human physiology study questions 15
University of Iowa, INTEGRATIV 130
Excerpt: ... at happens after an antibody binds to a virus or toxin? A. The antibody engulfs the microbe and destroys it by phagocytosis. B. The bound microbe is rendered inactive and can no longer bind to susceptible cells. C. Complement binds to the antibody and initiates a cascade of events to destroy the microbe. D. The antibody bound microbe can attach to a natural killer cell and be destroyed. E. A, B, and C could all happen. F. B, C, and D could all happen. 3. What is one of the reasons that the human immunodeficiency virus (the virus that causes AIDs) impacts the immune system so greatly? A. The virus causes a proliferation of Helper T cells that results in an exaggerated immune response destroying healthy cells. B. The virus will enter and destroy the a cells so people can no longer release antibodies. C. The virus infects the Helper T cells, which ultimately diminishes the function of B and Cytotoxic T cells severely suppressing the immune system. D. The virus suppresses the immune system by binding to the B cel ...
|
|
Btech quiz 3 Spring 2006 samples only
Kennesaw, BTECH 3100
Excerpt: ... BTEC 3301 Quiz 3 samples only Check the answers from testbk & lectures 1. Retrovirus-mediated transgenics is accomplished by infectiong mouse embryo with retrovirus before the embryo is implanted A. True B. False 2. The OncoMouse or the Harvard mouse, carrying a gene that promotes the development of various human cancers A. True B. False 3. A transgenic bull carries a human gene for Lactoferrin (gene responsible for higher iron content) A. True B. False 4. The Foot and Mouth disease in England in - led to destruction of herds of cattle, sheep and goat. A. 2000 B. 2001 C. 1999 D. 2002 5. The Human immunodeficiency virus (HIV) is-. A. adenoviruses B. adeno-associated viruses and C. herpes simplex viruses D. retroviruses. 6. Dolly who became the first famous adult cloned sheep was successfully cloned in 1996. A. True B. False 7. Embyro twinning is the process of splitting the embryo in half. A.True B.False 8. In the embryo stem cells, embryonic cells are collected from any part of the ...
|
|
Homework2
Acton School of Business, BIOE 301
Excerpt: ... ns of antiretroviral drugs has proven remarkably effective in controlling the progression of human immunodeficiency virus (HIV) disease and prolonging survival, but these benefits can be compromised by the development of drug resistance. Resistance is the consequence of mutations that emerge in the viral proteins targeted by antiretroviral agents. In the United States, as many as 50 percent of patients receiving antiretroviral therapy are infected with viruses that express resistance to at least one of the available antiretroviral drugs. NEJM 350:1023-35, 2004. Drug-Resistant HIV One new technology developed to decrease the development of resistance is described in the following NPR report: http:/www.npr.org/templates/story/story.php?storyId=5554167 4) How might this particular development reduce the risk of drug resistance in the developing and developed world? 1 Drug-Resistant TB Access the following CDC Weekly Report: Emergence of Mycobacterium tuberculosis with Extensive Resistance to Second-Lin ...
|
|
Homework2
Acton School of Business, BIOE 301
Excerpt: ... of antiretroviral drugs has proven remarkably effective in controlling the progression of human immunodeficiency virus (HIV) disease and prolonging survival, but these benefits can be compromised by the development of drug resistance. Resistance is the consequence of mutations that emerge in the viral proteins targeted by antiretroviral agents. In the United States, as many as 50 percent of patients receiving antiretroviral therapy are infected with viruses that express resistance to at least one of the available antiretroviral drugs. NEJM 350:1023-35, 2004. Drug-Resistant HIV One new technology developed to decrease the development of resistance is described in the following NPR report: http:/www.npr.org/templates/story/story.php?storyId=5554167 4) How might this particular development reduce the risk of drug resistance in the developing and developed world? Drug-Resistant TB Access the following CDC Weekly Report: Emergence of Mycobacterium tuberculosis with Extensive Resistance to Second-Line Drugs ...
|
|
AIDS
Penn State, BI SC 001
Excerpt: ... Bi Sci 001 Wednesday April 21,1999 Announcements: Lecture notes: AIDS Sexual Transmission: male to male, male to female, female to female. *Women are 20-23 times more likely to receive than transmit the virus in heterosexual transmission. Transmission by blood and blood products: Infected illegal drug "works" Transfusion: Risk- 1 in 50,000 to 1 in 100,000. Factor 8 (Almost no risk now- heat treated or bioengineered now) Mother (Infected) to infant *1/4 infected in mom's uterus. *more are infected by breast milk. HIV ( Human Immunodeficiency Virus ) HIV is a fragile retrovirus. (retroviruses contain copies of reverse transcriptase which can make DNA from RNA.) Stage of the Disease Process. Exposure: exchange of body fluids which contain enough virus to infect cells. (semen, blood, vaginal fluids, possibly mother's milk) Infection: 1. The virus has a protein on its membrane called gp120. It finds and binds to the protein called CD4 on the surface of a T4 lymphocyte. Also infects monocytes and glial ce ...
|
|
Health Study Guide Test 2
Vermont, GEOG 001
Excerpt: ... complications, and treatment for: Bacterial Sexually Transmitted Infections Bacterial Vaginosis (BV) Chlamydia Gonorrhea Syphilis Viral Sexually Transmitted Infections Herpes Human papillomavirus (HPV) Hepatitis B Human immunodeficiency virus (HIV) Other Sexually Transmitted Infections Trichimoniasis (is actually a protozoa) Lice or crabs (insect) Scabies or mites (insect) Ch 16: (Drugs of Abuse) Exact definition of a drug How drugs are classified How drugs work Some common side effects of drugs of abuse (figure 16.3) Withdrawal Dependence (physical and psychological) Tolerance Addiction Why people take drugs How drug companies pick your pocket Know drugs, effects, classifications etc: (see table 16.4) Stimulants Cocaine, amphetamine, caffeine Club Drugs Ecstasy, rohypnol Depressants Opiates Codeine, Morphine, Oxycodone, Vicodan etc Sedatives Amytal, Nembutal, phenobarb, seconal Minor and Major tranquilizers Xanax, valium, thorazine Marijuana Hallucinogens Ch 17 ...
|
|
1113 Unit 7 - Immunologic Diagnosis of Infectio...
Weber, CLS 1113
Excerpt: ... of infectious mononucleosis and serum sickness. 9. Compare and contrast direct methods and what they detect for CMV infection. 10. Identify the common name, the mode of transmission, and the serological methods used in the diagnosis of the Rubella virus. 11. Compare and contrast Hepatitis A, B and C with regard to the transmission route, length of incubation, acute and/or chronic states and causative agent. 12. Correlate test results for HbsAg and anti-HBc antibody to disease phase. 13. Explain the process by which immunity to hepatitis A & B can be obtained. 14. Describe the causative agent, etiology and pathogenicity of AIDS. 15. Describe the clinical and laboratory findings in a patient with acquired immunodeficiency syndrome (AIDS). 16. Identify the common serological methods used in the diagnosis of the Human Immunodeficiency Virus (HIV) 17. Define the current confirmatory testing for HIV infections. 18. Explain what the P24 antigen test is and how it is more useful in the detection of HIV. LEARNING AC ...
|
|
Microbiology_Ch_11_EP
CSU LA, MICR 300
Excerpt: ... Chapter 11 Lecture Outline Viral Molecular Biology Outline 11.1 Phage T4: The classic Molecular Model 11.4 A segmented (-) Strand RNA Virus: Influenza 11.5 A Retrovirus: Human Immunodeficiency Virus Note: We will not cover 11.2, 11.3, 11.6! Microbiology: An Evolving Science 2009 W. W. Norton & Company, Inc. 2 Prokaryotic Viruses Must bind to host cell receptor Must cross a cell wall In gram- hosts 2 membranes to cross Must not damage host cell initially Use host nucleotides, amino acids, ATP Replicate viral genome, build capsid, assemble new viruses lyse host cells Microbiology: An Evolving Science 2009 W. W. Norton & Company, Inc. 3 Exit through cell wall Usually Bacteriophage T4 Complicated structure 170 genes 10 different capsid protein types Tail fibers bind host cell Receptor = OmpC porin Outer membrane protein Long tail injects DNA Microbiology: An Evolving Science 2009 W. W. Norton & Company, Inc. 4 Phage T4 Adsorption and DNA Injection Tail fibers bind ...
|
|
Lecture 7 Glossary
Acton School of Business, BIOE 301
Excerpt: ... Lecture 7 Glossary AIDS Acquired immunodeficiency syndrome. A disease caused by human immunodeficiency virus (HIV). People with AIDS are at an increased risk for developing certain cancers and for infections that usually occur only in individuals with a weak immune system. Source: http:/www.cancer.gov/dictionary/ Atherosclerosis A disease process that leads to the buildup of a waxy substance, called plaque, inside blood vessels. Source: http:/www.texasheartinstitute.org/HIC/Gloss/index.cfm Cervix The lower, narrow end of the uterus that forms a canal between the uterus and vagina. Source: http:/www.cancer.gov/dictionary/ Confocal Microscopy A microscope that allows the observer to visualise objects in a single plane of focus, thereby creating a sharper image (usually the objects are fluorescent molecules); a refinement of this microscope uses optical sectioning and a computer to record serial sections. this permits three-dimensional reconstruction. Source: http:/www.biology-online.org/dictionary/Confoc ...
|
|
final 2005 study guide
Minnesota, PSY 4501
Excerpt: ... whole section) Cardiovascular disease Pap smear Cervical cancer Hysterectomy Osteoporosis Human immunodeficiency virus (whole section on AIDS/HIV) Alcohol abuse Binge drinking Plus section on health care and health status of women (pp. 354-6) Note: The multiple choice questions are based on these key terms but go beyond just the definition of the terms. You should know the material in the section that contains the key term in addition to its definition. Key Material from Lecture Women in medical research, history and current status Smoking (lecture and book) Binge drinking, effects of alcohol on women Possible essay question: Describe four of the five biases against women in the health care system (1 point each) and provide one specific example of each (1 point each). 8 points total. Chapter 12: Women and Psychological Disorders Key Terms from Textbook Major Depressive Disorder and explanations for gender differences (pp. 388-393) Ruminative style Anorexia nervosa Bulimia nervosa Binge-eating disorder Cultu ...
|
|
06tumor_viruses
Penn State, BIOL 416
Excerpt: ... #6 BIOL 416 Biology of Cancer Tumor Viruses (Chapter 6, pp. 7781) Jan. 20, 2006 I. Basic components of viruses Genetic material RNA (e.g. retroviruses) or DNA (e.g. SV40 and polyoma viruses) Capsid Envelope (coat protein + lipid b ...
|
|
HW2a & b fall 2008
Acton School of Business, BIOE 301
Excerpt: ... BIOE 301/362 Homework #2 Due: 9/11/04 Part A Bioengineering and World Health HW Questions: #6-9, Chapter 4 6. The use of combinations of antiretroviral drugs has proven remarkably effective in controlling the progression of human immunodeficiency virus (HIV) disease and prolonging survival, but these benefits can be compromised by the development of drug resistance. Resistance is the consequence of mutations that emerge in the viral proteins targeted by antiretroviral agents. In the United States, as many as 50 percent of patients receiving antiretroviral therapy are infected with viruses that express resistance to at least one of the available antiretroviral drugs. [NEJM 350:1023-35, 2004]. One new technology developed to decrease the development of resistance is described in the following NPR report: http:/www.npr.org/templates/story/story.php?storyId=5554167. How might this particular development reduce the risk of drug resistance in the developing and developed world? 7. Access the following CDC Weekly R ...
|
|
HW2a & b fall 2008
Acton School of Business, BIOE 301
Excerpt: ... BIOE 301/362 Homework #2 Due: 9/11/04 Part A Bioengineering and World Health HW Questions: #6-9, Chapter 4 6. The use of combinations of antiretroviral drugs has proven remarkably effective in controlling the progression of human immunodeficiency virus (HIV) disease and prolonging survival, but these benefits can be compromised by the development of drug resistance. Resistance is the consequence of mutations that emerge in the viral proteins targeted by antiretroviral agents. In the United States, as many as 50 percent of patients receiving antiretroviral therapy are infected with viruses that express resistance to at least one of the available antiretroviral drugs. [NEJM 350:1023-35, 2004]. One new technology developed to decrease the development of resistance is described in the following NPR report: http:/www.npr.org/templates/story/story.php?storyId=5554167. How might this particular development reduce the risk of drug resistance in the developing and developed world? 7. Access the following CDC Weekly R ...
|
|
Study Guide 3 08
Middle Tennessee State University, BIOL 4130
Excerpt: ... macrophages, B lymphocytes, helper T cells, cytotoxic T cells, and NK cells and explain why the human immunodeficiency virus (HIV) is so devastating to our immune system. While cavorting on a warm spring days you backed into a locust tree thorn. The thorn penetrated to your gluteus maximus where the tip broke-off and lodged. Beginning with the skin surface, outline the cell/tissue layers and any structures encountered when the thorn tip is removed. Outline and explain the role of the various cells and organelles involved in the process of epidermal keratinization. Compare and contrast the structure, cells present and secretory function of an eccrine sweat gland, apocrine gland, and a mammary gland. Describe the structure and major histological features of the human tongue. Compare and contrast the three major salivary glands in terms of structural and functional features. Outline the major cell types and the layers present in a developing tooth. Compare and contrast the upper esophagus, fundic stomach, duoden ...
|
|
Lecture Notes 19 11
University of Iowa, SOCIOLOGY 034:001:CC
Excerpt: ... Lecture Notes 19 11/8/07 AIDS (Acquired Immune Deficiency Syndrome) Transmitted through HIV ( Human Immunodeficiency Virus ) New Case in 2000 MSM- Men having sex with men (18,000) IDU- Injection drug users (10,000) Heterosexual contact (9,000) HIV is spread by injection drug users who share needles and heterosexual contact as well as by men having sex with men Edward O. Laumann et al. (1994) The Social Organization of Sexuality. U. Of Chicago, National Health and Social Life Survey completed 1992: 3400 respondents, strict random sampling procedures, very high completion rate, 80%, suggests high quality results. NUMBERS MEMORIZE! Percent Who Report ever having Extramarital Sex by Gender and Birth Cohort Year Born 1933-42 (50-59 years old) 1943-52 (40-49 years old) 1953-62 (30-39 years old) 1963-74 (18-29 years old) Men 37.0% 31.4% 20.5% 7.1% Women 12.4% 19.9% 14.5% 11.7% Percent Who Report No Vaginal Intercourse Before Marriage by Birth Cohort and Gender Year Born Men Women 1933-42 (50-59 years o ...
|
|
lecture1
UWO, CS 832
Excerpt: ... TTCGGGATAGGTGGTGGAGTTA GGAGCAATTTTTTGTGGGCAGGGAGTGGATCTTACAAAGGACATTCTCAA GGGTGGGGATGATTTTACAAAGTACCTTCTTAAGGGCGGGGGAGGATATT ACAAAGTACCTTCTCAAGGGTGGGGATGATTTTACAAAGTACCTTCTTAA GGGCGGGGGAGGATATTACAAAGTACCTTCTCAAGGGTGGGGGTGGATAT Chromosome X is one of the 23 chromosomes in human genome. Chromosome X has 162 million base pairs. Genome Sizes Species Amoeba dubia Homo sapiens Drosophila melanogaster Mycoplasma genitalium Human immunodeficiency virus type 1 Size in bps 670,000,000,000 3,400,000,000 180,000,000 580,000 9,750 Protein and Amino Acids Protein Protein GOT Ecoli A protein sequence >gi|7228451|dbj|BAA92411.1| EST AU055734(S20025) corresponds to a region . MCSYIRYDTPKLFTHVTKTPPKNQVSNSINDVGSRRATDRSVASCSSEKSVGTMSVKNASSISFEDIEKSISNWKIPKVN IKEIYHVDTDIHKVLTLNLQTSGYELELGSENISVTYRVYYKAMTTLAPCAKHYTPKGLTTLLQTNPNNRCTTPKTLKWD EITLPEKWVLSQAVEPKSMDQSEVESLIETPDGDVEITFASKQKAFLQSRPSVSLDSRPRTKPQNVVYATYEDNSDEPSI SDFDINVIELDVGFVIAIEEDEFEIDKDLLKKELRLQKNRPKMKRYFERVDEPFRLKIRELWHKEMREQRKNIFFFDWYE SSQVRHFEEFFKG ...
|
|
Joe_PE_Tutorial
Middlebury, CHEM 0441
Excerpt: ... Joe Della Rocca Chem 441 Protein Explorer Tutorial 3/31/06 HIV-1 Protease Tutorial on Protein Explorer PDB code: 1bdr In the two decades since it was first reported, acquired immunodeficiency syndrome (AIDS) and its causative agent human immunodeficiency virus (HIV) have spread to epidemic proportions throughout the world. The United Nations currently estimate that 40.3 million people are living with HIV and 3.1 people died as a result of AIDS in the last year. HIV-1 protease is a 99 amino acid aspartyl protease that functions as a homodimer with only 1 active site formed by both subunits. It is a key enzyme in the HIV life cycle, cleaving polypeptide precursors into mature proteins. Studies have shown that immature viral proteins do not have any infective properties, so inhibition of this enzyme is a logical goal for HIV drug design. Several mechanisms for HIV-1 protease have been suggested, most of which suggest that the HIV protease follows the general mechanism for aspartyl proteases first proposed by Se ...
|
|
Lecture 4 Glossary
Acton School of Business, BIOE 301
Excerpt: ... Lecture 4 Glossary AIDS Acquired immunodeficiency syndrome. A disease caused by human immunodeficiency virus (HIV). People with AIDS are at an increased risk for developing certain cancers and for infections that usually occur only in individuals with a weak immune system. Source: http:/www.cancer.gov/dictionary/ Anaplasia a loss of differentiation of cells and of their orientation to one another and to their axial framework and blood vessels, a characteristic of tumor tissue; called also dedifferentiation and undifferentiation. Source: www.mercksource.com Angioplasty A nonsurgical technique for treating diseased arteries by temporarily inflating a tiny balloon inside an artery. Source: http:/www.texasheartinstitute.org/HIC/Gloss/index.cfm Aspirin Acetylsalicylic acid; a medicine used to relieve pain, reduce inflammation, and prevent blood clots. Source: http:/www.texasheartinstitute.org/HIC/Gloss/index.cfm CABG Coronary Artery Bypass Grafting. Surgical rerouting of blood around a diseased vessel that ...
|
|
m320_1cF01
Washington University in St. Louis, MATH 320
Excerpt: ... odeficiency virus (HIV). An inexpensive test is used to screen people for the disease. Of those who have HIV, the test detects that they have the disease 99% of the time. Of those who do not have HIV, the test says they don't have the disease 97% of the time. What is the joint probability that someone chosen at random will not have HIV, but the test will say that he or she does? 7. Given the information in Problem 6, what is the conditional probability that a person is infected with human immunodeficiency virus (HIV), given that the test says he or she is infected? ...
|
|
abstract_jmc_1996_39_2472
Michigan, SW 16
Excerpt: ... 2472 J. Med. Chem. 1996, 39, 2472-2481 Antiretroviral Agents as Inhibitors of both Human Immunodeficiency Virus Type 1 Integrase and Protease Abhijit Mazumder, Shaomeng Wang, Nouri Neamati, Marc Nicklaus, Sanjay Sunder, Julie Chen, George W. A. Milne, William G. Rice, Terrence R. Burke, Jr., and Yves Pommier* Laboratories of Molecular Pharmacology and Medicinal Chemistry, Division of Basic Sciences, National Cancer Institute, Building 37, Bethesda, Maryland 20892, and Laboratory of Antiviral Drug Mechanisms, NCI-Frederick Cancer Research and Development Center, Frederick, Maryland 21702 Received January 24, 1996X The human immunodeficiency virus type one integrase (HIV-1 integrase) is required for integration of a double-stranded DNA copy of the viral RNA genome into a host chromosome and for HIV replication. We have previously reported that phenolic moieties in compounds such as flavones, caffeic acid phenethyl ester (CAPE), tyrphostins, and curcumin confer inhibitory activity against HIV-1 ...
|
|
Lecture 10 Glossary
Acton School of Business, BIOE 301
Excerpt: ... Lecture 10 Glossary AIDS Acquired immunodeficiency syndrome. A disease caused by human immunodeficiency virus (HIV). People with AIDS are at an increased risk for developing certain cancers and for infections that usually occur only in individuals with a weak immune system. Source: http:/www.cancer.gov/dictionary/ CTL Abbreviation for Cytotoxic T-Lymphocytes. Envelope Proteins The envelope is the outer protective layer of the virus that is composed of two layers of fat like molecules called lipids. Envelope proteins refers to the proteins imbedded in this membrane, that help the virus attach to and enter the host cell. Source: http:/www.aidsinfo.nih.gov/Glossary/GlossaryDataCenterPage.aspx?fromLetter=E HIV Human immunodeficiency virus , the cause of acquired immunodeficiency syndrome (AIDS). Source: http:/www.cancer.gov/dictionary/ Immuno-comprimised Having an immune system that has been impaired by disease or treatment. Source: http:/www.medterms.com/ Immunologic Dysregultion Inappropriate response of ...
|
|
HW2
USC, BME 423
Excerpt: ... BME-423 HOMEWORK #2 FALL 2006 1. Narrowing of the carotid arteries can reduce flow to the brain and starve the brain of oxygen, a condition called cerebral ischemia. To study whether medical (i.e., drug therapy) or surgical treatment of this problem produced better results, an investigation was conducted in which the outcome (defined below) was determined in patients who received medical or surgical treatment. Recurrent ischemia, stroke, or death (# of patients) YES NO 55 41 49 15 Therapy Surgical Medical Is there sufficient evidence to conclude that one treatment is better than the other? To answer this question use the z statistic (with Yates correction) for testing the difference of sample proportions. 2. Answer the question posed in #1 by doing the 2 test. 3. A study of 96 women was conducted to determine if there is a relationship between the status of human papilloma virus (two HPV outcomes: positive or negative) and the stage of human immunodeficiency virus (HIV) infection (t ...
|
|
glutahione_stability
Stanford, TERUEL 1
Excerpt: ... NOTE: Glutahione is stable as a powder for 5 years at 4deg, but it is very unstable when it is solubilized in aqueous solutions. After resuspending in an aqueous solution, FREEZE IMMEDIATELY at -20deg! Here is some info from Sigma regarding the stability of Glutahione. Subject: G6013, Glutathione Thank you for contacting Sigma-Aldrich Technical Service. Per Data for Biochemical Research, 3rd ed., p. 17: readily oxidize in air to GSSG. From Biochemical Education vol. 11, 70 (1983): Half-life (Hours) 16 9 1.3 8 0.2 1.2 70 Aqueous solutions Conditions pH 6.5 at 20 deg. C. in 0.1 M KPO4 buffer pH 7.5 at " pH 8.5 pH 8.5 at " " " " " " " " + 0.1 mM Cu+ " + 1.0 mM EDTA " " " " " " 0 deg. C. pH 8.5 at 40 deg. C. pH 8.5 at 20 deg. C. pH 8.5 at 20 deg. C. Kalebic, T., et al., Proc. Natl. Acad. Sci. 88, 986, 1991 report on the suppression of human immunodeficiency virus expression in chronically infected monocytic cells by glutathione, glutathione ester and Nacetylcysteine. I hope this information is useful. please ...
|
|
Lecture3_NaturalSelection
Washington, BIOL 180
Excerpt: ... Evolution by Natural Selection I. Evolution by natural selection Charles Darwin Pattern = Process = How does evolution by natural selection occur? A. Darwin's four postulates 1. Individuals within populations are 2. Some of these variations are 3. Not all offspring live to reproduce or produce the 4. Only individuals with certain As a result, evolution occurs = the characteristics of the B. Current view of evolution by natural selection Distill the four postulates to their essence: 1) Heritable that leads to . 2) Differential Increased focus on Define evolution = a change in the characteristics of a population over time C. An example of natural selection in action: The evolution of drug resistance in HIV HIV = Human immunodeficiency virus The pathogen responsible for AIDS (acquired immune deficiency syndrome) HIV infects immune system cells, takes cells over and replicates inside, killing host cell in process Number dead to date: over Number currently infected: million ( million; million in 2005) millio ...
|