27 Thefollowinginformationrelatestoaspecificinstitutionalsharetransaction: Time 09:15 09:20 10:00 SharePrice (cps) Portfoliomanageraskstradingdesktobuy200,000PTT shares. Tradingdeskgivesinstructiontoabrokertobuytheshares. Thebrokeronlymanagestobuy120,000PTTshares. 180 184 190* *Averagepriceatwhichbought. Thebrokercommissionisatarateof1%oftransactionvalue. OneweekaftertheshareswereboughtthePTTsharepriceis227cps TwoweeksaftertheshareswereboughtthePTTsharepriceis218cps Forthishypotheticaltrade,calculatethefollowing(inRands): a) Commission b) PriceImpactCosts c) TraderTimingCost d) Opportunitycost(basedonatwoweekperiod) [1] [1] [1] [1] SECTIONC:WRITTENQUESTIONS [30MARKS] Question28 a) ExplaintheroleoftheFinancialServicesBoardintheSouthAfricanfinancialsector. (maximum150words) [3marks] b) In no more than 3 sentences each, define Fundamental Analysis, Quantitative AnalysisandTechnicalAnalysis. [3 marks] c) Explainhowtechnicalanalystswouldusethenperiodmovingaverageofashare pricetodeterminewhethertheshareshouldbeboughtorsold. (maximum 150 words) [3marks] Question29 a) Compareandcontrasttheconceptsofariskaverseinvestor,riskneutralinvestorand risk lover with specific reference to risk premiums and the appetite for risk. (maximum150words) [3marks] b) Explainhowthepricesonbothanunderpricedandoverpricedstockwouldadjust suchthatthesecuritieswouldagainbefairlypricedinthemarket.(maximum150 words) [4marks] c) The CAPM proposes that all investors in the market will derive the same risky portfolio,themarketportfolio.Explainwhythisissowithspecificreferencetothe assumptionsunderlyingtheCAPM.(maximum150words) [5marks] d) Thederivationoftheoptimalriskyportfolioisfrequentlycalledatechnicaldecision asitfailstotakeintoaccountthepersonalriskaversionofindividualinvestors.When does thepersonalriskaversionofaninvestor becomeimportant andhowdowe incorporateitintoourcapitalallocationdecision?(maximum150words) [4marks] e) Assumewehavealreadyderivedourefficientportfolioopportunitysetandoptimal riskyportfolio.Iftherewasnoriskfreerateinthemarkethowwouldwereconcile theindividualriskaversionofaninvestorwiththeoptimalriskyportfolio?Illustrate youranswerbymeansofaroughdiagram. [5 marks] END FormulaSheet w MIN (D) = WD = wD = 2 2 E Cov(rD , rE ) 2 E + D 2Cov(rD , rE ) 2 E(rD ) E(rE ) + 0.01A( E D E DE ) 2 0.01A(2 D + E 2D E DE ) 2 [E(rD ) rf ]E [E(rE ) rf ]Cov(rD , rE ) 2 2 [E(rD ) rf ]E + [E(rE ) rf ]D [E(rD ) rf + E(rE ) rf ]Cov(rD , rE ) BUS3026WCLASSTEST MEMO APRIL2007 SectionA 1. b 2. d 3. b 4. bordwereaccepted 5. d 6. a 7. b 8. d 9. e 10. thisquestionwasscrappedasiandiiiwouldhavebeenthecorrectanswerbutthat optionwasnotprovided 11. d 12. d(ealsoacceptedduetoerrorinnamingofstockinquestion) 13. c 14. d 15. d 16. d 17. c 18. d 19. c 20. c SectionB Question21 r=rf+(rmrf) =8%+0.75(15%8%) =13.25% [2marks1answer,1formula] PVGO=P0E1/r =775cps(65cps/13.25%) =775cps491cps =284cps [2marks1answer,1formula] Question22 Forecastreturnontheshareis: =[(3028)+2]/28=14.3% [2marks] TheexpectedreturnbasedontheCAPMis: =5+1.3(8)=15.4% [2marks] Theshareisthereforeoverpricedasithasanegativealpha(1.1%).Wewouldtherefore notaddittoourportfoliobutweshouldshortselltheshareandinvesttheproceedsinour portfoliototakeadvantageofitsmispricing. [2marks] E(r) SML 15.4% 14.3% rf 1.3 [2marks] Question23 Requiredearningsadjustment: Capitalisedcosts: Lessamortization(20/5) amortisation] Taxfactor R20mn R4mn [1markforcorrecttreatmentof R16.0mn x0.7 R11.2mn [1markforadjustmentvalue] Magnitudeofadjustment:R11.2mn Correctearnings:R42mnR11.2mn=R30.8mn [1mark] Value=(CorrectearningsxP/E)/#shares =(30.8x8)/25 =R9.86 [1mark] Note:thesequenceofcalculationsmaydiffer. Question24 p =wFordFord+wGMGM =(0.75x1.25)+(0.25x1.10)=1.2125 [1mark] Asthemarketriskpremium,E(rMrf)is8%,theportfolioriskpremiumwillbe: E(rp)rf Question25 =p[E(rM)rf] =1.2125x9=9.7% [2marks] Effectivelast12months=(Full20061H2006)+1H2007 Dividends:(21549)+144=310cps Earnings:(422188)+238=472cps [1Mark] Dividendyield=dividends/shareprice =310/2400=12.9% [1Mark] P/E=shareprice/earnings =2400/472=5.08 [1Mark] Question26 Iforgottheriskfreerateinsettingthisquestion.Anannouncementwasmadeineach venuethatstudentsshoulduseariskfreerateof5%inansweringthequestion.Anumber ofthemhadalreadyattemptedthequestionandmadeassumptions,however. Pleaseworkwiththeanswersofanystudentswhomadeanassumptionabouttherisk freerateorasuitableriskaversionrate(andusedthesecondequationintheformula sheet). wD = 2 [E(rD ) rf ]E [E(rE ) rf ]Cov(rD , rE ) 2 2 [E(rD ) rf ]E + [E(rE ) rf ]D [E(rD ) rf + E(rE ) rf ]Cov(rD , rE ) = [0.150.05]x0.28x0.28[0.210.05]x0.2x0.28x0.18 [0.150.05]x0.28x0.28+[0.210.05]x0.18x0.18[0.150.05+0.210.05]x0.2x0.28x 0.18 = 0.007840.0016128 0.00784+0.0051840.0026208 =0.0062272 0.0104032 =60% Thesplitistherefore60%indebtand40%equity. [3marks] Fromacapitalallocationperspectiveweareinvesting0.8x60%indebt(48%)and0.8x 40%inequity(32%). [1mark] Question27 a) Commission=120,000xR1.90x0.01 =R2,280 b) [1mark] PriceImpactCost=120,000x(R1.90R1.84) =R7,200 TraderTimingCost=120,000x(R1.84R1.80) =R4,800 [1mark] c) d) [1mark] Theoreticalpriceincreasepershare(2weeks): =R2.18R1.80(calculatedfromorderinitiation) =R0.38 Sharesnotbought:80,000 Totalopportunitycost=80,000xR0.38 =R30,400 SectionC Question28 a) [1mark] EstablishedbystatuteandfundedbytheSAfinancialindustry. Oversees the regulation of financial markets (including the JSE) and institutions, includinginsurers,fundmanagersandbrokingoperations Responsibilitiesexcludesbanks,whichfallundertheSouthAfricanReserveBank. b) FundamentalAnalysis: Usingeconomicandcompanyspecificinformationtotryto predictfutureearningsetc.andvaluingthefirm/equitybasedonthese. QuantitativeAnalysis: Usingstatisticalandmathematicaltechniquestoextrapolate historicalrelationships,values,sharepricesetc.togettoavaluefortheequity. TechnicalAnalysis: Interpretingtrendsandrelationshipsinsharepricesgraphically andpredictingthefuturesharepricesbasedonthese. c) Comparethecurrentsharepricewiththenperiodmovingaverage. ConsiderbuyingiftheshareistradingaboveitMAthismeansthemarketispositive ontheshareanditisonitswayup(themarketismorepositivethanitwasonaverage overtheMAperiod). Considersellingtheshareisitistradingbelowitsmovingaveragethemarketis negativeonthesharerelativetoitspreviousviewsandtheshareistradingdown. Question29 a) Riskaverse:Riskaverseinvestorswillrejectafairgameorworseonlyaccepting investmentswithpositiveriskpremia.He/shepenalizestheE(r)toaccountforthe riskinvolved. Note:Thequestionspecificallyrequestedthatyoudiscussthesethreeconceptswith referencetoriskpremiums.Thisisparticularlyimportantforariskaverseinvestor whodoesntsimplyrequireariskpremium,butrequiresapositiveriskpremium. Riskneutral:JudgeriskyprospectssolelybyE(r)asthelevelofriskisirrelevant. Theinvestmentscertaintyequivalentisthereforetheexpectedreturn. Risklover:Willingtoengageinfairgamesandgambles.AdjuststheE(r)upbythe thrilloftakingonmorerisk.Riskpremiumisirrelevant. [1markeach] b) Underpricedstockswouldbepurchasedbypeoplewhoveidentifiedthemispricing. Theincreaseddemandwouldincreasethepriceofthesharestherebyerodingthe potentialforprofitontheinvestment.Thiswouldslowlydecreasetheforecastreturn ontheshareanderodeitspositivealphauntilitplotsbackontheSML.[2marks] Overpricedstockswouldbesoldinthemarketbythosewhoveidentifiedthemas mispriced. The increased supply would decrease the price of the shares thereby increasingthepotentialforprofitontheinvestment.Thiswouldslowlyincreasethe forecastreturnontheshareanderodeitsnegativealphauntilitplotsbackonthe SML. [2marks] c) Thereareanumberofassumptionswhichcontributetotheexistenceofthemarket portfolio.Forexample,thefactthatborrowingandlendingratesarethesamegives risetoasituationwherewehaveequalamountsinborrowingandlendingwhichnet eachotheroffandthuswehaveinvestmentonlyinthemarketportfolio.Students were awarded marks as long as they were able to explain how the assumptions influencedtheexistenceofthemarketportfolio.Simplylistingalltheassumptions wasnotsufficienttogainthemaximumof5marksonoffer. Themostimportantfactoristhatinvestorshavehomogenousexpectationsandare meanvarianceoptimizers. Asaresulttheyanalysesecuritiesinthesameway Havethesameeconomicviewoftheworld Haveidenticalprobabilitydistributionsforreturns UsethesameinputlistfortheMarkowitzmodel. Theresultisthatallinvestorsgeneratethesameefficientfrontierandoptimalrisky portfolio,whichisthemarketportfolio.[ [5marks] d) Theriskaversionoftheinvestorisrelevantonlywhendeterminingtheallocation betweentheriskyportfolioandriskfreeasset.Thisisdonebydrawingatangent fromtheriskfreeratetotheoptimalriskyportfolioontheefficientriskyfrontier. Thislinerepresentsallpossibleoptimalcombinationsoftheriskyassetandriskfree assetandisknownastheCapitalAllocationLine.OncewehavetheCAL,weplot theinvestorsutilitycurvesonthegraphandfindthepointatwhichautilitycurveis atangenttotheCAL.Thisrepresentstheoptimalrisky/riskfreesplitfortheinvestor. Theoptimalriskyproportioniscalculatedasfollows: y* = E(rp ) rf 0.01A p 2 e) IntheabsenceofariskfreeassetthereisnoCAL.Instead,theonlydecisioninvolves reconcilingtheinvestorsriskaversionwiththerangeofefficientriskyportfolios. Thisisdonebyplottingtheinvestorsutilitycurvesonthegraphandfindingthe pointatwhichtheutilitycurveisatangenttotheefficientriskyopportunityset. Thisrepresentstheoptimalriskyportfoliogiventheinvestorslevelofrisk. Pleasedonotdrawtheinefficientportionofthefrontierandlabeltheentireline efficient.Also,thereshouldbenoCALonthegraphwhatsoever.TheCALimplies theexistenceofariskfreerateregardlessofwhetheritgoesthroughtheorigin.In thatcaseweresimplysayingtheriskfreereturnis0%.Intheabsenceofariskfree assetthereisnoCALatall. Also,itwasnotsufficientsimplytodrawthegraphanddiscusswhatutilitycurves differentlevelsofriskwouldyieldontheefficientfrontier.Youneededtoexplainthat therewouldnotbeaCALandwhy,andwhyonewouldthensimplymaptheutility curvesinstead. Investors Utility Curve E(r) Efficient frontier of risky assets P Optimal Risky Investment St. Dev
Find millions of documents on Course Hero - Study Guides, Lecture Notes, Reference Materials, Practice Exams and more. Course Hero has millions of course specific materials providing students with the best way to expand their education.

Below is a small sample set of documents:

University of Cape Town - FINANCE - 3044
BUS3026WCLASSTESTMEMOAPRIL2007SectionA1. b2. d3. b4. bordwereaccepted5. d6. a7. b8. d9. e10. thisquestionwasscrappedasiandiiiwouldhavebeenthecorrectanswerbutthatoptionwasnotprovided11. d12. d(ealsoacceptedduetoerrorinnamingofstockinquestio
University of Cape Town - FINANCE - 3044
UNIVERSITYOFCAPETOWNSCHOOLOFMANAGEMENTSTUDIESBUS3026WMIDYEAREXAMJUNE2009TotalMarks:180Time:3hoursINSTRUCTIONS: DONOTTURNOVERTHEPAGEUNTILINSTRUCTED TODOSO ANSWERALLQUESTIONS ANSWEREACHSECTIONINADIFFERENTBOOK NO QUESTIONS WILL BE ANSWERED DURING
University of Cape Town - FINANCE - 3044
FormulaSheetw MIN (D) =wD =22E Cov(rD , rE )2E + D 2Cov(rD , rE )2[E(rD ) rf ]E [E(rE ) rf ]Cov(rD , rE )22[E(rD ) rf ]E + [E(rE ) rf ]D [E(rD ) rf + E(rE ) rf ]Cov(rD , rE )x%x%0.01%-3.7191%-2.3262.50%-1.965%-1.64510%-1.28225%-
University of Cape Town - FINANCE - 3044
UNIVERSITYOFCAPETOWNSCHOOLOFMANAGEMENTSTUDIESFINANCE2BUS3026WJUNE2008TotalMarks:170Time:3hoursINSTRUCTIONS: DONOTTURNOVERTHEPAGEUNTILINSTRUCTEDTODO SO ANSWERALLQUESTIONS ANSWEREACHSECTIONINADIFFERENTBOOK NOQUESTIONSWILLBEANSWEREDDURINGTHEEXAM.
University of Cape Town - FINANCE - 3044
Finance II 2006: DerivativesSeptember TestThursday, 28 September 2006September Test, 4th QuarterThursday, 28 September 2006DurationTotal Marks1 hour 45 minutes100 marksNotes and InstructionsSection 1 True of False Questions (10 Questions, max 20
University of Cape Town - FINANCE - 3044
30Sep058.50%7.95%7.90%RS00110yearswap9yearswap3.1.1RS00110YearSwapmarks0.50.5RS0019YearSwap0.50.53.1.230Sep05NACQNACS8.41%8.50% =(1+8.5%/2)^(2/4)1)*48.03% =(1+7.95%/4)^(4/2)1)*27.95%0.46%0.47%30Sep06NACQNACS9.39%9.50% =(1+9.
University of Cape Town - FINANCE - 3044
BUS3026WTERM TEST 130 March 2006`Version ATime: 120 minutesTotal marks: 120 (plus 1 possible bonus mark)Of which:Equities:Portfolio Theory:75 marks45 marksIMPORTANT INSTRUCTIONS:1. At the top right of this page you will see whether your paper
University of Cape Town - FINANCE - 3044
UNIVERSITYOFCAPETOWNSCHOOLOFMANAGEMENTSTUDIESFINANCE2MAKEUPTESTBUS3026WOCTOBER2009TotalMarks:120Time:2hoursINSTRUCTIONS: DONOTTURNOVERTHEPAGEUNTILINSTRUCTED TODOSO ANSWERALLQUESTIONS ANSWEREACHSECTIONINADIFFERENTBOOK NO QUESTIONS WILL BE ANSWE
University of Cape Town - FINANCE - 3044
BUS3026WNovemberExam2007SolutionsSectionAQuestion1WehaveaR15mALSIexposure.ThefuturescontractcanberestatedintermsofaninvestmentintheALSI:=1097.6x25x350xe(0.0470.022)0.5=R9724803[2]OurnetexposurestotheALSIisthusR24724803.Theoptionscontractcanberest
University of Cape Town - FINANCE - 3044
UNIVERSITYOFCAPETOWNSCHOOLOFMANAGEMENTSTUDIESFINANCE2CLASSTESTBUS3026WOCTOBER2008TotalMarks:115Time:2hoursINSTRUCTIONS: DONOTTURNOVERTHEPAGEUNTILINSTRUCTED TODOSO ANSWERALLQUESTIONS ANSWEREACHSECTIONINADIFFERENTBOOK NO QUESTIONS WILL BE ANSWER
University of Cape Town - FINANCE - 3044
UNIVERSITYOFCAPETOWNSCHOOLOFMANAGEMENTSTUDIESFINANCE2SUPPLEMENTARYEXAMBUS3026WJANUARY2007TotalMarks:160Time:3hoursINSTRUCTIONS: DONOTTURNOVERTHEPAGEUNTILINSTRUCTED TODOSO ANSWERALLQUESTIONS ANSWEREACHSECTIONINADIFFERENTBOOK NO QUESTIONS WILL B
University of Cape Town - FINANCE - 3044
SECTION A: RISK MANAGEMENT[30 MARKS]QUESTION 1[21 MARKS]Firstly, we determine our exposures:i) We have a R20m ALSI exposure with weekly dividends of 20m x 0.0156 / 52 = R6 000. [1]The futures contract can be restated in terms of an investment in the
University of Cape Town - FINANCE - 3044
UNIVERSITY OF CAPE TOWNSCHOOL OF MANAGEMENT STUDIESFINANCE 2 FINAL EXAMBUS3026WNOVEMBER 2009Total Marks: 160Time: 3 hoursINSTRUCTIONS: DO NOT TURN OVER THE PAGE UNTIL INSTRUCTEDTO DO SO ANSWER ALL QUESTIONS ANSWER EACH SECTION IN A DIFFERENT BO
University of Cape Town - FINANCE - 3044
FINANCE 2BUS326WFINAL EXAM31 OCTOBER 2003Section A: Modern Portfolio Theory and Bond Valuation [70 marks]Section B: Derivatives and Equity Valuation[45 marks]Section C: International Finance[45 marks]Section D: Active Portfolio Theory and Evaluat
University of Cape Town - FINANCE - 3044
ECTIONSA:WrittenQuestions[60marks]ChooseONLY2ofthefollowing3Questions.QUESTION1(30MARKS)[Maximumlength:1pages]AsafinanceinternatPorkProducts,JenniferSmithsnewestassignmentistocomeupwithfreshinsightsregardingthefirmscostofcapital.Shehasjustreturned
University of Cape Town - FINANCE - 3044
ECTIONSA:WrittenQuestions[60marks]ChooseONLY2ofthefollowing3Questions.QUESTION1(30MARKS)[Maximumlength:1pages]AsafinanceinternatPorkProducts,JenniferSmithsnewestassignmentistocomeupwithfreshinsightsregardingthefirmscostofcapital.Shehasjustreturned
University of Cape Town - FINANCE - 3044
UNIVERSITYOFCAPETOWNSCHOOLOFMANAGEMENTSTUDIESFINANCE2BUS3026WJUNE2008TotalMarks:170Time:3hoursINSTRUCTIONS: DONOTTURNOVERTHEPAGEUNTILINSTRUCTEDTODO SO ANSWERALLQUESTIONS ANSWEREACHSECTIONINADIFFERENTBOOK NOQUESTIONSWILLBEANSWEREDDURINGTHEEXAM.
University of Cape Town - FINANCE - 3044
Exam BUS3026 Equity SectionPlease show all your calculations.Total: 60 marksQuestion 1:[Total:17]a) Name one bullish technical pattern that technical analysts use, as well as one ofthe two commonly used overbought / oversold indicators. No descripti
University of Cape Town - FINANCE - 3044
BUS3026W September Test with SolutionsQuestion 111 MarksAssume today is 1 October 2007:Company XYZ issued two zero coupon bonds with the following characteristics:Bond AFace ValueMaturityYield to MaturityCurrent Value====R1,00030 September
University of Cape Town - FINANCE - 3044
SOLUTIONSSECTION A: EQUITIES (18 MARKS)QUESTION 1 (6 MARKS)1.1Resistance levels are set a prices where sellers consistently come in, therebypreventing prices from rising above that level (supply comes in).[1 marks]1.2When earnings are negative, P/
University of Cape Town - FINANCE - 3044
BUS3044F 2011 TutorialDue: Week beginning 21 February__Question 1The founders of Rotocon own 300,000 A-class shares (each with one vote). Recently thecompany had an IPO during which it issued an additional 2,000,000 N-shares (each with0.1 of a vote
University of Cape Town - FINANCE - 3044
BUS3044F 2011 TutorialDue: Week beginning 28 February__Question 1Platocon has just declared a dividend of 437 cps for the 2010/11 financial year.You also have the following information:Dividends for 2007/8, 2008/9 and 2009/10 were, respectively, 38
University of Cape Town - FINANCE - 3044
BUS3044F 2011 Tutorial 4Due: Week beginning 14 March__Question 1Heggie Construction currently has the following capital structure:Ordinary shares8% R1,000 par value convertible debentures each convertible into 10 ordinary sharesOptions owned by ma
University of Cape Town - FINANCE - 3044
BUS3044F 2011 Tutorial 4Due: Week beginning 14 March__Question 1Heggie Construction currently has the following capital structure:Ordinary shares8% R1,000 par value convertible debentures each convertible into 10 ordinary sharesOptions owned by ma
University of Cape Town - FINANCE - 3044
Tutorial and Solutions: Due week beginning 18th April 2011(16 marks)1. The Security Characteristic Line (SCL)A. plots the excess return on a security as a function of the excess return on the market.B. allows one to estimate the beta of the security.
University of Cape Town - FINANCE - 3044
Tutorial: Due week beginning 2nd May 2011(20 marks)1. Discuss the assumptions of the capital asset pricing model, and how these assumptionsrelate to the "real world" investment decision process.[12]2. Discuss the differences between the capital marke
University of Cape Town - FINANCE - 3044
Tutorial: Due week beginning 16th May 2011(22 marks)1. Discuss the various forms of market efficiency. Include in your discussion the information sets involved ineach form and the relationships across information sets and across forms of market efficie
University of Cape Town - FINANCE - 3044
Tutorial 5:Due week beginning 4th April 2011(7 marks)a) Discuss why common stocks must earn a risk premium.[2]b) Toyota stock has the following probability distribution of expected prices one year from now:If you buy Toyota today for $55 and it will
University of Cape Town - FINANCE - 3044
Tutorial and Solutions:(16 marks)Due week beginning 18th April 20111. The Security Characteristic Line (SCL)A. plots the excess return on a security as a function of the excess return on the market.B. allows one to estimate the beta of the security.
University of Cape Town - FINACNE - 3045
BUS3026W Finance II 2010 International Finance Tutorial 1QUESTION 1 [3 Marks]How is international financial management different from domestic financial management?[3]QUESTION 2 [3 Marks]Discuss three major trends that have prevailed in international
University of Cape Town - FINACNE - 3045
BUS3026W Finance II 2010 International Finance Tutorial 1 Suggested SolutionQUESTION 1 [3 Marks]How is international financial management different from domestic financial management?There are three major dimensions that set international finance apart
University of Cape Town - FINACNE - 3045
BUS3026W Finance II 2010 International Finance Tutorial 2QUESTION 1 [3 Marks]As of November 1, 1999, the exchange rate between the Brazilian real and U.S. dollar is R$1.95/$. The consensusforecast for the U.S. and Brazil inflation rates for the next 1-
University of Cape Town - FINACNE - 3045
BUS3026W Finance II 2010 International; Finance Tutorial 2 Suggested SolutionQUESTION 1 [3 Marks]As of November 1, 1999, the exchange rate between the Brazilian real and U.S. dollar is R$1.95/$. Theconsensus forecast for the U.S. and Brazil inflation r
University of Cape Town - FINACNE - 3045
BUS3026W Finance II 2010 International Finance Tutorial 3QUESTION 1Suppose that you overheard the following statements at a conference for institutional investors:(A German national): My money manager knows the German firms very well; why should I both
University of Cape Town - FINACNE - 3045
BUS3026W Finance II 2010 International Finance Tutorial 3 Suggested SolutionsQUESTION 1(a) Two reasons why each of these people would want to diversify their portfolio internationally are: risk reductionand return enhancement. Empirical studies have fo
C. Washington - CS - 4613
1.6 List four significant differences between a file-processing system and a DBMS.Answer: Some main differences between a database management system anda file-processing system are: Both systems contain a collection of data and a set of programs which
C. Washington - CS - 4613
1.8 List five responsibilities of a database management system. For each responsibility,explain the problems that would arise if the responsibility were not discharged.Answer: A general purpose database manager (DBM) has five responsibilities:a. intera
C. Washington - CS - 4613
1.11 What are five main functions of a database administrator?Answer: Five main functions of a database administrator are: To create the scheme definition To define the storage structure and access methods To modify the scheme and/or physical organiza
C. Washington - CS - 4613
2.4 Describe the differences in meaning between the terms relation and relation schema.Answer: A relation schema is a type definition, and a relation is an instanceof that schema. For example, student (ss#, name) is a relation schema andss# name123-45
C. Washington - CS - 4613
2.5 Consider the relational database of Figure 2.35, where the primary keys are underlined.Give an expression in the relational algebra to express each of the followingqueries:a. Find the names of all employees who work for First Bank Corporation.b. F
C. Washington - CS - 4613
Figure 2.35. Relational database for Exercises 2.1, 2.3 and 2.9.b. person-name, city (employee _(company-name = First Bank Corporation (works)c. person-name, street, city(company-name = First Bank Corporation salary > 10000)works _ employee)d. perso
C. Washington - CS - 4613
2.6 Consider the relation of Figure 2.20, which shows the result of the query Findthe names of all customers who have a loan at the bank. Rewrite the queryto include not only the name, but also the city of residence for each customer.Observe that now c
C. Washington - CS - 4613
2.7 Consider the relational database of Figure 2.35. Give an expression in the relationalalgebra for each request:a. Give all employees of First Bank Corporation a 10 percent salary raise.Exercises 9b. Give allmanagers in this database a 10 percent sa
C. Washington - CS - 4613
2.8 Using the bank example, write relational-algebra queries to find the accountsheld by more than two customers in the following ways:a. Using an aggregate function.b. Without using any aggregate functions.Answer:a. t1 account-numberGcount customer-
C. Washington - CS - 4613
2.9 Consider the relational database of Figure 2.35. Give a relational-algebra expressionfor each of the following queries:a. Find the company with the most employees.b. Find the company with the smallest payroll.c. Find those companies whose employee
C. Washington - CS - 4613
2.10 List two reasons why null values might be introduced into the database.Answer: Nulls may be introduced into the database because the actual valueis either unknown or does not exist. For example, an employee whose addresshas changed and whose new a
C. Washington - CS - 4613
3.8 Consider the insurance database of Figure 3.11, where the primary keys are underlined.Construct the following SQL queries for this relational database.a. Find the number of accidents in which the cars belonging to John Smithwere involved.b. Update
C. Washington - CS - 4613
Figure 3.12. Employee database.3.9 Consider the employee database of Figure 3.12, where the primary keys are underlined.Give an expression in SQL for each of the following queries.a. Find the names of all employees who work for First Bank Corporation.
C. Washington - CS - 4613
Figure 3.11. Insurance database.employee (employee name, street, city)works (employee name, company name, salary)company (company name, city)manages (employee name, manager name)3.10 Consider the relational database of Figure 3.12. Give an expression
C. Washington - CS - 4613
3.11 Let the following relation schemas be given:14 Chapter 3 SQLR = (A,B,C)S = (D,E, F)Let relations r(R) and s(S) be given. Give an expression in SQL that is equivalentto each of the following queries.a. A(r)b. B =17 (r)c. r sd. A,F (C =D(r s)
C. Washington - CS - 4613
3.12 Let R = (A,B,C), and let r1 and r2 both be relations on schema R. Give anexpression in SQL that is equivalent to each of the following queries.a. r1 r2b. r1 r2c. r1 r2d. AB(r1) _ BC(r2)Answer:a. r1 r2(select *from r1)union(select *from r2
C. Washington - CS - 4613
3.13 Show that, in SQL, <> all is identical to not in.Answer: Let the set S denote the result of an SQL subquery.We compare (x <>all S) with (x not in S). If a particular value x1 satisfies (x1 <> all S) then forall elements y of S x1 _= y. Thus x1 is
C. Washington - CS - 4613
3.14 Consider the relational database of Figure 3.12. Using SQL, define a view consistingof manager name and the average salary of all employees who work forthat manager. Explain why the database system should not allow updates to beexpressed in terms
C. Washington - CS - 4613
3.15 Write an SQL query, without using a with clause, to find all branches wherethe total account deposit is less than the average total account deposit at allbranches,16 Chapter 3 SQLa. Using a nested query in the from clauser.b. Using a nested quer
C. Washington - CS - 4613
3.18 Give an SQL schema definition for the employee database of Figure 3.12. Choosean appropriate domain for each attribute and an appropriate primary key foreach relation schema.Answer:create domain company names char(20)create domain city names cha
C. Washington - CS - 4613
4.7 Referential-integrity constraints as defined in this chapter involve exactly tworelations. Consider a database that includes the following relations:salaried-worker (name, office, phone, salary)hourly-worker (name, hourly-wage)address (name, stree
C. Washington - CS - 4613
4.10 Consider an employee database with two relationsemployee (employee-name, street, city)works (employee-name, company-name, salary)where the primary keys are underlined.Write a query to find companies whoseemployees earn a higher salary, on average
C. Washington - CS - 4613
4.12 Compare the use of embedded SQL with the use in SQL of functions defined ina general-purpose programming language. Under what circumstances wouldyou use each of these features?Answer: SQL functions are primarily a mechanism for extending the power
C. Washington - CS - 4613
5.6 Consider the employee database of Figure 5.14. Give expressions in tuple relationalcalculus and domain relational calculus for each of the following queries:a. Find the names of all employees who work for First Bank Corporation.b. Find the names an
C. Washington - CS - 4613
5.7 Let R = (A, B) and S = (A, C), and let r(R) and s(S) be relations. Writerelational-algebra expressions equivalent to the following domain-relationalcalculusexpressions:a. cfw_< a > | b (< a,b > r b = 17)b. cfw_< a, b, c > | < a,b > r < a,c > sc.
C. Washington - CS - 4613
5.9 Let R = (A, B) and S = (A, C), and let r(R) and s(S) be relations. Usingthe special constant null, write tuple-relational-calculus expressions equivalentto each of the following:a. r _ sb. r _ sc. r _ sAnswer:a. cfw_t | r R s S (r[A] = s[A] t[A