Course Solutions And Notes - knorr83_emergingPRIN 01
| Enterobacteriaceae.pdf Path: Skyline College >> BIOL >> 240 Fall, 2008 Description: Differentiation of Enterobacteriaceae by Biochemical Tests Morganella morganii Shigella Edwardsiella tarda Escherichia coli Salmonella Citrobacter amalonaticus Klebsiella Enterobacter agglomerans Hafnia alvei Serratia marcescens Proteus Providenc... Date Added: 2009-06-24 08:03:47 |
| Song_mdp14.txt Path: Duke >> CPS >> 001 Fall, 2009 Description: Name Maria Perales (mdp14) Assignment: Song Date Submitted: Monday, April 20, 2009 5:35:30 AM EDT Current Grade: not yet graded Comments: Maria Perales\' (mdp14) Extra Credit Song For a Sing-a-Long version: http:/www.youtube.com/watch?v=wzI4UghBL50... Date Added: 2009-06-24 08:06:01 |
| winter_outline.pdf Path: Brookdale >> AC >> 292 Fall, 2009 Description: BROCK UNIVERSITY COURSE OUTLINE ECON 2P92: Research Methods in Economics, Winter 2005/06 Lectures: Seminars: Wednesday and Friday, 12:30 2:00, TH258 S1- Tuesday, 8-9, MC D403 S2- Friday, 3-4, MC D400 S3- Wednesday, 9-10, EA104 S4- Tuesday, 9-10, ... Date Added: 2009-06-24 08:07:00 |
| strainplot.ps Path: Michigan >> PHYSICS >> 300 Fall, 2008 Description: %!PS-Adobe-2.0 %Title: ./s3/h1/300/strainplot.ps (Portrait A 4) %Pages: (atend) %Creator: HIGZ Version 1.27/03 %CreationDate: 2004/06/25 12.49 %EndComments %BeginProlog /s {stroke} def /l {lineto} def /m {moveto} def /t {translate} def /sw {stringwid... Date Added: 2009-06-24 08:07:23 |
| MICE0107.pdf Path: Illinois Tech >> MICE >> 0107 Fall, 2009 Description: The Coil and Support Structure Stress and Strain the MICE Focusing and Coupling Magnets Michael A. Green and Stephanie Q. Yang Oxford University Physics Department, Oxford, OX1 3RH, UK 30 August 2004* Abstract This report discusses the calculation of... Date Added: 2009-06-24 08:08:21 |
| MICE0222_abs.txt Path: Illinois Tech >> MICE >> 0222 Fall, 2009 Description: This note contains the list of requirements for the Detector DAQ and Trigger Systems. This is a PDF document URL http:/mice.iit.edu/micenotes/public/pdf/MICE0222/MICE0222.pdf Posted by graulich ... Date Added: 2009-06-24 08:08:34 |
| MICE0090_abs.txt Path: Illinois Tech >> MICE >> 0090 Fall, 2008 Description: The design of the scintillating-fibre tracker for the international Muon Ionisation Cooling Experiment (MICE) is reviewed. The first prototype of the MICE tracker was constructed over the summer of 2003. This report presents the design and constructi... Date Added: 2009-06-24 08:08:39 |
| syllabus330.pdf Path: Radford >> ECON >> 330 Fall, 2009 Description: Money and Banking ECON 330 Spring 2009 Professor: Phone: Office: Email: URL: Office hours: Alex Orlov 831-5889 Davis 110 aorlov@radford.edu www.radford.edu/~aorlov/econ330 TTh 10:45 12:30pm, W 1:00 2:30pm, and by appointment 1 Overview We will stu... Date Added: 2009-06-24 08:16:47 |
| 140Test3ReviewSol.pdf Path: Midlands Tech >> MATH >> 140 Fall, 2009 Description: 208 Chapter 3 Answers to Tests Answers to CHAPTER 3 Tests Test Form Test Form E A 2. e 6. b 10. a 1.f(t 3.b 7. 11. c c 1.c 5.a 9.d 13, b Test Forrn B 4.c 8.b 12, d 2. Minimurn at x - b 3.a. y !4. d 1\"d 5.c g.b L3. e d 6. b L0. c ... Date Added: 2009-06-24 08:17:33 |
| ps02k.pdf Path: Barton CCC >> MATH >> 118 Fall, 2009 Description: Math 118 Problem Set 2 Total = 22 pts page 1 Answers 1. Convert the following decimals to fractions. (a) 0:72 = (b) 0:51 = 18 25 51 17 = 99 33 2. Suppose that A is a set with n (A) = 12. (a) How many dierent subsets does A have? 212 = 4096 (b) Ho... Date Added: 2009-06-24 08:20:28 |
| hw2.ps Path: Harvey Mudd College >> A >> 101 Fall, 2009 Description: %!PS-Adobe-2.0 %Creator: dvipsk 5.86 p1.5d Copyright 1996-2001 ASCII Corp.(www-ptex@ascii.co.jp) %based on dvipsk 5.86 Copyright 1999 Radical Eye Software (www.radicaleye.com) %Title: hw2.dvi %Pages: 3 %PageOrder: Ascend %BoundingBox: 0 0 596 842 %Do... Date Added: 2009-06-24 08:22:07 |
| M152F08Q4A.pdf Path: Bellevue College >> MATH >> 152 Fall, 2009 Description: Math 152 Show Your Work! Good Luck! October 27, 2008 Quiz #4 A Name _ (please print) 1. Write a definite integral that represents the volume of the solid in Fig. 1. 0 x 2. (Do NOT evaluate it.) (4) volume = \" ! 2. Write a definite integral th... Date Added: 2009-06-24 08:23:44 |
| brockett1973pages64to81.pdf Path: Maryland >> ENEE >> 769 Fall, 2009 Description: ... Date Added: 2009-06-24 08:28:01 |
| hw4.pdf Path: UMBC >> MATH >> 413 Fall, 2009 Description: HW4: , and Primitive Elements Robert Campbell Math 413, Spring 2009 1. (a) List the elements of Z and compute (21) 21 (b) Compute the orders of the elements of Z and compute (21) 21 (c) Compute (54) and (54) (d) Compute (5000) and (5000) 2. Find all... Date Added: 2009-06-24 08:29:44 |
| A28.pdf Path: El Camino >> MATH >> 073 Fall, 2009 Description: Activity 28 Simplifying Radical Expressions and Rationalizing Math 73 Team Name (optional): Your Name: Partner(s): Task 1: Adding and Subtracting Radical Expressions. a) Simplify the polynomial expressions. i) 3x - 7x ii) 14mn 5mn - 7mn iii) 5a 2... Date Added: 2009-06-24 08:30:32 |
| mid-term-solns-08.pdf Path: Stanford >> MATH >> 175 Fall, 2009 Description: Mathematics Department Stanford University Math 175 Mid-term Test 2008 Solutions 1(a) (3 points): If X is a (real or complex) inner product space, give the proof of the parallelogram identity kx yk2 C kx C yk2 D 2.kxk2 C kyk2 / 8 x; y 2 X , assuming ... Date Added: 2009-06-24 08:32:32 |
| Set3_Key.pdf Path: Laurentian >> LOGI >> 200401 Fall, 2009 Description: Logic 2003A Problem Set 3: ANSWER KEY Use the following terms and predicates: P x := x is a person Ax := x is an aardvark V x := x is from the Transvaal F x := x is an ant Sx := x likes to sleep in the sun Cx := x is a cobra T x := x is a termite Lx... Date Added: 2009-06-24 08:37:58 |
| Left_Right_Sums.pdf Path: USP >> MATH >> 102 Fall, 2009 Description: The Left and Right Sums The Definite Integral: If f is a continuous function defined on interval [a, b] then b Area between the graph of f and x-axis on [a, b] = a f (x) dx. Approximating the area: Step 1 Divide [a, b] into n-pieces. Get the point... Date Added: 2009-06-24 08:41:18 |
| Assignment 2.txt Path: Penn State >> BCC >> 5027 Fall, 2009 Description: \"Benjamin Franklin\" By: Bruce Chang Benjamin Franklin was one of the most influential people not only to America, but also to the world as an inventor, government official, founder, and the first of his kind. Today he is still regarded and renowne... Date Added: 2009-06-24 08:42:21 |
| formulas.pdf Path: National Taiwan University >> SOC >> 549 Fall, 2009 Description: FORMULAS Sociology 549, Paul von Hippel Descriptive statistics Measures of center 1. mode 2. median 3. trimmed mean Y or, for a frequency table, Y = fY 4. mean Y = N N For a dummy variable the mean is p, the proportion of observations with a value... Date Added: 2009-06-24 08:46:59 |
| 3b9b0b65.pdf Path: Wisconsin >> WILL >> 0014 Fall, 2009 Description: ... Date Added: 2009-06-24 08:50:30 |
| 3b9b0b74.pdf Path: Wisconsin >> WILL >> 0014 Fall, 2009 Description: ... Date Added: 2009-06-24 08:50:32 |
| 3b9b0cd0.pdf Path: Wisconsin >> WILL >> 0014 Fall, 2009 Description: ... Date Added: 2009-06-24 08:51:20 |
| 3b9b22af.pdf Path: Wisconsin >> WILL >> 0031 Fall, 2009 Description: ... Date Added: 2009-06-24 08:52:04 |
| 3b9b0172.pdf Path: Wisconsin >> WILL >> 0025 Fall, 2009 Description: ... Date Added: 2009-06-24 08:53:49 |
| 3b9b02ff.pdf Path: Wisconsin >> WILL >> 0025 Fall, 2009 Description: ... Date Added: 2009-06-24 08:54:06 |
| 3b9b0329.pdf Path: Wisconsin >> WILL >> 0025 Fall, 2009 Description: ... Date Added: 2009-06-24 08:54:27 |
| 4876e835.pdf Path: Wisconsin >> WILL >> 0070 Fall, 2009 Description: ... Date Added: 2009-06-24 08:56:15 |
| 48770a37.pdf Path: Wisconsin >> WILL >> 0078 Fall, 2009 Description: ... Date Added: 2009-06-24 08:57:50 |
| 487709cc.pdf Path: Wisconsin >> WILL >> 0078 Fall, 2009 Description: ... Date Added: 2009-06-24 08:58:58 |
| 4877346f.pdf Path: Wisconsin >> WILL >> 0090 Fall, 2009 Description: ... Date Added: 2009-06-24 09:00:56 |
| 487773d3.pdf Path: Wisconsin >> WILL >> 0109 Fall, 2009 Description: ... Date Added: 2009-06-24 09:01:12 |
| 487774da.pdf Path: Wisconsin >> WILL >> 0109 Fall, 2009 Description: ... Date Added: 2009-06-24 09:01:33 |
| 29e1.pdf Path: Wisconsin >> WILL >> 0062 Fall, 2009 Description: ... Date Added: 2009-06-24 09:03:15 |
| 487723b0.pdf Path: Wisconsin >> WILL >> 0086 Fall, 2009 Description: ... Date Added: 2009-06-24 09:03:30 |
| 487726bb.pdf Path: Wisconsin >> WILL >> 0086 Fall, 2009 Description: ... Date Added: 2009-06-24 09:04:39 |
| 4877240c.pdf Path: Wisconsin >> WILL >> 0086 Fall, 2009 Description: ... Date Added: 2009-06-24 09:05:01 |
| 48778a04.pdf Path: Wisconsin >> WILL >> 0115 Fall, 2009 Description: ... Date Added: 2009-06-24 09:05:19 |
| 3b9acce7.pdf Path: Wisconsin >> WILL >> 0002 Fall, 2009 Description: ... Date Added: 2009-06-24 09:06:58 |
| 3b9acd53.pdf Path: Wisconsin >> WILL >> 0002 Fall, 2009 Description: ... Date Added: 2009-06-24 09:07:25 |
| 3b9acec4.pdf Path: Wisconsin >> WILL >> 0002 Fall, 2009 Description: ... Date Added: 2009-06-24 09:08:26 |
| 3b9acecb.pdf Path: Wisconsin >> WILL >> 0002 Fall, 2009 Description: ... Date Added: 2009-06-24 09:08:27 |
| 3b9b3e0b.pdf Path: Wisconsin >> WILL >> 0039 Fall, 2009 Description: ... Date Added: 2009-06-24 09:08:45 |
| 10e8.pdf Path: Wisconsin >> WILL >> 0055 Fall, 2009 Description: ... Date Added: 2009-06-24 09:10:23 |
| d97.pdf Path: Wisconsin >> WILL >> 0055 Fall, 2009 Description: ... Date Added: 2009-06-24 09:11:24 |
| 48776a02.pdf Path: Wisconsin >> WILL >> 0106 Fall, 2009 Description: ... Date Added: 2009-06-24 09:11:47 |
| 48776aaa.pdf Path: Wisconsin >> WILL >> 0106 Fall, 2009 Description: ... Date Added: 2009-06-24 09:12:15 |
| 48774f0b.pdf Path: Wisconsin >> WILL >> 0098 Fall, 2009 Description: ... Date Added: 2009-06-24 09:12:56 |
| 3b9b448b.pdf Path: Wisconsin >> WILL >> 0041 Fall, 2009 Description: ... Date Added: 2009-06-24 09:14:27 |
| 3b9b1faf.pdf Path: Wisconsin >> WILL >> 0015 Fall, 2009 Description: ... Date Added: 2009-06-24 09:15:39 |
| 3b9b33be.pdf Path: Wisconsin >> WILL >> 0036 Fall, 2009 Description: ... Date Added: 2009-06-24 09:16:24 |
| 3b9b64da.pdf Path: Wisconsin >> WILL >> 0049 Fall, 2009 Description: ... Date Added: 2009-06-24 09:18:49 |
| 3b9af7a8.pdf Path: Wisconsin >> WILL >> 0009 Fall, 2009 Description: ... Date Added: 2009-06-24 09:19:29 |
| 3b9af712.pdf Path: Wisconsin >> WILL >> 0009 Fall, 2009 Description: ... Date Added: 2009-06-24 09:19:55 |
| 3b9afa3d.pdf Path: Wisconsin >> WILL >> 0009 Fall, 2009 Description: ... Date Added: 2009-06-24 09:20:09 |
| 3b9afa17.pdf Path: Wisconsin >> WILL >> 0009 Fall, 2009 Description: ... Date Added: 2009-06-24 09:20:14 |
| 3b9afe66.pdf Path: Wisconsin >> WILL >> 0024 Fall, 2009 Description: ... Date Added: 2009-06-24 09:22:05 |
| 4876ebbe.pdf Path: Wisconsin >> WILL >> 0071 Fall, 2009 Description: ... Date Added: 2009-06-24 09:22:21 |
| 4876ed6e.pdf Path: Wisconsin >> WILL >> 0071 Fall, 2009 Description: ... Date Added: 2009-06-24 09:23:27 |
| 48770b3b.pdf Path: Wisconsin >> WILL >> 0079 Fall, 2009 Description: ... Date Added: 2009-06-24 09:25:36 |
| 487738e1.pdf Path: Wisconsin >> WILL >> 0091 Fall, 2009 Description: ... Date Added: 2009-06-24 09:27:23 |
| 487739ed.pdf Path: Wisconsin >> WILL >> 0091 Fall, 2009 Description: ... Date Added: 2009-06-24 09:27:42 |
| 32b2.pdf Path: Wisconsin >> WILL >> 0065 Fall, 2009 Description: ... Date Added: 2009-06-24 09:28:45 |
| 4877219b.pdf Path: Wisconsin >> WILL >> 0085 Fall, 2009 Description: ... Date Added: 2009-06-24 09:30:45 |
| 4877223f.pdf Path: Wisconsin >> WILL >> 0085 Fall, 2009 Description: ... Date Added: 2009-06-24 09:30:50 |
| 48772094.pdf Path: Wisconsin >> WILL >> 0085 Fall, 2009 Description: ... Date Added: 2009-06-24 09:31:06 |
| 487784b8.pdf Path: Wisconsin >> WILL >> 0114 Fall, 2009 Description: ... Date Added: 2009-06-24 09:31:14 |
| 487784c8.pdf Path: Wisconsin >> WILL >> 0114 Fall, 2009 Description: ... Date Added: 2009-06-24 09:31:17 |
| 487784d7.pdf Path: Wisconsin >> WILL >> 0114 Fall, 2009 Description: ... Date Added: 2009-06-24 09:31:20 |
| 487785d1.pdf Path: Wisconsin >> WILL >> 0114 Fall, 2009 Description: ... Date Added: 2009-06-24 09:31:37 |
| 487785ff.pdf Path: Wisconsin >> WILL >> 0114 Fall, 2009 Description: ... Date Added: 2009-06-24 09:31:45 |
| section78.pdf Path: Ill. Chicago >> MATH >> 417 Fall, 2008 Description: Math 417 Section 78 Solutions 1. To evaluate the integral: 2 0 1 d = 5 + 4 sin 5 2 0 1+ d 4 5 sin we will use the result from the example on p. 279: 2 0 4 with a = 5 . Therefore, 2 d = 1 + a sin 1 - a2 2 0 (-1 < a < 1) 1 5 1 d = 4 5 1 ... Date Added: 2009-06-24 09:32:01 |
| 4877866e.pdf Path: Wisconsin >> WILL >> 0114 Fall, 2009 Description: ... Date Added: 2009-06-24 09:32:34 |
| 3b9b42b9.pdf Path: Wisconsin >> WILL >> 0040 Fall, 2009 Description: ... Date Added: 2009-06-24 09:33:13 |
| 3b9b42f6.pdf Path: Wisconsin >> WILL >> 0040 Fall, 2009 Description: ... Date Added: 2009-06-24 09:33:25 |
| 3b9b43c4.pdf Path: Wisconsin >> WILL >> 0040 Fall, 2009 Description: ... Date Added: 2009-06-24 09:33:33 |
| 487700e2.pdf Path: Wisconsin >> WILL >> 0076 Fall, 2009 Description: ... Date Added: 2009-06-24 09:35:13 |
| 4877003c.pdf Path: Wisconsin >> WILL >> 0076 Fall, 2009 Description: ... Date Added: 2009-06-24 09:35:37 |
| 3b9ad9a6.pdf Path: Wisconsin >> WILL >> 0016 Fall, 2009 Description: ... Date Added: 2009-06-24 09:37:23 |
| 3b9ada03.pdf Path: Wisconsin >> WILL >> 0016 Fall, 2009 Description: ... Date Added: 2009-06-24 09:37:47 |
| 3b9ada7a.pdf Path: Wisconsin >> WILL >> 0016 Fall, 2009 Description: ... Date Added: 2009-06-24 09:37:50 |
| 3b9b3a61.pdf Path: Wisconsin >> WILL >> 0037 Fall, 2009 Description: ... Date Added: 2009-06-24 09:39:02 |
| 3b9b38a1.pdf Path: Wisconsin >> WILL >> 0037 Fall, 2009 Description: ... Date Added: 2009-06-24 09:39:21 |
| 3b9af305.pdf Path: Wisconsin >> WILL >> 0008 Fall, 2009 Description: ... Date Added: 2009-06-24 09:42:29 |
| 3b9af537.pdf Path: Wisconsin >> WILL >> 0008 Fall, 2009 Description: ... Date Added: 2009-06-24 09:42:44 |
| 3b9b0f33.pdf Path: Wisconsin >> WILL >> 0027 Fall, 2009 Description: ... Date Added: 2009-06-24 09:42:53 |
| 3b9b0f36.pdf Path: Wisconsin >> WILL >> 0027 Fall, 2009 Description: ... Date Added: 2009-06-24 09:42:54 |
| 3b9b11e1.pdf Path: Wisconsin >> WILL >> 0027 Fall, 2009 Description: ... Date Added: 2009-06-24 09:43:33 |
| 48771da3.pdf Path: Wisconsin >> WILL >> 0084 Fall, 2009 Description: ... Date Added: 2009-06-24 09:44:59 |
| 48771e5d.pdf Path: Wisconsin >> WILL >> 0084 Fall, 2009 Description: ... Date Added: 2009-06-24 09:45:24 |
| 48778f38.pdf Path: Wisconsin >> WILL >> 0117 Fall, 2009 Description: ... Date Added: 2009-06-24 09:46:13 |
| 3b9b5d00.pdf Path: Wisconsin >> WILL >> 0048 Fall, 2009 Description: ... Date Added: 2009-06-24 09:46:42 |
| 2dc2.pdf Path: Wisconsin >> WILL >> 0064 Fall, 2009 Description: ... Date Added: 2009-06-24 09:48:37 |
| 2eb7.pdf Path: Wisconsin >> WILL >> 0064 Fall, 2009 Description: ... Date Added: 2009-06-24 09:49:29 |
| 48773b7b.pdf Path: Wisconsin >> WILL >> 0092 Fall, 2009 Description: ... Date Added: 2009-06-24 09:50:55 |
| 48773b90.pdf Path: Wisconsin >> WILL >> 0092 Fall, 2009 Description: ... Date Added: 2009-06-24 09:51:11 |
| 3b9b5b9f.pdf Path: Wisconsin >> WILL >> 0047 Fall, 2009 Description: ... Date Added: 2009-06-24 09:52:14 |
| 487702c7.pdf Path: Wisconsin >> WILL >> 0077 Fall, 2009 Description: ... Date Added: 2009-06-24 09:54:33 |
| 487703d1.pdf Path: Wisconsin >> WILL >> 0077 Fall, 2009 Description: ... Date Added: 2009-06-24 09:54:52 |
| 487705cb.pdf Path: Wisconsin >> WILL >> 0077 Fall, 2009 Description: ... Date Added: 2009-06-24 09:55:27 |
| 487762f6.pdf Path: Wisconsin >> WILL >> 0104 Fall, 2009 Description: ... Date Added: 2009-06-24 09:56:17 |
| 487763d5.pdf Path: Wisconsin >> WILL >> 0104 Fall, 2009 Description: ... Date Added: 2009-06-24 09:56:28 |
| 3b9aec6b.pdf Path: Wisconsin >> WILL >> 0007 Fall, 2009 Description: ... Date Added: 2009-06-24 09:56:48 |
| 3b9aec72.pdf Path: Wisconsin >> WILL >> 0007 Fall, 2009 Description: ... Date Added: 2009-06-24 09:56:56 |
| 3b9aecb0.pdf Path: Wisconsin >> WILL >> 0007 Fall, 2009 Description: ... Date Added: 2009-06-24 09:56:59 |
| 3b9af0d8.pdf Path: Wisconsin >> WILL >> 0007 Fall, 2009 Description: ... Date Added: 2009-06-24 09:57:46 |
| 3b9af065.pdf Path: Wisconsin >> WILL >> 0007 Fall, 2009 Description: ... Date Added: 2009-06-24 09:57:55 |
| 3b9b0daa.pdf Path: Wisconsin >> WILL >> 0026 Fall, 2009 Description: ... Date Added: 2009-06-24 09:58:45 |
| 15fd.pdf Path: Wisconsin >> WILL >> 0057 Fall, 2009 Description: ... Date Added: 2009-06-24 10:00:22 |
| 16db.pdf Path: Wisconsin >> WILL >> 0057 Fall, 2009 Description: ... Date Added: 2009-06-24 10:00:34 |
| 17e4.pdf Path: Wisconsin >> WILL >> 0057 Fall, 2009 Description: ... Date Added: 2009-06-24 10:00:54 |
| 48777b3e.pdf Path: Wisconsin >> WILL >> 0111 Fall, 2009 Description: ... Date Added: 2009-06-24 10:01:43 |
| 387e.pdf Path: Wisconsin >> WILL >> 0067 Fall, 2009 Description: ... Date Added: 2009-06-24 10:04:44 |
| 48771a43.pdf Path: Wisconsin >> WILL >> 0083 Fall, 2009 Description: ... Date Added: 2009-06-24 10:05:08 |
| 48771acc.pdf Path: Wisconsin >> WILL >> 0083 Fall, 2009 Description: ... Date Added: 2009-06-24 10:05:30 |
| 48771c1f.pdf Path: Wisconsin >> WILL >> 0083 Fall, 2009 Description: ... Date Added: 2009-06-24 10:06:26 |
| 3b9ae0aa.pdf Path: Wisconsin >> WILL >> 0017 Fall, 2009 Description: ... Date Added: 2009-06-24 10:07:56 |
| 3b9b2bca.pdf Path: Wisconsin >> WILL >> 0034 Fall, 2009 Description: ... Date Added: 2009-06-24 10:08:04 |
| 3b9b2c20.pdf Path: Wisconsin >> WILL >> 0034 Fall, 2009 Description: ... Date Added: 2009-06-24 10:08:32 |
| 3b9b2d08.pdf Path: Wisconsin >> WILL >> 0034 Fall, 2009 Description: ... Date Added: 2009-06-24 10:09:06 |
| 3b9b2d7c.pdf Path: Wisconsin >> WILL >> 0034 Fall, 2009 Description: ... Date Added: 2009-06-24 10:09:13 |
| 48773d72.pdf Path: Wisconsin >> WILL >> 0093 Fall, 2009 Description: ... Date Added: 2009-06-24 10:09:52 |
| 48776a15.pdf Path: Wisconsin >> WILL >> 0105 Fall, 2009 Description: ... Date Added: 2009-06-24 10:11:18 |
| 3b9ae2a7.pdf Path: Wisconsin >> WILL >> 0018 Fall, 2009 Description: ... Date Added: 2009-06-24 10:12:24 |
| 3b9ae4a4.pdf Path: Wisconsin >> WILL >> 0018 Fall, 2009 Description: ... Date Added: 2009-06-24 10:13:03 |
| 3b9b667b.pdf Path: Wisconsin >> WILL >> 0050 Fall, 2009 Description: ... Date Added: 2009-06-24 10:16:56 |
| 48779dc9.pdf Path: Wisconsin >> WILL >> 0121 Fall, 2009 Description: ... Date Added: 2009-06-24 10:18:13 |
| 1afe.pdf Path: Wisconsin >> WILL >> 0058 Fall, 2009 Description: ... Date Added: 2009-06-24 10:21:13 |
| 1b6e.pdf Path: Wisconsin >> WILL >> 0058 Fall, 2009 Description: ... Date Added: 2009-06-24 10:21:23 |
| 1b79.pdf Path: Wisconsin >> WILL >> 0058 Fall, 2009 Description: ... Date Added: 2009-06-24 10:21:41 |
| 3b9aea22.pdf Path: Wisconsin >> WILL >> 0006 Fall, 2009 Description: ... Date Added: 2009-06-24 10:23:01 |
| 3b9aea69.pdf Path: Wisconsin >> WILL >> 0006 Fall, 2009 Description: ... Date Added: 2009-06-24 10:23:06 |
| 3b9aeeea.pdf Path: Wisconsin >> WILL >> 0021 Fall, 2009 Description: ... Date Added: 2009-06-24 10:24:36 |
| 3b9aef5c.pdf Path: Wisconsin >> WILL >> 0021 Fall, 2009 Description: ... Date Added: 2009-06-24 10:24:47 |
| 34a1.pdf Path: Wisconsin >> WILL >> 0066 Fall, 2009 Description: ... Date Added: 2009-06-24 10:25:25 |
| 487718b6.pdf Path: Wisconsin >> WILL >> 0082 Fall, 2009 Description: ... Date Added: 2009-06-24 10:27:13 |
| 487743aa.pdf Path: Wisconsin >> WILL >> 0094 Fall, 2009 Description: ... Date Added: 2009-06-24 10:29:05 |
| 4877425d.pdf Path: Wisconsin >> WILL >> 0094 Fall, 2009 Description: ... Date Added: 2009-06-24 10:29:41 |
| 3b9afc8c.pdf Path: Wisconsin >> WILL >> 0010 Fall, 2009 Description: ... Date Added: 2009-06-24 10:30:12 |
| 3b9b2f74.pdf Path: Wisconsin >> WILL >> 0035 Fall, 2009 Description: ... Date Added: 2009-06-24 10:31:18 |
| 3b9b32e9.pdf Path: Wisconsin >> WILL >> 0035 Fall, 2009 Description: ... Date Added: 2009-06-24 10:32:31 |
| 3b9b1a82.pdf Path: Wisconsin >> WILL >> 0029 Fall, 2009 Description: ... Date Added: 2009-06-24 10:33:02 |
| 3b9b1ac6.pdf Path: Wisconsin >> WILL >> 0029 Fall, 2009 Description: ... Date Added: 2009-06-24 10:33:12 |
| 3b9b1b42.pdf Path: Wisconsin >> WILL >> 0029 Fall, 2009 Description: ... Date Added: 2009-06-24 10:33:47 |
| 3b9ae4cf.pdf Path: Wisconsin >> WILL >> 0019 Fall, 2009 Description: ... Date Added: 2009-06-24 10:37:28 |
| 3b9ae5c3.pdf Path: Wisconsin >> WILL >> 0019 Fall, 2009 Description: ... Date Added: 2009-06-24 10:37:43 |
| 3b9ae5cf.pdf Path: Wisconsin >> WILL >> 0019 Fall, 2009 Description: ... Date Added: 2009-06-24 10:37:45 |
| 3b9ae504.pdf Path: Wisconsin >> WILL >> 0019 Fall, 2009 Description: ... Date Added: 2009-06-24 10:38:55 |
| 3d9a.pdf Path: Wisconsin >> WILL >> 0069 Fall, 2009 Description: ... Date Added: 2009-06-24 10:39:02 |
| 3e43.pdf Path: Wisconsin >> WILL >> 0069 Fall, 2009 Description: ... Date Added: 2009-06-24 10:39:48 |
| 23b7.pdf Path: Wisconsin >> WILL >> 0061 Fall, 2009 Description: ... Date Added: 2009-06-24 10:42:40 |
| 24b9.pdf Path: Wisconsin >> WILL >> 0061 Fall, 2009 Description: ... Date Added: 2009-06-24 10:43:00 |
| 2367.pdf Path: Wisconsin >> WILL >> 0061 Fall, 2009 Description: ... Date Added: 2009-06-24 10:44:10 |
| 1ccb.pdf Path: Wisconsin >> WILL >> 0059 Fall, 2009 Description: ... Date Added: 2009-06-24 10:45:00 |
| 1da2.pdf Path: Wisconsin >> WILL >> 0059 Fall, 2009 Description: ... Date Added: 2009-06-24 10:45:45 |
| 3b9ad9db.pdf Path: Wisconsin >> WILL >> 0005 Fall, 2009 Description: ... Date Added: 2009-06-24 10:46:08 |
| 3b9ae8fe.pdf Path: Wisconsin >> WILL >> 0020 Fall, 2009 Description: ... Date Added: 2009-06-24 10:47:58 |
| 3b9ae846.pdf Path: Wisconsin >> WILL >> 0020 Fall, 2009 Description: ... Date Added: 2009-06-24 10:48:34 |
| 3b9b52ba.pdf Path: Wisconsin >> WILL >> 0045 Fall, 2009 Description: ... Date Added: 2009-06-24 10:50:45 |
| 3b9b53d1.pdf Path: Wisconsin >> WILL >> 0045 Fall, 2009 Description: ... Date Added: 2009-06-24 10:51:08 |
| 487747f9.pdf Path: Wisconsin >> WILL >> 0095 Fall, 2009 Description: ... Date Added: 2009-06-24 10:54:11 |
| 4877446f.pdf Path: Wisconsin >> WILL >> 0095 Fall, 2009 Description: ... Date Added: 2009-06-24 10:54:17 |
| 3b9afe9c.pdf Path: Wisconsin >> WILL >> 0011 Fall, 2009 Description: ... Date Added: 2009-06-24 10:54:50 |
| 3b9afe40.pdf Path: Wisconsin >> WILL >> 0011 Fall, 2009 Description: ... Date Added: 2009-06-24 10:54:55 |
| 3b9affa1.pdf Path: Wisconsin >> WILL >> 0011 Fall, 2009 Description: ... Date Added: 2009-06-24 10:55:32 |
| 487794c0.pdf Path: Wisconsin >> WILL >> 0118 Fall, 2009 Description: ... Date Added: 2009-06-24 10:56:36 |
| 487714a2.pdf Path: Wisconsin >> WILL >> 0081 Fall, 2009 Description: ... Date Added: 2009-06-24 10:57:24 |
| 487715e0.pdf Path: Wisconsin >> WILL >> 0081 Fall, 2009 Description: ... Date Added: 2009-06-24 10:57:55 |
| 4877125f.pdf Path: Wisconsin >> WILL >> 0081 Fall, 2009 Description: ... Date Added: 2009-06-24 10:58:03 |
| 4877134e.pdf Path: Wisconsin >> WILL >> 0081 Fall, 2009 Description: ... Date Added: 2009-06-24 10:58:14 |
| 3b9b15b8.pdf Path: Wisconsin >> WILL >> 0028 Fall, 2009 Description: ... Date Added: 2009-06-24 10:58:45 |
| 3b9b158f.pdf Path: Wisconsin >> WILL >> 0028 Fall, 2009 Description: ... Date Added: 2009-06-24 10:59:34 |
| 48772f7a.pdf Path: Wisconsin >> WILL >> 0089 Fall, 2009 Description: ... Date Added: 2009-06-24 11:00:16 |
| 48772f27.pdf Path: Wisconsin >> WILL >> 0089 Fall, 2009 Description: ... Date Added: 2009-06-24 11:00:23 |
| 48772f51.pdf Path: Wisconsin >> WILL >> 0089 Fall, 2009 Description: ... Date Added: 2009-06-24 11:00:28 |
| 487731a3.pdf Path: Wisconsin >> WILL >> 0089 Fall, 2009 Description: ... Date Added: 2009-06-24 11:01:15 |
| 4876ef9d.pdf Path: Wisconsin >> WILL >> 0072 Fall, 2009 Description: ... Date Added: 2009-06-24 11:01:39 |
| 4876efe5.pdf Path: Wisconsin >> WILL >> 0072 Fall, 2009 Description: ... Date Added: 2009-06-24 11:02:03 |
| 3b74.pdf Path: Wisconsin >> WILL >> 0068 Fall, 2009 Description: ... Date Added: 2009-06-24 11:05:22 |
| 1a9.pdf Path: Wisconsin >> WILL >> 0052 Fall, 2009 Description: ... Date Added: 2009-06-24 11:05:55 |
| 2d6.pdf Path: Wisconsin >> WILL >> 0052 Fall, 2009 Description: ... Date Added: 2009-06-24 11:06:24 |
| 3d4.pdf Path: Wisconsin >> WILL >> 0052 Fall, 2009 Description: ... Date Added: 2009-06-24 11:06:45 |
| 1f6f.pdf Path: Wisconsin >> WILL >> 0060 Fall, 2009 Description: ... Date Added: 2009-06-24 11:07:35 |
| 22af.pdf Path: Wisconsin >> WILL >> 0060 Fall, 2009 Description: ... Date Added: 2009-06-24 11:08:58 |
| 487783dd.pdf Path: Wisconsin >> WILL >> 0113 Fall, 2009 Description: ... Date Added: 2009-06-24 11:10:32 |
| 4877815f.pdf Path: Wisconsin >> WILL >> 0113 Fall, 2009 Description: ... Date Added: 2009-06-24 11:10:49 |
| 3b9b2a8d.pdf Path: Wisconsin >> WILL >> 0033 Fall, 2009 Description: ... Date Added: 2009-06-24 11:11:46 |
| 3b9b2b32.pdf Path: Wisconsin >> WILL >> 0033 Fall, 2009 Description: ... Date Added: 2009-06-24 11:12:54 |
| 3b9b2b77.pdf Path: Wisconsin >> WILL >> 0033 Fall, 2009 Description: ... Date Added: 2009-06-24 11:13:03 |
| 3b9b4f7d.pdf Path: Wisconsin >> WILL >> 0044 Fall, 2009 Description: ... Date Added: 2009-06-24 11:13:36 |
| 3b9b4f81.pdf Path: Wisconsin >> WILL >> 0044 Fall, 2009 Description: ... Date Added: 2009-06-24 11:13:53 |
| 3b9b4fdd.pdf Path: Wisconsin >> WILL >> 0044 Fall, 2009 Description: ... Date Added: 2009-06-24 11:14:11 |
| 3b9b01c6.pdf Path: Wisconsin >> WILL >> 0012 Fall, 2009 Description: ... Date Added: 2009-06-24 11:15:17 |
| 3b9b01d0.pdf Path: Wisconsin >> WILL >> 0012 Fall, 2009 Description: ... Date Added: 2009-06-24 11:15:19 |
| 3b9b0393.pdf Path: Wisconsin >> WILL >> 0012 Fall, 2009 Description: ... Date Added: 2009-06-24 11:16:20 |
| 3b9b04f1.pdf Path: Wisconsin >> WILL >> 0012 Fall, 2009 Description: ... Date Added: 2009-06-24 11:16:24 |
| 48777a0b.pdf Path: Wisconsin >> WILL >> 0110 Fall, 2009 Description: ... Date Added: 2009-06-24 11:16:43 |
| 487777dc.pdf Path: Wisconsin >> WILL >> 0110 Fall, 2009 Description: ... Date Added: 2009-06-24 11:17:37 |
| 487777f0.pdf Path: Wisconsin >> WILL >> 0110 Fall, 2009 Description: ... Date Added: 2009-06-24 11:17:41 |
| 3b9ad68b.pdf Path: Wisconsin >> WILL >> 0004 Fall, 2009 Description: ... Date Added: 2009-06-24 11:19:16 |
| 3b9af8ee.pdf Path: Wisconsin >> WILL >> 0023 Fall, 2009 Description: ... Date Added: 2009-06-24 11:20:33 |
| 3b9af775.pdf Path: Wisconsin >> WILL >> 0023 Fall, 2009 Description: ... Date Added: 2009-06-24 11:21:25 |
| 5b8.pdf Path: Wisconsin >> WILL >> 0053 Fall, 2009 Description: ... Date Added: 2009-06-24 11:24:59 |
| 8b2.pdf Path: Wisconsin >> WILL >> 0053 Fall, 2009 Description: ... Date Added: 2009-06-24 11:25:58 |
| 4876f3d7.pdf Path: Wisconsin >> WILL >> 0073 Fall, 2009 Description: ... Date Added: 2009-06-24 11:28:20 |
| 4876f4f9.pdf Path: Wisconsin >> WILL >> 0073 Fall, 2009 Description: ... Date Added: 2009-06-24 11:28:48 |
| 3b9b4b6f.pdf Path: Wisconsin >> WILL >> 0043 Fall, 2009 Description: ... Date Added: 2009-06-24 11:29:58 |
| 3b9b4b7f.pdf Path: Wisconsin >> WILL >> 0043 Fall, 2009 Description: ... Date Added: 2009-06-24 11:29:59 |
| 3b9b4bef.pdf Path: Wisconsin >> WILL >> 0043 Fall, 2009 Description: ... Date Added: 2009-06-24 11:30:28 |
| 3b9b4d5a.pdf Path: Wisconsin >> WILL >> 0043 Fall, 2009 Description: ... Date Added: 2009-06-24 11:31:30 |
| 2a72.pdf Path: Wisconsin >> WILL >> 0063 Fall, 2009 Description: ... Date Added: 2009-06-24 11:31:44 |
| 3b9b1edf.pdf Path: Wisconsin >> WILL >> 0030 Fall, 2009 Description: ... Date Added: 2009-06-24 11:34:53 |
| 3b9b1fd0.pdf Path: Wisconsin >> WILL >> 0030 Fall, 2009 Description: ... Date Added: 2009-06-24 11:35:19 |
| 48774ba4.pdf Path: Wisconsin >> WILL >> 0097 Fall, 2009 Description: ... Date Added: 2009-06-24 11:35:53 |
| 3b9b06b5.pdf Path: Wisconsin >> WILL >> 0013 Fall, 2009 Description: ... Date Added: 2009-06-24 11:38:36 |
| 3b9b09af.pdf Path: Wisconsin >> WILL >> 0013 Fall, 2009 Description: ... Date Added: 2009-06-24 11:39:25 |
| 3b9b3c89.pdf Path: Wisconsin >> WILL >> 0038 Fall, 2009 Description: ... Date Added: 2009-06-24 11:41:09 |
| 487727fc.pdf Path: Wisconsin >> WILL >> 0087 Fall, 2009 Description: ... Date Added: 2009-06-24 11:42:21 |
| 487729b6.pdf Path: Wisconsin >> WILL >> 0087 Fall, 2009 Description: ... Date Added: 2009-06-24 11:42:41 |
| 4877273c.pdf Path: Wisconsin >> WILL >> 0087 Fall, 2009 Description: ... Date Added: 2009-06-24 11:42:59 |
| 48777e41.pdf Path: Wisconsin >> WILL >> 0112 Fall, 2009 Description: ... Date Added: 2009-06-24 11:43:22 |
| 48777e55.pdf Path: Wisconsin >> WILL >> 0112 Fall, 2009 Description: ... Date Added: 2009-06-24 11:43:24 |
| 48777eb6.pdf Path: Wisconsin >> WILL >> 0112 Fall, 2009 Description: ... Date Added: 2009-06-24 11:43:38 |
| 48777f29.pdf Path: Wisconsin >> WILL >> 0112 Fall, 2009 Description: ... Date Added: 2009-06-24 11:44:06 |
| 3b9ad2e8.pdf Path: Wisconsin >> WILL >> 0003 Fall, 2009 Description: ... Date Added: 2009-06-24 11:45:25 |
| 132Formulae_M2.pdf Path: SUNY Stony Brook >> PHY >> 132 Fall, 2008 Description: Electric Charge Q [C]: Current: I # dQ/dt I = qnq Avdrift; vdrift $ E Coulomb Force: 1 Q1Q2 ! 1 Force exerted by Q1 on F1 on 2 \' r, \' 8.998 ( 109 Nm 2 /C 2 , % 0 \' 8.85 ( 10!12 C 2 /(Nm 2 ) 2 4% 0 Q2, r12 points from 1 to 2 Electric Field... Date Added: 2009-06-24 11:53:05 |
| test3-pg7.pdf Path: CSU LA >> MATH >> 248 Fall, 2009 Description: 6. [14 points - 7 each] (a) Suppose & tree haa 8 vertices of degree 1, 0 vertices of degree 2, 2 vertices of degree 3, a,nd a,ndno vertices of degreegreater than 4. How many vertices a.rethere of degree4 ? o Le,t 1=g-yc.lices + Lqrce =1, ^A g= g 6{... Date Added: 2009-06-24 11:53:39 |
| WS9.10.pdf Path: SWCCD >> MATH >> 251 Fall, 2009 Description: MATH 251/GRACEY Theorem: The Form of a Convergent Power Series 9.10 n If f is represented by a power series f ( x ) = an ( x - c ) for all x in an open f ( n) ( c ) interval I containing c, then an = and n! f ( c ) f ( n) ( c ) 2 n f ( x ) = f (... Date Added: 2009-06-24 11:54:05 |
| docTemplate.txt Path: Washington University in St. Louis >> CSE >> 573 Fall, 2009 Description: Program B Documentation Last Update: Thu, Apr. 24, 2003 (100PM) 1. Program Status [ State explicitly if your program is bug free or not. If not bug free, list the problem(s). If you have clear conjectures as to the causes of the problems, ... Date Added: 2009-06-24 11:54:44 |
| ch23.pdf Path: Oregon State >> PH >> 203 Spring, 2008 Description: ... Date Added: 2009-06-24 11:56:25 |
| YMR124W.t2k.alpha-logo.pdf Path: UCSC >> YMR >> 124 Fall, 2009 Description: YMR124W.t2k ALPHA 2 1 E H H X XX S H X X D D H H C I B E H BT H B C S B E S E H X X X H X X XXXX H H H B X X X X X X X X X X X H H EE EAB A H H D S S H H H H B E C E H H X X XXXXXXAXXXXXAXXXXXXXXXA X X X H S E A F A EE BB E E ... Date Added: 2009-06-24 11:57:28 |
| phy232_lec0.pdf Path: Tennessee >> PHY >> 232 Fall, 2009 Description: ... Date Added: 2009-06-24 11:57:45 |
| YMR199W.t04.o_sep-logo.pdf Path: UCSC >> YMR >> 199 Fall, 2009 Description: YMR199W.t04 o_sep 3 2 1 DDDDD G BD A XXXXXDXXXX X B 10 20 30 40 D 3 2 1 D DDDDDG G C C C C X X X X X H B D H B H B H D 51 60 70 80 90 G D 3 2 1 G D B H B H B H D H B HH D B I X X X D D G H D D B XXXAXDXDDDBDXBXBXXXDGXXXXCC... Date Added: 2009-06-24 11:57:49 |
| ECE499-s07.pdf Path: George Mason >> BENG >> 401 Fall, 2008 Description: ECE499 Introduction to Bioengineering Spring 2007. Class time: Mondays and Wednesdays, 3-4:15pm. Instructor: Nathalia Peixoto Office hours: open (to be discussed in class) Objective: This course gives an overview of Bioengineering. The sequence of cl... Date Added: 2009-06-24 11:58:11 |
| sums_of_squares_bw.pdf Path: Wisconsin Milwaukee >> MATH >> 275 Fall, 2008 Description: What formula is suggested by these figures? ... Date Added: 2009-06-24 11:58:24 |
| YMR158W-B.t2k.stride-ebghtl-logo.pdf Path: UCSC >> YMR >> 158 Fall, 2009 Description: YMR158W-B.t2k EBGHTL 3 2 1 C C TTTCCX X X E E X X C C E T X E H H H E H H H H E H H H E X X X X X X X X X X X X X X X X X X X X C E EEE E E E EE HHHHHHH H H H X X X H H X X X T H H X X H X H H H T T X X X H X H X HXXX H H H X H ... Date Added: 2009-06-24 11:58:33 |
| ECE1000Sp05_HW5solnp2.pdf Path: Utah >> ECE >> 1000 Fall, 2008 Description: ... Date Added: 2009-06-24 12:03:13 |
| ECE1000_tot_sq_errm.txt Path: Utah >> ECE >> 1000 Fall, 2008 Description: function tot = tot_sq_err(x)% Calculate total squared error between diode model and % measured data.% Requires globally defined arrays:% v_diode = array of measured voltages for data points% i_diode = array of measured currents for data points% Ex... Date Added: 2009-06-24 12:03:18 |
| mhd_example_4_sols.pdf Path: East Los Angeles College >> MATH >> 3456 Fall, 2009 Description: ... Date Added: 2009-06-24 12:06:32 |
| LazyQueue.rtf Path: Eastern Washington University >> CSCD >> 327 Fall, 2009 Description: LazyQueue: JobEntry.java, MinHeap.java , and TestHeap.java JobEntry.java /* * Small class to hold the job information - quite abbreviated! * Both fields (timeRqd and otherInfo) are publicly accessible */ class JobEntry implements Comparable { public ... Date Added: 2009-06-24 12:17:17 |
| syllabus.pdf Path: ASU >> STAT >> 242 Fall, 2009 Description: MAT 242 Syllabus Week 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 Date Mon Jan 19 Wed Jan 21 Mon Jan 26 Wed Jan 28 Mon Feb 2 Wed Feb 4 Mon Feb 9 Wed Feb 11 Mon Feb 16 Wed Feb 18 Mon Feb 23 Wed Feb 25 Mon Mar 1 Wed Mar 3 Mon Mar 8 Wed Mar 10 Mon Mar 15 ... Date Added: 2009-06-24 12:22:51 |
| section07.pdf Path: ASU >> STAT >> 371 Fall, 2009 Description: 7. Convergence Exercise 7.1. Use the Archimedean Principle to prove that 1/n 0. Exercise 7.2. (a) Prove that xn x if and only if every open interval containing x eventually contains xn . (b) Prove that t A if and only if every open interval contai... Date Added: 2009-06-24 12:22:58 |
| definitions.pdf Path: ASU >> STAT >> 371 Fall, 2009 Description: ADVANCED CALCULUS I MAIN DEFINITIONS JOHN QUIGG Sequences A sequence is a function whose domain is N. A sequence (xn ) of real numbers converges to a real number x, written xn x, if for all > 0 there exists k N such that for all n N, if n k then... Date Added: 2009-06-24 12:23:29 |
| project3.pdf Path: Montana >> MATH >> 441 Fall, 2008 Description: PROJECT 3 Math 441 Due: Thursday, Sept. 25 All \"by hand\" calculations require that you show your work. All MATLAB code and output must be turned in. 1. Do problem 1.7.10. (a) Calculate the determinants by hand, and show your work. (b) Do this part by... Date Added: 2009-06-24 12:34:12 |
| HO_15Community.pdf Path: Delta MI >> BIO >> 111 Fall, 2009 Description: Community Interactions Chapter 15 1. Describe a common organisms habitat and niche. 2. What is biological amplification or magnification? Provide an example. 3. Define and provide examples for the following community interactions. Predator/prey Para... Date Added: 2009-06-24 12:46:24 |
| 733Lecture04.pdf Path: National Taiwan University >> EEOBMG >> 733 Fall, 2009 Description: COMPLEMENTATION HETEROGENEITY (II) Locus heterogeneity Disorder is caused by defects which can occur at several different loci Inheritance patterns may differ for different loci Extent of familial or nonfamilial variation in phenotype may be loc... Date Added: 2009-06-24 12:46:46 |
| fcchrom.pdf Path: SUNY Stony Brook >> CHE >> 133 Fall, 2008 Description: START PREPARE CHROMATOGRAPHY PAPER & CHOOSE (BEST) SOLVENT DRAW ORIGIN (PENCIL) PLACE SAMPLES DEVELOP PAPER WITH SOLVENT MEASURE Rf\'S IN EACH SOLVENT UNKNOWN GO ON TO NEXT PART YOUR SAMPLE REPORT RESULTS END ... Date Added: 2009-06-24 12:47:16 |
| l41.pdf Path: SUNY Stony Brook >> CHE >> 322 Fall, 2008 Description: TA Final Exam Review 9:30 11:30 AM Monday May 11 Javits 100 9:30 11:30 AM Tuesday May 12 Javits 100 Final Exam 1:00 AM 1:30 PM Friday May 15 Sports Complex Main Arena (not the gym) From the Course Information Page \"Because organic chemistry is a ... Date Added: 2009-06-24 12:47:25 |
| hw-6-spr09.pdf Path: Maryland >> P >> 115 Fall, 2008 Description: Homework Assignment #6 Physics 115, Section 0201, Spring 2009 Due March 24, 2009 Essay 1 (10 points) In class, we compared temperature as measured with a thermometer with the sensations of hot and cold as measured through the sense of touch. Discuss ... Date Added: 2009-06-24 12:48:09 |
| psy420_lecture6_outline.doc Path: CSU Northridge >> PSY >> 420 Fall, 2009 Description: Outline of Lecture 6 (Chap 8) 1. Hypothesis testing and decision rule In ANOVA H 0 : 1 = 2 H a : 1 2 Decision rule: Reject H0 when F observed F critical value Otherwise, do not reject H0 2. F ratio F= MS A MSbetween = MS S / A MS within = = betwe... Date Added: 2009-06-24 12:55:26 |
| hwsol07.pdf Path: Washington >> AMATH >> 351 Fall, 2008 Description: AMATH 351 Introduction to Dierential Equations and Applications Bernard Deconinck Spring 2004 Homework 7: Solutions The following transforms were derived in class and will be refrenced in the solutions: f (s) F (t) ecs (x c) (x1) esc L [F (t + c... Date Added: 2009-06-24 13:04:52 |
| AcidBaseBalance.pdf Path: Glendale Community College >> COMMON >> 202 Fall, 2009 Description: Acid-Base Balance Chapter 27 Pages 1003-1009 Introduction 1. The pH scale is a measure of H+ concentration. A pH below 7 is acidic, above 7 is alkaline (basic), and a pH of 7 is neutral. 2. The normal pH of blood is 7.35 to 7.45. A. Acidosis is a pH ... Date Added: 2009-06-24 13:05:20 |
| hw13sol.pdf Path: Colorado >> AMATH >> 2360 Fall, 2008 Description: ... Date Added: 2009-06-24 13:08:17 |
| 14.pdf Path: Allan Hancock College >> IMS >> 5042 Fall, 2009 Description: ... Date Added: 2009-06-24 13:09:04 |
| PIC_ISA_Part2.ppt Path: Clark U >> CS >> 140 Fall, 2009 Description: Clark University Computer Science Department CSCI 140 Computer Organization Introduction to PIC Instruction Set Architecture Part 2 - The Hardware ISA - 2 1 Where to Get More Information These slides provide only the basic information you need. T... Date Added: 2009-06-24 13:12:03 |
| YNL043C.t2k.dssp-ebghstl-logo.pdf Path: UCSC >> YNL >> 043 Fall, 2009 Description: YNL043C.t2k EBGHSTL 3 2 1 CC C C S T E X E S C SS C C T C C CTEE S C C EEEE E C C C C TCTECE STH S C S E S C C E CC C E E C S G T G E S S T H H H H X X XSXXXECCXCCCSXXXXCXSXXCXGXHSXCXXXXXXEXSXCCXCXSX X XXX XXXTETS XTTSBX X X X X X X X X X CT C E... Date Added: 2009-06-24 13:15:55 |
| YNL053W.t06.bys-logo.pdf Path: UCSC >> YNL >> 053 Fall, 2009 Description: YNL053W.t06 bys 5 4 3 2 1 EEEE H P P PP H Y G H YYPD X X X XXXXXH X E H P G N X G N LH D G L E G H D T CHNHHHGPPHEHH P G P G H H Y G H N P H E G H Y H G G X X X X X X X X X XXXXXXXXXXXXXXXXXXXXXXXXXXHXYX X X G H PN E X P PP E HPHEP GE DC P H ... Date Added: 2009-06-24 13:17:28 |
| 110-hands-on-15.doc Path: Penn State >> METBD >> 110 Fall, 2009 Description: METBD 110 Hands-On 15 Application of Drag, Trim and Extend Features Why: When designing a part, sometimes it is faster to drag one or more entities to a new location. Trim and extend features are editing tools used to detail 2D sketcher objects. By u... Date Added: 2009-06-24 13:17:57 |
| min10161984.pdf Path: Purdue >> MIN >> 1984 Fall, 2009 Description: F I L E COPY ASSOCIATION OF AMERICAN PESTICIDE CONTROL OFFICIALS, INC. R e p l y To: v OFFICERS L. 0. Nelson President Ralph Pay President Elect Harry K. Rust Secretary Michael Fresvik Treasurer BOARD OF DIRECTORS L. 0 . Nelson Indiana Ralph Pay A... Date Added: 2009-06-24 13:18:40 |
| 52.pdf Path: Vanderbilt >> BSCI >> 275 Fall, 2009 Description: letters to nature 27. Denetclaw W. F. & Ordahl, C. P. The growth of the dermomyotome and formation of early myotome lineages in thoracolumbar somites of chicken embryos. Development 127, 893905 (2000). 28. Dietrich, S., Schubert, F. R., Healy C., Sha... Date Added: 2009-06-24 13:19:49 |
| YKL067W.t2k.dssp-ehl2-logo.pdf Path: UCSC >> YKL >> 067 Fall, 2009 Description: YKL067W.t2k DSSP-EHL2 2 1 CC 1 E C X X X X 10 20 30 40 H 2 1 EH H T E H HHHHH C C C C X X X X X X X H C E C H H C C C H C H C C C C C H C X X X X X X X X X X X X HC CC C H HHHHHHH CCCE X X X X X X X X X X X X X X X X X X X X X X ... Date Added: 2009-06-24 13:26:09 |
| Dfd.doc Path: UMKC >> CS >> 451 Fall, 2009 Description: Data Flow Diagram for Registration Users information Users (patients and facilitator) Verify required information Valid Information Store the information Reject the registration Confirmation email User Accounts Database The required informat... Date Added: 2009-06-24 13:27:18 |
| PRL1999_hyperfinemuon.pdf Path: Oregon State >> PH >> 585 Fall, 2008 Description: VOLUME 82, NUMBER 4 PHYSICAL REVIEW LETTERS 25 JANUARY 1999 High Precision Measurements of the Ground State Hyperne Structure Interval of Muonium and of the Muon Magnetic Moment W. Liu,1 M. G. Boshier,1 S. Dhawan,1 O. van Dyck,2 P. Egan,3 X. Fei,1... Date Added: 2009-06-24 13:31:25 |
| Cody Clarke.doc Path: Penn State >> CWC >> 5023 Winter, 2009 Description: CodyClarke ... Date Added: 2009-06-24 13:33:38 |
| Grinding.pdf Path: AUC Egypt >> MENG >> 439 Fall, 2009 Description: Basic Manufacturing Processes Grinding Pictures are taken from From the book Workshop Processes, Practices & Materials, by Black and the book Manufacturing Engineering and Technology, by Serope Kalpakjian. The most common abrasive materials are Sil... Date Added: 2009-06-24 13:35:34 |
| resume.pdf Path: Penn State >> NSM >> 5032 Fall, 2009 Description: Nicholas McCurdy 701 Tener Hall University Park, PA 16802 http:/www.personal.psu.edu/nsm5032/ E-mail: nsm5032@psu.edu Objective Skills Education Acquire a management position that effectively utilizes the skills I have acquired 6 years of the Ger... Date Added: 2009-06-24 13:40:10 |
| 2009-E3-Solutions.pdf Path: Southern Illinois University, Carbondale >> CE >> 310 Fall, 2008 Description: ... Date Added: 2009-06-24 13:42:37 |
| bio_essay_s09.pdf Path: Boise State >> M >> 301 Fall, 2009 Description: M 301-002 Spring 2009 Due Monday, March 30 This assignment will replace class on Friday, March 20. For this assignment you are to pick a name from the list on p. 478 in our textbook. Then find out some information about this person and write an essay... Date Added: 2009-06-24 13:43:28 |
| sylwd151f2006.pdf Path: Glendale Community College >> CHM >> 151 Fall, 2008 Description: FALL 2006 CHM 151* General Chemistry I 3 credit hours INSTRUCTOR: Dr. Paul Gilletti EMAIL: paul.gilletti@mcmail.maricopa.edu OFFICE: Building 9 PS-105 PHONE: Office 480.461-7685 Web Page: http:/www.mc.maricopa.edu/~gilletti/ (Many of my Powerpoint p... Date Added: 2009-06-24 13:46:50 |
| ClustalWtutorialFall05.pdf Path: Purdue >> SCI >> 190 Fall, 2008 Description: 1 BIOL 495S / CS 490B / MATH 490B / STAT 490B M. Levy (10/7/05): Tutorial on Clustal W Multiple Sequence Alignment and Phylogenetic Tree Reconstruction Readings: After this tutorial begin to read the file on Phylogenetics from the Science Primer at N... Date Added: 2009-06-24 13:47:04 |
| 16_symbol_tables.pdf Path: UVA >> CS >> 101 Fall, 2008 Description: Symbol Table 4.4 Symbol Tables Symbol table. K ey-value pair abstraction. Insert a key with specified value. Given a key, search for the corresponding value. ! ! Ex. [DNS lookup] Insert URL with specified IP address. Given URL, find corresponding ... Date Added: 2009-06-24 13:49:05 |
| final_soln_08.pdf Path: Rochester >> ECE >> 111 Fall, 2009 Description: ... Date Added: 2009-06-24 13:53:34 |
| ece110_lab9.pdf Path: Lake County >> ECE >> 110 Fall, 2009 Description: Laboratory #9 pulse width modulation (revisited) Grade Pre-lab: /0 Lab: /12 Total: /12 Objectives * Learn how PWM module works * Understand how to use PWM in car design * Learn how to use logic analyzer * Learn about sequential circuits * Learn how... Date Added: 2009-06-24 13:55:07 |
| INO_MA_Online_attachment_C.pdf Path: Illinois Springfield >> LNT >> 501 Fall, 2009 Description: Academic Histories beginning: 420048 All INO INO INO INO INO INO INO PAC MGT INO PAD PAC PHI EDL EDL EDL HDC HMS HMS INO MGT PAD PHI TEP TEP ART ART BUS COM COM EDL ENG HMS HMS HMS INO MGT PAD PAD PAD TEP AAS ART AST COM COM COM COM Title Graduate Co... Date Added: 2009-06-24 14:00:31 |
| YGL252C.t2k.alpha-logo.pdf Path: UCSC >> YGL >> 252 Fall, 2009 Description: YGL252C.t2k ALPHA 3 2 1 E B E A S G F BEEHESE A BDIDBE B A SSESA B E G B C B H CT C B TA A G T A X XXXXXXXXXXXXXXXXXDBBBTXXXXBBBBBTTAAEXXXXBCBX X X X XXX XCXX X X C E E B H H B B B H H E B E A B C E E B E G H H A B AEEEEA E A E A T X X D F C ... Date Added: 2009-06-24 14:07:27 |
| Chapter_02_outline.pdf Path: Bethel VA >> CHE >> 231 Fall, 2009 Description: Chapter 2 - Atomic Structure and Interatomic Bonding There are four things to be covered: Basic atomic structure Electron configuration The periodic table Atomic and molecular bonding Chapter 2 (continued) Qualitative Questions 4 Explain the dif... Date Added: 2009-06-24 14:07:45 |
| hw78.pdf Path: Maine >> ECE >> 417 Fall, 2008 Description: ECE 417 - ROBOTICS Homework 7 and 8 Solve the inverse kinematics problem for the Lab-Volt robot. We assume 0T5 is given and we need to compute i. The following method is suggested (use my solution to Homework 6 as a starting point): Homework 7: 1. Wr... Date Added: 2009-06-24 14:08:16 |
| ps5_2008_ans.pdf Path: Maryville MO >> CHM >> 531 Fall, 2009 Description: Chemistry 531 Problem Set 5 Spring 2008 Solutions 1. Problem 3-3, page 64, text. Answer: E= E V = , 1 Ej,N eEj,N N j,N 1 j,N Ej,N V eEj,N N 1 Ej,N j,N Ej,N V N eEj,N N + 1 2 Ej,N eEj,N N j,N j ,N Ej ,N V eEj ,N = p + [ pE ... Date Added: 2009-06-24 14:09:55 |
| T0349.t06.stride-ebghtl-logo.pdf Path: UCSC >> T >> 0349 Fall, 2009 Description: T0349.t06 stride-ebghtl 3 2 1 CHHHH H C T X H H C X XXXXTHTX X X X C T CH H 10 20 30 40 H 3 2 1 X T E T E CHHH TTTG G GXXXXX T E X 51 60 H H 70 HEDDLAGARRLLTDAGLAHELRSDD HHHHHHHHHHHCCC X X X X X X H H TXXGCCXXXT T X X X T G TTH... Date Added: 2009-06-24 14:14:15 |
| T0313.t06.stride-ebghtl-logo.pdf Path: UCSC >> T >> 0313 Fall, 2009 Description: T0313.t06 stride-ebghtl 3 2 1 CEE T E X C X C X X X X 1 10 20 30 40 E 3 2 1 T E T E T E E EC C GHC C T T H E B X X X XXXXX X X 51 60 70 80 90 T 3 2 1 H E T E T TT X CHHH CT G X C T G H X X X X H 3 2 1 T E H T E C... Date Added: 2009-06-24 14:15:17 |
| bennett myth ritual.pdf Path: Kentucky >> JAT >> 520 Fall, 2009 Description: Media Politics Myth, Ritual, and Political Control W Lance Bennett Journal of Communication (pre-1986); Autumn 1980; 30, 4; ABI/INFORM Global pg. 166 Reproduced with permission of the copyright owner. Further reproduction prohibited without permissi... Date Added: 2009-06-24 14:15:33 |
| m118tx.txt Path: East Los Angeles College >> M >> 118 Fall, 2009 Description: 31 93 771 Actual line C:\\My Documents\\Miao\\Concordance\\TextFromClipboard-File8.txt 16/11/2001 16:59:53 Program copyright (c) R.J.C. Watt 1998. All rights reserved. -ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz ABLE 6 13 17 Year this... Date Added: 2009-06-24 14:35:07 |
| samplexam1.pdf Path: Oakland University >> MTH >> 154 Fall, 2008 Description: M ath 1 5 4 S a m p le T e s t 1 - S u m m e r 2 0 0 6 T h i s i s a c lo s e d b o o k t e s t . Y o u m a y u s e y o u r c a lc u la t o r a n d t h e s c r a p p a p e r p r o v i d e d . T o r e c e i v e c r e d i t o n a n y p r o b le m y o u... Date Added: 2009-06-24 14:38:21 |
| PS10.pdf Path: Lake County >> ECE >> 313 Fall, 2009 Description: University of Illinois ECE 413: Problem Set 10 Due: 4/4/07 at the beginning of class Reading: Chapter 5 of the textbook Noncredit Exercises: Chapter 5, Problems 10-19; 21, 22, 24, 31-41 Problems: Spring 2007 Function of a random variable; hazard ra... Date Added: 2009-06-24 14:41:00 |
| Cell_Phone_Abs.pdf Path: Lake County >> ECE >> 317 Fall, 2009 Description: ECE317 Hiral Patel, Michael Bell, Lucian Tira, Bogdan Tira Cell Phone Communication Protocols Since the development of the mobile phone, the industry has been trying to improve the talk time, quality and features of communcation between these portab... Date Added: 2009-06-24 14:41:42 |
| T-Account Chart.doc Path: Ill. Chicago >> ACTG >> 315 Fall, 2008 Description: Problem_ Problem_ ... Date Added: 2009-06-24 14:41:53 |
| solution_4.1.pdf Path: Washington >> AA >> 360 Fall, 2009 Description: ... Date Added: 2009-06-24 14:42:20 |
| slides.pdf Path: Allan Hancock College >> COMP >> 284 Fall, 2009 Description: Chapter 23 Software cost estimation comp284-Software Engineering 1 Objectives 1. To introduce the fundamentals of software costing and pricing 2. To describe three metrics for software productivity assessment 3. To explain why dierent techniques... Date Added: 2009-06-24 14:50:51 |
| Chapter 18.ppt Path: Uni. Westminster >> ATS >> 0417 Fall, 2009 Description: Chapter 18 Liver, Gallbladder, and Pancreas NURS 210 - 2005 Medical Nutrition Therapy for Liver Problems Fatty liver Viral hepatitis Cirrhosis Liver transplantation Fatty Liver Triglyceride build up in the liver Can be reversed if causative ... Date Added: 2009-06-24 14:51:02 |
| 02-Final_Mentee_Application.doc Path: UC Davis >> ATT >> 110 Fall, 2009 Description: Mentorship Program- Mentee Application Applications due December 2 nd, 2008 Name:_ Email_ Life Goal/ Career Goal_ Employed? If so, where & how many hours?_ Year:__ Major:_ Gender:_ Hometown:_ Local Phone Number:_ What Activities are more of your int... Date Added: 2009-06-24 14:53:03 |
| fpga_cpld_tut.pdf Path: Southern Illinois University, Carbondale >> ECE >> 428 Spring, 2008 Description: F I E L D - P R O G R A M M A B L E D E V I C E S FPGA and CPLD Architectures: A Tutorial RECENTLY, the development of new types of sophisticated fieldprogrammable devices (FPDs) has dramatically changed the process of design... Date Added: 2009-06-24 15:05:03 |
| hw1.pdf Path: Southern Illinois University, Carbondale >> ECE >> 428 Spring, 2008 Description: ECE428 Homework 1 Due date: January 28, Wednesday before class 1. The structure of a PAL device is shown below. Program this device to implement the following functions: Z 1 = x y , Z 2 = x y , z 3 = x + y . In your homework, place a dot at the int... Date Added: 2009-06-24 15:05:03 |
| exam2-guide.pdf Path: Bucknell >> CSCI >> 204 Fall, 2008 Description: CSCI 204 Study Guide for Exam Two Prof. Wittie Spring 2007 Exam two will be held in class on Monday April 3rd, 2006 at the lecture time. 1 The Rules You may bring one 8x11 information sheet of paper with anything you like hand-written on it, one ... Date Added: 2009-06-24 15:21:04 |
| TableA.pdf Path: College of Idaho >> M >> 112 Fall, 2009 Description: ... Date Added: 2009-06-24 15:22:28 |
| class20.pdf Path: UVA >> CS >> 150 Fall, 2008 Description: Laziness Laziness Building an interpreter is a fundamental idea in computing. Eval and Apply are mutually recursive. The most complicated parts of meval are the handling of function abstraction (lambda) and function application. The most complica... Date Added: 2009-06-24 15:24:20 |
| LimitGraph.pdf Path: Glendale Community College >> MAT >> 220 Fall, 2008 Description: , : l\'/ , .1,:i / u \' , , , , , i/ , 1, / f Left H and L imit hrnn (x) -7 -4 Limit Limit lst\'<a lim f t(x) lsh continuous aax :al ... Date Added: 2009-06-24 15:25:58 |
| 2009-June.txt Path: Rutgers >> ENR >> 704 Fall, 2009 Description: From tizzano at AESOP.Rutgers.edu Mon Jun 1 12:23:17 2009 From: tizzano at AESOP.Rutgers.edu (Christine Tizzano) Date: Thu Jun 4 10:10:04 2009 Subject: [Enr704_students] FW: Forest Tree Microarray Workshop Message-ID: <D26F682D109A4FB7A070A8B1C944... Date Added: 2009-06-24 15:28:19 |
| CH01.ppt Path: San Diego State >> PEOPLE >> 690 Fall, 2009 Description: Slide Presentation to Accompany Educational Research: Planning, Conducting, and Evaluating Quantitative and Qualitative Approaches by John W. Creswell Prepared by Ron Shope, Grace University Educational Research by John W. Creswell. Copyright 2002 b... Date Added: 2009-06-24 15:28:33 |
| prob1.pdf Path: SUNY Stony Brook >> MAT >> 331 Spring, 2008 Description: MAT331 Exercises, Spring 08 set number 1 NOTE: Each exercise is worth 10 points and can be turned in at any time before its expiration date. Altogether, these will count the same as one project. Many of these problems will require you to use the he... Date Added: 2009-06-24 15:31:04 |
| Syllabus.pdf Path: Rutgers >> CHEM >> 161 Fall, 2009 Description: Syllabus Date Day Lecture Topic Scientific Method Measurement, Sig. Figs Problem solving Mixture vs. substance Conservation of matter Atomic theory of matter Periodic table Molecules and Compounds Ionic vs. molecular Acids and bases Organic compounds... Date Added: 2009-06-24 15:34:53 |
| ExtrasolarPlanets.pdf Path: SUNY Stony Brook >> AST >> 248 Fall, 2008 Description: ExtraSolar Planets Finding Extrasolar Planets. I Direct Searches D ir e c t s e a r c h e s a r e d iffic u lt b e c a u s e s ta r s a r e s o b r ig h t. How Bright are Planets? Planets shine by reflected light. The amount reflected is the amoun... Date Added: 2009-06-24 15:39:09 |
| h5.pdf Path: SUNY Stony Brook >> AST >> 341 Fall, 2008 Description: AST 341 Homework 5 Due Tuesday 2 December 2008 C Ostlie, 2nd edition (the big orange book). 1. Derive the homologous form of the luminosity equation, 2. CO 11.5 4. CO 12.18 6. T Tauri stars co... Date Added: 2009-06-24 15:39:18 |
| Interference.pdf Path: Montclair >> PHYS >> 192 Fall, 2009 Description: Name _ Date _ Partners _ Two-slit Interference (Colors): Lab #13 Background: What is light? There may be no complete answer to this question, but in certain circumstances light behaves as a wave does. We can measure the wavelength of this wave and se... Date Added: 2009-06-24 15:39:51 |
| Leet ch09.pdf Path: Texas El Paso >> CE >> 3343 Fall, 2008 Description: ... Date Added: 2009-06-24 15:44:03 |
| UNAIDS_IP_pr.doc Path: Michigan >> SPP >> 638 Fall, 2009 Description: vti_encoding:SR|utf8-nl vti_timelastmodified:TR|09 Jan 2003 03:08:06 -0000 vti_extenderversion:SR|5.0.2.4330 vti_backlinkinfo:VX|deliverables.htm ... Date Added: 2009-06-24 15:44:53 |
| NSEEcapstone_smeiste.pdf Path: Hamline >> FAS >> 270 Fall, 2009 Description: 1 HOW EARTH JOURNALING EFFECTS STUDENT WRITING IN WORD CHOICE, VOICE AND IDEAS By Sharon Meister A capstone submitted in partial fulfillment of the requirement for the degree of Master of Arts in Education Natural Science and Environmental Educatio... Date Added: 2009-06-24 15:45:38 |
| detune_070114_42723_reconstruction.ps Path: Stanford >> SOI >> 070114 Fall, 2009 Description: %!PS-Adobe-3.0 %BoundingBox: 0 0 425 340 %Title: Graphics produced by IDL %For: couvidat@n12.Stanford.EDU, /auto/scr20/couvidat/HMI %Creator: IDL Version 6.3 (linux x86_64 m64) %CreationDate: Mon Jan 15 19:40:36 2007 %DocumentData: Clean7bit %Require... Date Added: 2009-06-24 15:46:14 |
| 060303_182735_detune27_obs_CENTRALHOLE.ps Path: Stanford >> SOI >> 060303 Fall, 2009 Description: %!PS-Adobe-3.0 %BoundingBox: 0 28 425 651 %Title: Graphics produced by IDL %For: couvidat@stitch.Stanford.EDU, /auto/scr20/couvidat/HMI %Creator: IDL Version 6.1.1 (linux x86 m32) %CreationDate: Fri Mar 3 13:11:47 2006 %DocumentData: Clean7bit %Requi... Date Added: 2009-06-24 15:46:24 |
| 060304_011551_detune27_obs_EDGEHOLE.ps Path: Stanford >> SOI >> 060303 Fall, 2009 Description: %!PS-Adobe-3.0 %BoundingBox: 0 28 425 651 %Title: Graphics produced by IDL %For: couvidat@stitch.Stanford.EDU, /auto/scr20/couvidat/HMI %Creator: IDL Version 6.1.1 (linux x86 m32) %CreationDate: Mon Mar 6 16:11:38 2006 %DocumentData: Clean7bit %Requi... Date Added: 2009-06-24 15:46:27 |
| detune_phases_contrasts_87497_calmode.ps Path: Stanford >> SOI >> 070225 Fall, 2009 Description: %!PS-Adobe-3.0 %BoundingBox: 0 0 566 765 %Title: Graphics produced by IDL %For: couvidat@n12.Stanford.EDU, /auto/scr20/couvidat/HMI %Creator: IDL Version 6.3 (linux x86_64 m64) %CreationDate: Fri Mar 2 15:53:26 2007 %DocumentData: Clean7bit %Requirem... Date Added: 2009-06-24 15:46:42 |
| T0501.dssp-ehl2-logo.pdf Path: UCSC >> T >> 0501 Fall, 2009 Description: T0501 dssp-ehl2 2 1 MLTKVIAQAHIDHFTKWFERADKIVIVSHVSPDGDAIGSSLGLYHFLDSQDKIVNVIVPNAFPDFLKWMPGSKDILLYDRYQEFADKLIMEADVICCLDF 1 10 20 30 40 50 60 70 80 90 EH 2 1 E H E H H H E NALKRIDEMSDIVAASPGRKIMIDHHLYPEDFCRITISHPEISSTSELVFRLICRMGYFSDISKEGAECI... Date Added: 2009-06-24 15:47:14 |
| cs583hmw1.pdf Path: USC >> CS >> 583 Fall, 2009 Description: CS 583 Computational Geometry Fall 2002 Homework #1 Line Segment Intersections Context We have seen in class that a line sweep algorithm can be performed when N segments are given as input and all you need are the intersections that occur. This hom... Date Added: 2009-06-24 15:48:01 |
| lauderdalegraham.pdf Path: National Taiwan University >> HISTORY >> 326 Fall, 2009 Description: ... Date Added: 2009-06-24 15:52:50 |
| sub2.pdf Path: Delta State >> MAT >> 331 Fall, 2009 Description: Subtraction: Comparison Place Value Table using Decomposition and Subtraction from the Base and the Austrian Method The Austrian Method effect s the language that is used while working the problem. Notice the difference in the explanations to the sid... Date Added: 2009-06-24 16:02:37 |
| YJL047C-A.t2k.dssp-ehl2-logo.pdf Path: UCSC >> YJL >> 047 Fall, 2009 Description: YJL047C-A.t2k DSSP-EHL2 2 1 CCEEEEEEEE E X X X X 1 10 20 30 E H H T E T E 40 ECCECCCCCC E HH C CE ECCCCCCCC MK IKI SIEISLSL LSEHYKRNENCISN M L V IG E G PR G E TI V ER F X X X H C C C H H H C C H C C C H H H X X X X X X X X X H X X X X ... Date Added: 2009-06-24 16:03:50 |
| YJL012C-A.t2k.w0.5-logo.pdf Path: UCSC >> YJL >> 012 Fall, 2009 Description: YJL012C-A.t2k w0.5 1 M L L V I I V 1 10 20 30 40 H 1 ILF FFC LV XXXXXXXXXXXXXXX IL SIL FSFFCNLV AK IL L V I V E G T T H L Y I I V V V L S I I V V S A V L L L Y Y I N L V I A K 51 60 50 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX... Date Added: 2009-06-24 16:03:55 |
| YJL065C.t2k.dssp-ehl2-logo.pdf Path: UCSC >> YJL >> 065 Fall, 2009 Description: YJL065C.t2k DSSP-EHL2 2 1 CCC 1 CXXXHHHCCCCCHHXXCCCCCCCCCCXHHHX C C C E X X X X X X H C 10 20 30 40 H 2 1 T H T H HHHHHHHHHHHHHHHH C C C C C X X X X X X X X X X X X X X 51 60 70 80 90 T 2 1 H H HHHH 101 CC H CC HCXX C CCX CCC C ... Date Added: 2009-06-24 16:04:15 |
| li.txt Path: NYU >> JK >> 1786 Fall, 2009 Description: aioli ali alkali argali bali bengali bernoulli bimli botticelli broccoli cali chili chilli cli corelli dali deli denali discocephali disraeli douroucouli elli friuli grappelli holocephali ismaili isospondyli israeli kali kigali kiswahili lazuli li lu... Date Added: 2009-06-24 16:04:47 |
| CS152-Lecture_4.pdf Path: Harvard >> CS >> 152 Fall, 2009 Description: PROGRAMMING LANGUAGES CS 152 David F. Bacon Lecture 4 VECTOR PARALLELISM (HOMOGENEOUS) SIMD addvec Examples: Cray, MMX MULTIPROCESSORS (HETEROGENEOUS) CPU Cache MIMD CPU Cache CPU Cache CPU Cache BUS RAM C ACHE COHERENCE CPU CPU CPU CPU ... Date Added: 2009-06-24 16:05:21 |
| old-mid-sol.pdf Path: Toledo >> STA >> 247 Fall, 2009 Description: STA 247, Fall 2003 Solutions to the Mid-term Test 1. Every year you cook a turkey and a ham for Thanksgiving dinner. You also invite four of your friends over to help eat the turkey and the ham. You have ten friends altogether. Four of your friends ... Date Added: 2009-06-24 16:17:28 |
| Lighting Proposal Memo.pdf Path: Penn State >> KYC >> 5006 Fall, 2009 Description: [LIGHTING PROPOSAL MEMO] Proposed spaces to be redesigned: 1. Building Faade 2. Main Lobby 3. Presidents Office 4. Training Room Kelly Chan 1. Building Faade The building has a more traditional architectural style where the main components are: 1. ... Date Added: 2009-06-24 16:17:37 |
| sh060119_tilt04.ps Path: Wisconsin >> SH >> 060119 Fall, 2009 Description: %!PS-Adobe-3.0 %Creator: MATLAB, The Mathworks, Inc. %Title: sh060119_tilt04213001_215143.ps %CreationDate: 01/29/2007 16:50:26 %DocumentNeededFonts: Helvetica %DocumentProcessColors: Cyan Magenta Yellow Black %LanguageLevel: 2 %Pages: (atend) %Bound... Date Added: 2009-06-24 16:18:33 |
| mp2.ppt Path: Duke >> CPS >> 220 Fall, 2009 Description: vti_encoding:SR|utf8-nl vti_timelastmodified:TR|15 Nov 2001 16:20:19 -0000 vti_extenderversion:SR|4.0.2.3406 vti_cacheddtm:TX|15 Nov 2001 16:20:19 -0000 vti_filesize:IR|171520 vti_cachedlinkinfo:VX| vti_cachedsvcrellinks:VX| vti_cachedtitle:SR|Lectur... Date Added: 2009-06-24 16:21:46 |
| phy211lsylsum06.pdf Path: Kentucky >> PHY >> 211 Fall, 2008 Description: UNIVERSITY OF KENTUCKY DEPARTMENT OF PHYSICS AND ASTRONOMY PHYSICS 211 LABORATORY COURSE SYLLABUS Summer 2006 1. PURPOSE: This document provides detailed information regarding the Physics 211 laboratory course. This laboratory will provide an experim... Date Added: 2009-06-24 16:22:26 |
| 20595-readme.txt Path: UNC >> DOCS >> 20595 Fall, 2009 Description: The Project Gutenberg EBook The Awful German Language by Mark Twain This eBook is for the use of anyone anywhere at no cost and with almost no restrictions whatsoever. You may copy it, give it away or re-use it under the terms of the Project Guten... Date Added: 2009-06-24 16:27:04 |
| chapter 7 class notes.pdf Path: Pima CC >> MAT >> 151 Fall, 2008 Description: Copyright 2004 Pearson Education, Inc. Chapter 7 Further Topics in Algebra Copyright 2004 Pearson Education, Inc. 7.1 Sequences and Series Copyright 2004 Pearson Education, Inc. Sequences A sequence is a function that computes an ordered list... Date Added: 2009-06-24 16:31:49 |
| Syllabus_MAN 3301_Spring 2009.doc Path: UCF >> BUS >> 3301 Fall, 2009 Description: Management 3301: Human Resource Management University of Central Florida College of Business Administration Department of Management Spring 2009 Monday and Wednesday 12:00 PM 1:20 PM (BAI 239) Monday and Wednesday 3:00 PM 4:20 PM (BAI 122) Instruct... Date Added: 2009-06-24 16:31:56 |
| Excel_Section_4_Skills_Review_Activity_3(1).xls Path: Idaho >> MCDO >> 8529 Fall, 2009 Description: The Waterfront Bistro 3104 Rivermist Drive Buffalo, NY 14280 Invoice No. 2463 INVOICE Customer Name Address City Phone Qty 16 16 16 1 First Choice Travel 4277 Yonge Street Toronto 416-555-9834 Lunches Desserts Beverages Delivery and Setup Misc Dat... Date Added: 2009-06-24 16:33:02 |
| hw7.pdf Path: Western Michigan >> MATH >> 1220 Fall, 2008 Description: Math 1220: Honors Calculus Homework #7 Due Tuesday, November 4 Minimum Requirements. The standard for your homework is that another student in this class should be able to read and understand your work. This means that: 1. You must write down the pro... Date Added: 2009-06-24 16:40:42 |
| WWII.ppt Path: Middlebury >> AC >> 023 Fall, 2009 Description: Presentedby: DerekCeceCovers TedKing Advertisements MitchellSt.Peter Articles TheSaturdayEveningPost TheSaturdayEveningPost WorldWarIIEra Propagandathrough Propagandathrough CoversofThePost Presentedby:DerekCece Mother May8,1943 Womanreadi... Date Added: 2009-06-24 16:41:16 |
| Lecture 5 (Jan 19 2007).ppt Path: St. Francis IL >> CHEM >> 255 Fall, 2009 Description: Bioenergetics Go and Keq For the reaction aA + bB = cC + dD G = Go + RT ln [C]c[D]d [A]a[B]b At equilibrium, G = 0 G = - RT ln Keq o Equation expresses relationship between Go and equilibrium constant, Keq Equilibrium constant can be calcula... Date Added: 2009-06-24 16:53:05 |
| Chem 255 SAMPLE QUESTIONS - March 2004.doc Path: St. Francis IL >> CHEM >> 255 Fall, 2009 Description: CHEM255 SAMPLEQUESTIONS 1. Acellhasaninternalglucoseconcentrationof0.5mMandan externalglucoseconcentrationof10mM.Whatisthechemicalpotential difference(G)withregardtoglucosetransportfromoutsidetoinsidethe cellacrossthismembrane(assume298K)? 2. E... Date Added: 2009-06-24 16:53:13 |
| g3_script.doc Path: Missouri State >> ART >> 300 Fall, 2008 Description: TITLE: Its All Connected JRBP PSA WRITERS: Ryan Burrell, Dalton Jones, Rob Rosener, John Schwartz DATE: 6/19/2009 VIDEO SHORT FADE IN 1.MS of a person pouring water from a pitcher into a glass. [2-3 sec] AUDIO SFX (sound of water pouring into glas... Date Added: 2009-06-24 17:05:44 |
| DRT 00Z 19 Apr 2003.xls Path: Colorado >> ATOC >> 1050 Fall, 2008 Description: Del Rio, Texas, sounding at 00Z 19 Apr 2006 -Pressure Level Temperature Dew Point Pressure Temperature Dew millibars C C Level Point millibars C C 1000 967 31.2 18.2 950 31 18 935.1 27.7 17 900 25 16 925 26.6 16.6 850 19 15 903.2 24.6 16.1 800 21 2 8... Date Added: 2009-06-24 17:07:01 |
| YPL102C.t2k.dssp-ehl2-logo.pdf Path: UCSC >> YPL >> 102 Fall, 2009 Description: YPL102C.t2k DSSP-EHL2 2 1 X X X X X CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC H H X X X X X X X X X X X X X X X X X X HHHH H HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH X X X X X X X X X X X X X X H H H H C H H H C C C E C H E E C C C C X X X X X X X X X X X X X HH... Date Added: 2009-06-24 17:07:58 |
| fieldscont.pdf Path: Syracuse >> PHY >> 222 Fall, 2008 Description: III. ELECTROSTATIC FIELDS (CONTINUATION) = s01.03 INTRODUCTION This experiment is a continuation of studies on electrostatic elds discussed in the previous experiment. PURPOSE In the previous experiment we traced equipotential lines for various elec... Date Added: 2009-06-24 17:09:24 |
| ch14.ppt Path: UCSC >> ECON >> 161 Fall, 2008 Description: vti_encoding:SR|utf8-nl vti_timelastmodified:TR|13 Jan 2003 18:19:20 -0000 vti_extenderversion:SR|4.0.2.6513 vti_backlinkinfo:VX|powerpoints.htm vti_cacheddtm:TX|09 Feb 2001 12:18:26 -0000 vti_filesize:IR|862720 vti_cachedlinkinfo:VX| vti_cachedsvcre... Date Added: 2009-06-24 17:25:27 |
| 7304.txt Path: UNC >> DOCS >> 7304 Fall, 2009 Description: Project Gutenberg\'s The Life of Captain Matthew Flinders, by Ernest Scott This eBook is for the use of anyone anywhere at no cost and with almost no restrictions whatsoever. You may copy it, give it away or re-use it under the terms of the Project ... Date Added: 2009-06-24 17:27:23 |
| 5693.txt Path: UNC >> DOCS >> 5693 Fall, 2009 Description: The Project Gutenberg EBook of The Innocents Abroad, Part 6 of 6 by Mark Twain (Samuel Clemens) This eBook is for the use of anyone anywhere at no cost and with almost no restrictions whatsoever. You may copy it, give it away or re-use it under the... Date Added: 2009-06-24 17:27:50 |
| 23419.txt Path: UNC >> DOCS >> 23419 Fall, 2009 Description: The Project Gutenberg EBook of The Return Of The Soul, by Robert S. Hichens This eBook is for the use of anyone anywhere at no cost and with almost no restrictions whatsoever. You may copy it, give it away or re-use it under the terms of the Projec... Date Added: 2009-06-24 17:28:21 |
| 23093.txt Path: UNC >> DOCS >> 23093 Fall, 2009 Description: The Project Gutenberg EBook of Princo Vanc\', by Eleanor Putnam and Arlo Bates This eBook is for the use of anyone anywhere at no cost and with almost no restrictions whatsoever. You may copy it, give it away or re-use it under the terms of the Proj... Date Added: 2009-06-24 17:29:18 |
| rcrcl10.txt Path: UNC >> DOCS >> 2345 Fall, 2009 Description: *The Project Gutenberg Etext of The Adventure of the Red Circle* #18 in our series by Sir Arthur Conan Doyle Copyright laws are changing all over the world, be sure to check the copyright laws for your country before posting these files! Please tak... Date Added: 2009-06-24 17:29:36 |
| busswords.pdf Path: Minnesota >> STAT >> 8061 Fall, 2008 Description: Statistics 8061, Fall 2000 S.Weisberg Some Vocabulary for Generalized Linear Models More details are given in Agresti, Categorical Data Analysis, Chapter 13. Generalized Linear Model A regression model with the following characteristics: 1. The con... Date Added: 2009-06-24 17:30:12 |
| YML133C.t2k.dssp-ehl2-logo.pdf Path: UCSC >> YML >> 133 Fall, 2009 Description: YML133C.t2k DSSP-EHL2 2 1 CC 1 C C C C E H X X X X X X H H H H X 10 20 30 40 T 2 1 E H T E H HH X X E C H H H H CCHXECCCHCEXXCCCCCCCXXXXCCCCCHE C X H H C H X 51 60 70 80 90 T 2 1 E S H T E G T T E C X X X X X X X 101 1... Date Added: 2009-06-24 17:30:43 |
| YML121W.t2k.alpha-logo.pdf Path: UCSC >> YML >> 121 Fall, 2009 Description: YML121W.t2k ALPHA 3 2 1 A E H XXXXXXAX X H S E H E 1 10 20 30 40 HEH 3 2 1 EAE S GSBSH BSBEBE SB E A D C E D F B T C B FE I F C B S GISB G HH I D X X X A XX EEEEEE AAAA B B T T T X X X X B BBFFT I D T BXXXXXX E ATB C ADHS S H... Date Added: 2009-06-24 17:31:15 |
| YML105C.t2k.CB_burial_14_7-logo.pdf Path: UCSC >> YML >> 105 Fall, 2009 Description: YML105C.t2k CB_BURIAL_14_7 3 2 1 AA C X A A A A A AA BBBABABBAABAAABXXBB BBCB C C X E B A B A A C B B A D D B C C B C C C D C C C C C C C D D C D D C C C B D D D D D C C D C D C D D C D D D D D D D C D D D D D D D C D D E D D D D D C D E C F X X X... Date Added: 2009-06-24 17:31:54 |
| Mathlabhours.doc Path: Piedmont >> STAT >> 930 Fall, 2009 Description: Academic Support Math Tutor Lab & More Anthony Baldridge Andrew Mingledorff Mathematics Lab D-301 Anthony Baldridge Tutors: College Algebra Elementary Statistics Math for Teachers Pre-Calculus Calculus I Calculus II General Chemistry I General Chemi... Date Added: 2009-06-24 17:35:28 |
| nfa2.pdf Path: Midwestern State University >> CS >> 452 Fall, 2009 Description: a 2 1 a b 3 b 4 b b a b 5 a 6 b a 7 a 8 2 1 a b 3 b 5 a 6,8 7 b 4 b a b 6,8 2 1 a b 3~4 b 5~7 b a b a b a a b b a b b a ... Date Added: 2009-06-24 17:35:43 |
| fal06sheet04.pdf Path: SUNY Albany >> CSI >> 110 Fall, 2009 Description: I-CSI110 - Introduction to Programming, Worlds and Problems Lab Sheet 04 Thurs. Sept. 14, 2006 Name_ Albany NetID_ Two Partners for this lab. _ _ Turn in your Assignment 1 (snowpeople scene and animation) files using WebCT. Whose netid will you use ... Date Added: 2009-06-24 17:36:06 |
| hw7figp2.ps Path: Iowa State >> STAT >> 557 Fall, 2008 Description: ... Date Added: 2009-06-24 17:38:05 |
| 23943.txt Path: UNC >> DOCS >> 23943 Fall, 2009 Description: The Project Gutenberg eBook, The Chickens of Fowl Farm, by Lena E. Barksdale This eBook is for the use of anyone anywhere at no cost and with almost no restrictions whatsoever. You may copy it, give it away or re-use it under the terms of the Proj... Date Added: 2009-06-24 17:39:29 |
| steinbeck.pdf Path: McPherson >> EN >> 255 Fall, 2009 Description: American iterature L II Student _ G-EN 255 The Chrysanthemums is the opening story in Steinbecks only collection of short fiction, The Long Valley (1938). Despite the fact that he wrote novels and long non-fiction almost exclusively, the Swedish ... Date Added: 2009-06-24 17:46:37 |
| Galanter Why the Haves Come Out Ahead.pdf Path: SMU - Cox School of Business >> PLSC >> 4332 Fall, 2009 Description: ... Date Added: 2009-06-24 17:57:39 |
| method2.txt Path: University of Hawaii - Hilo >> ICS >> 212 Fall, 2009 Description: #include <iostream> using namespace std; class Fraction { int num, den; public: Fraction(int n=0, int d=1) :num(n),den(d){ } friend Fraction operator+ (const Fraction b){ ... Date Added: 2009-06-24 17:57:43 |
| PC1672_ 4.pdf Path: Michigan >> CH >> 332 Fall, 2009 Description: PC1672: 4.3 Tensors http:/theory.ph.man.ac.uk/~mikeb/lecture/pc167/rigidbody/. Home: PC 1672 home page | Up: 4 Rigid-body motion | Weekly plan | Help: Guide to using this document | Next: 4.4 Moment-of-inertia tensor | Previous: 4.2 Rigid bodies | ... Date Added: 2009-06-24 17:58:36 |
| welkey.doc Path: Texas State >> FM >> 4301 Fall, 2008 Description: FM 4301 Internship in Fashion Merchandising Texas State University-San Marcos Department of Family and Consumer Sciences Summer I 2007 Sharon Welkey, Ph. D. 512-245-2444 sw30@txstate.edu FCS Fax: 512-245-3829 Texas State University-San Marcos San Mar... Date Added: 2009-06-24 18:06:22 |
| Seideletal2008.pdf Path: Arizona >> GEOG >> 530 Fall, 2008 Description: Progress ArTICLe Widening of the tropical belt in a changing climate Some of the earliest unequivocal signs of climate change have been the warming of the air and ocean, thawing of land and melting of ice in the Arctic. But recent studies are showin... Date Added: 2009-06-24 18:12:31 |
| graduate_addendum.pdf Path: UCSB >> ENGR >> 191 Fall, 2009 Description: Engineering 191/291E Spring 2008 Take Home Exam Graduate Addendum: All graduate students must complete this addendum as well as the regular classroom project. This addendum will account for 30% of your final exam grade and the regular undergraduate p... Date Added: 2009-06-24 18:13:12 |
| pc_evlist.txt Path: Berkeley >> ASTRO >> 00243690 Fall, 2009 Description: output00243690002_999/sw00243690002xpcw2po_cl.evt output00243690003_999/sw00243690003xpcw2po_cl.evt output00243690004_999/sw00243690004xpcw2po_cl.evt output00243690005_999/sw00243690005xpcw2po_cl.evt output00243690006_999/sw00243690006xpcw2po_cl.evt ... Date Added: 2009-06-24 18:13:30 |
| 6.ps Path: East Los Angeles College >> CS >> 123 Fall, 2009 Description: %!PS-Adobe-2.0 %Creator: dvips(k) 5.86 Copyright 1999 Radical Eye Software %Title: 6.dvi %Pages: 6 %PageOrder: Ascend %BoundingBox: 0 0 596 842 %EndComments %DVIPSWebPage: (www.radicaleye.com) %DVIPSCommandLine: dvips -f 6 %DVIPSParameters: dpi=600, ... Date Added: 2009-06-24 18:14:07 |
| Paper 2 Path: Cornell >> ANTHR >> 1166 Fall, 2008 Description: Balloga, 1 Abram Balloga ANTHR 1166 Paper #1 9/2/2008 Natural Noni & Witchcraft in Brittany Modern medicine often falls short of human expectation both in effectiveness and emotional reassurance. The growing importance of natural alternative healing ... Date Added: 2009-06-25 15:28:30 |
| 7.ppt Path: Carnegie Mellon >> EE >> 525 Fall, 2009 Description: Camera Auto Focus Presentation 7, March 7th, 2007 Team W1: Tom Goff (W11) David Hwang (W12) Kate Killfoile (W13) Greg Look (W14) Design Manager: Bowei Gai Project Goal: Design a low-power, small auto focus chip for a camera or other hand-held device... Date Added: 2009-06-25 18:17:15 |
| css.pdf Path: JMU >> SMAD >> 404 Spring, 2008 Description: Cascading Style Sheets Written by: Steven D. Anderson, Ph.D. Resources WestCIV Complete Style Guide: http:/www.westciv.com/style_master/academy/css_tutorial/index.html Tizag.com: http:/www.tizag.com/cssT Tizag.com CSS Reference: http:/www.tizag.com/... Date Added: 2009-06-25 18:20:15 |
| HD23478.24.preplot.p16.1060.ps Path: Cal Poly Pomona >> A >> 12002 Fall, 2009 Description: ... Date Added: 2009-06-25 18:21:40 |
| HD112999.12.tempplot.ps Path: Cal Poly Pomona >> A >> 12020 Fall, 2009 Description: ... Date Added: 2009-06-25 18:21:48 |
| HD108639.12.tempplot.ps Path: Cal Poly Pomona >> A >> 12013 Fall, 2009 Description: ... Date Added: 2009-06-25 18:21:48 |
| HD114886.bigplot.ps Path: Cal Poly Pomona >> A >> 12018 Fall, 2009 Description: ... Date Added: 2009-06-25 18:21:57 |
| M220-answers-fa01.pdf Path: Penn State >> MATH >> 220 Spring, 2008 Description: ... Date Added: 2009-06-25 18:28:15 |
| Rubric- final.doc Path: N. Georgia >> KAPHIL >> 8284 Fall, 2009 Description: Ms. Phillips World History Class Digital Media Research Project Rubric Student Name: _ Topic: _ Date: _ Research Process: Gathered information from journals, books, CD-ROMs, and the Internet Resources are current and reliable Extracted, synthesiz... Date Added: 2009-06-25 18:31:06 |
| ch8_organism_interactions.pdf Path: CSU San Marcos >> BIOL >> 296 Fall, 2009 Description: Organism responses to landscapes A continuum of patchiness Patchiness can be relatively mild (patchy habitat, but with free exchange among patches) to extreme (isolated patches with little or no exchange between patches) Continuous variation is rel... Date Added: 2009-06-25 18:34:01 |
| hoend10a.txt Path: UNC >> DOCS >> 2946 Fall, 2009 Description: *The Project Gutenberg Etext of Howards End, by E. M. Forster* #4 in our series by E. M. Forster Copyright laws are changing all over the world, be sure to check the laws for your country before redistributing these files! Please take a look at the... Date Added: 2009-06-25 18:36:00 |
| jcrom10.txt Path: UNC >> DOCS >> 2978 Fall, 2009 Description: *The Project Gutenberg Etext of Rome, by Jacques Casanova* #28 in our series by Jacques Casanova Copyright laws are changing all over the world, be sure to check the laws for your country before redistributing these files! Please take a look at the... Date Added: 2009-06-25 18:36:13 |
| ntsAideMem2.pdf Path: NSULA >> H >> 100 Fall, 2009 Description: Dnitions 1:(cette dnition vient remplacer la dnitions dinjectivit de la page e e e e 120 des notes dans le cas o` la relation tudie est une application.) u e e Etant donne une application f : B C , alors e f est injective (b, b : B |f (b) = f (b )... Date Added: 2009-06-25 18:45:34 |
| MarketingPlan.pdf Path: Cornell >> LECTURE >> 346 Fall, 2009 Description: Developing a Marketing Plan Mark Stephenson, Ph.D. A Well Written Marketing Plan Accomplishes Three Overall Objectives 1. Instills discipline into a normally emotionally driven decision Provides a means to evaluate, benchmark, and learn the scienc... Date Added: 2009-06-25 18:45:55 |
| PS310.GROUP.FIVE.doc Path: CSU Northridge >> GROUP >> 008 Fall, 2009 Description: PS310 :Assignment to be done in groups on Tuesday Feb 17 and turned in on Thursday, Feb 19. on Balaam and Veseth The IPE of International Finance: Mad Money pp57-75 in Xeroxed reader. PLUS OTHER READING BELOW Signature: GROUP FIVE Hovhannisyan,Asatur... Date Added: 2009-06-25 18:47:33 |
| p22_15.pdf Path: St. Michael >> CH >> 212 Fall, 2009 Description: 15. (a) A force diagram for one of the balls is shown below. The force of gravity mg acts downward, the electrical force Fe of the other ball acts to the left, and the tension in the thread acts along the thread, at the angle to the vertical. The ba... Date Added: 2009-06-25 18:47:44 |
| Duct Design.pdf Path: FIU >> EML >> 4603 Fall, 2008 Description: DUCT Duct System Sizing Program Purpose The purpose of DUCT is to compute sizes for supply or return air duct systems and to determine the pressure / flow requirements for the fan. The program is limited to round ducts except rectangular to round tr... Date Added: 2009-06-25 18:51:05 |
| PR+Resume.pdf Path: LSU >> APPL >> 015 Fall, 2009 Description: Sample Rsum - Public Relations 2255781548 career@lsu.edu www.lsu.edu/career MIKE THOMAS TIGER 1515 Hometown Road/Baton Rouge, La. 70808 225-555-7575 mtiger1@lsu.edu OBJECTIVE EDUCATION The Event Planning and Marketing Coordinator position with ... Date Added: 2009-06-25 18:52:22 |
| 2007 ESS 439 LAB 7.pdf Path: Washington >> ESS >> 439 Fall, 2008 Description: Earth and Space Sciences 439 LAB 7: MAFIC VOLCANIC ROCKS This week\'s lab introduces mafic volcanics - predominantly basalts - from a variety of tectonic settings. Basalts (volcanic rocks composed primarily of plagioclase and clinopyroxene) may be sub... Date Added: 2009-06-25 18:55:08 |
| AtlanticZonalSection.pdf Path: Rutgers >> MS >> 451 Fall, 2004 Description: ... Date Added: 2009-06-25 18:55:48 |
| Lecture06.ppt Path: Eckerd >> CS >> 110 Fall, 2009 Description: CS110 Lecture 06 Today\'s lecture: Computer Hardware (Also: Review Gates and Circuits) [Next time: First Java Programming Lab] 6- 1 Chapter 5 Computing Components Modifications by H. Mauch, Spring 2009 Chapter Goals Read an ad for a computer an... Date Added: 2009-06-25 18:57:23 |
| arf_pc.txt Path: Berkeley >> ASTRO >> 00173780 Fall, 2009 Description: ;instrument XRT ;exposure 407443.98 ;xunit kev ;bintype counts 0.0000000 0.0049999999 13.982557 1.00000 0.0049999999 0.0099999998 14.032430 1.00000 0.0099999998 0.015000000 14.082301 1.0... Date Added: 2009-06-25 19:00:00 |
| note1.pdf Path: Allan Hancock College >> CS >> 9315 Fall, 2009 Description: 5. External Sorting Xuemin Lin COMP9315: Database Systems Implementation 1 Why Sort? y y A classic problem in computer science! Data requested in sorted order e.g., find students in increasing gpa order y y y y Sorting is first step in bulk ... Date Added: 2009-06-25 19:03:27 |
| phys1169_midsession2004.pdf Path: Allan Hancock College >> PHYS >> 1169 Fall, 2009 Description: PHYS 1169 Midsession test 2004 Question 1 (8 marks) Consider three vectors: A = 3i - j + 2k B = i + j + 2k C = 4i + j Where i, j, and k are unit vectors along x, y and z coordinates. Showing all your reasoning, calculate (i) (ii) (iii) the scalar pro... Date Added: 2009-06-25 19:07:02 |
| example.pdf Path: Delaware >> CIS >> 475 Fall, 2009 Description: Software Engineering for Idiots Stephen F. Siegel Feb 18, 2008 Contents 1 The First Reason I Did It 2 The Second Reason I Did It 2.1 Could I be listening to Beethoven symphonies? . . . . . . . . . . . . . . . . 2.2 Could I be watching TV? . . . . . ... Date Added: 2009-06-25 19:07:32 |
| wheat.xls Path: Montana >> AGEC >> 421 Spring, 2008 Description: Year 1970 1971 1972 1973 1974 1975 1976 1977 1978 1979 1980 1981 1982 1983 1984 1985 1986 1987 1988 1989 1990 1991 1992 1993 1994 1995 1996 1997 1998 1999 2000 2001 2002 2003 2004 2005 2006 2007 U.S. All Wheat Price 1.32 1.36 1.91 4.04 3.85 3.41 2.5... Date Added: 2009-06-25 19:09:17 |
| résumés pour suivi du 3 novembre 2008.pdf Path: Université du Québec à Montréal >> R >> 17165 Fall, 2009 Description: ACTIONS CONCERTES PORTANT SUR LA PERSVRANCE ET LA RUSSITE SCOLAIRES RENCONTRE DU COMIT DE SUIVI DU 3 NOVEMBRE 2008 Rsums de projets de recherche financs Examen des mcanismes en jeu dans la dcision des intervenants scolaires dutiliser les connaissa... Date Added: 2009-06-25 19:09:51 |
| cpsc608requirements.ppt Path: Texas A&M >> CPSC >> 608 Fall, 2008 Description: To allow people to be provided by information and their surroundings by the room they are in Potential Scenarios Campus: Classrooms Offices Mall Stores Offices Directory and Map services Ideal Setup Device Graphical and Textual Display, ... Date Added: 2009-06-25 19:10:41 |
| 000089_1.pdf Path: Pittsburgh >> AEI >> 3994 Fall, 2009 Description: ... Date Added: 2009-06-25 19:11:45 |
| hardware.pdf Path: Allan Hancock College >> COMP >> 4610 Fall, 2009 Description: Textures Depth buffer Cache Vertex Fragment CPU OpenGL State RAM Software implementation Frame buffer System bus Software T & L, hardware raster RAM Frame buffer Textures Depth buffer CPU Fragment OpenGL state Cache Vertex OpenGL State AGP bu... Date Added: 2009-06-25 19:12:38 |
| ugur-m-05a.pdf Path: Pittsburgh >> AEI >> 8053 Fall, 2009 Description: Liberalisation of Network Industries in the European Union: Evidence on Market Integration and Performance* Abstract In the last decade or so, the EU has adopted a number of legislation aimed at liberalising network industries and developing an EU-l... Date Added: 2009-06-25 19:14:21 |
| syllabus - Empirical Corporate Finance - Spring 2007.pdf Path: Dallas >> AXB >> 056000 Fall, 2009 Description: Fin 7310 Empirical Corporate FinanceSpring 2007 Dr. Alexander W. Butler Class Time: Office: E-mail: Office Hours: Web page: Mondays 2:30pm-5:15pm (in SOM 2.801) SOM 3.229 butler@utdallas.edu (the best way to contact me; I check e-mail continually) Op... Date Added: 2009-06-25 19:24:17 |
| math122h5s.pdf Path: Rutgers >> MATH >> 523 Fall, 2009 Description: ... Date Added: 2009-06-25 19:33:54 |
| mms244_resume.pdf Path: Penn State >> MMS >> 244 Fall, 2009 Description: Michael Morgan Sparr Address upon request mms244@psu.edu OBJECTIVE: EDUCATION: To represent America within the Federal Government, focusing on Middle Eastern affairs and development. The Pennsylvania State University B.S. in International Politics Mi... Date Added: 2009-06-25 19:35:27 |
| MCAnswers_461.doc Path: MN State >> CM >> 461 Fall, 2009 Description: Answers to Multiple-Choice Questions Answers to Multiple-Choice Questions 8-11 8-12 8-13 8-14 8-15 C A A C A 8-16 8-17 8-18 8-19 8-20 B B D D C 9-11 9-12 9-13 9-14 9-15 D D B A C 9-16 9-17 9-18 9-19 9-20 B A A C C 10-12 10-13 10-14 10-15 10-16 1... Date Added: 2009-06-25 19:38:33 |
| Wear and Lin_ Content analysis on the Web.pdf Path: Sveriges lantbruksuniversitet >> CMNS >> 801 Fall, 2009 Description: Social Science Computer Review http:/ssc.sagepub.com Content Analysis of the World Wide Web: Opportunities and Challenges Christopher Weare and Wan-Ying Lin Social Science Computer Review 2000; 18; 272 The online version of this article can be found... Date Added: 2009-06-25 19:39:13 |
| Chapter4Notes Path: Austin Community College >> SOCI >> 1301 Summer, 2009 Description: Chapter 4 Notes Society -Society refers to people who interact in a dfined territory and share a culture. Gerhard Lenski: Society and Technology -Sociocultural evolution changes that occur as a society gains new technology. Five types of societies ... Date Added: 2009-06-25 19:40:15 |
| agenaapfco080387.pdf Path: Purdue >> MIN >> 1987 Fall, 2009 Description: ... Date Added: 2009-06-25 19:40:37 |
| lec14 Ch13 concurrency 081406.pdf Path: Western Michigan >> CS >> 4850 Fall, 2008 Description: Chapter 13 Topics Introduction Introduction to Subprogram-Level Concurrency Semaphores Monitors Message Passing Java Threads C# Threads Statement-Level Concurrency 13-1 Copyright 2006 Pearson Addison-Wesley. All rights reserved. Introducti... Date Added: 2009-06-25 19:41:44 |
| Web-based Lesson Plan.doc Path: N. Georgia >> ACBARR >> 7333 Fall, 2009 Description: Web-Based Lesson Plan Lesson Plan Title: Developed by: Subject Area: Grade Level: Purpose of the Activity: Discovering Places Ms. Amanda Barrett World Geography 9th Grade The purpose of the activity is to have the students research a country and be a... Date Added: 2009-06-25 19:44:27 |
| as08.pdf Path: USC >> PHYS >> 516 Spring, 2008 Description: PHYS516 ASSIGNMENT 8QUANTUM MONTE CARLO SIMULATION Due: Friday, April 24, 2009 1. Write a program that performs diffusion quantum Monte Carlo simulation of a onedimensional electron wave function in a harmonic potential, V(x) = x2/2 (in the atomic un... Date Added: 2009-06-25 19:49:00 |
| feb21.ppt Path: University of Iowa >> TA >> 016 Fall, 2009 Description: Outline Object-oriented programming Objects and classes, examples Object-Oriented Programming (OOP) A programming technique based on objects. Advantages: Good at modeling real-world objects you find in everyday life. Speedy development, high ... Date Added: 2009-06-25 19:49:58 |
| content.ps Path: East Los Angeles College >> CS >> 710 Fall, 2009 Description: %!PS (but not EPSF; comments have been disabled) %DVIPSCommandLine: dvips -K -p 1 -l 5 -N -h 2up-a4.ps -t landscape %+ report.dvi %DVIPSParameters: dpi=300, comments removed %DVIPSSource: TeX output 1996.06.24:1655 % twoup.ps for dvips 5.47 by Piet v... Date Added: 2009-06-25 19:50:12 |
| hwSolution_4.4.pdf Path: Los Angeles Southwest College >> MATH >> 122 Fall, 2009 Description: O tM Honvro*, puBt-eus @ , o,olt- t.r{t+r\\ t\\R t4u) = b [t (t) = Mk(l/) - ttce) - zo ncQ) = (0,03,tr2-t,qtr *s+) >o = -a BV?t t+p -4 eo (tr) ttp(m) (0,o4,2*+0,+).:s- 4 _- ll.a5 (* {a,z^g tu fer% s/\'... Date Added: 2009-06-25 19:57:50 |
| BoxCox_000.txt Path: Winona >> COURSE >> 305 Fall, 2009 Description: #* # # Macro: BCtrans.MAC # Version: Release 14 # Final Date: 04/02/04 # Authors: Steven Orlich and Mike Delozier # Minitab Inc. # Quality Plaza # 1829 Pi... Date Added: 2009-06-25 20:05:06 |
| Gropp C2.ppt Path: Winthrop >> CSCI >> 470 Fall, 2009 Description: MPIChapter2 IntroductiontoMPICommand BasicsSendandReceive MPIisamessagepassingenvironment. Theprocessorsmethodofsharing informationisNOTviasharedmemory, butbyprocessorssendingmessagesto eachother Thisisdoneviaasendreceivepairing. Theoriginatingpro... Date Added: 2009-06-25 20:05:59 |
| IDS module 4.doc Path: Academy of Art >> IDS >> 480 Fall, 2009 Description: Branding Introduction Inthismodule,youwilllearnaboutbrandingandaboutcreatinganidentitysystemforyourselfto beusedasaninitialintroductiontopotentialemployers.Wewillexaminethecomponentsofan integratedcommunicationsystemandthedifferencebetweenusingalogov... Date Added: 2009-06-25 20:09:15 |
| DWsetup.pdf Path: Laurentian >> NMED >> 2020 Fall, 2009 Description: Untitled Document file:/D|/L%20Dreamweaver/fa2020/Web/index.htm [2/5/2003 5:39:09 PM] Untitled Document You need to uncheck this box to see the extensions you will need Back file:/D|/L%20Dreamweaver/fa2020/Web/files.htm [2/5/2003 5:39:14 PM] Unt... Date Added: 2009-06-25 20:09:19 |
| wessels.pdf Path: Washington >> MICRO >> 553 Fall, 2009 Description: ... Date Added: 2009-06-25 20:09:39 |
| Time Studies.xls Path: St. Johns >> BBROD >> 106 Fall, 2009 Description: Time Studies Avg Actual Time 3 9 2 * * 1 2 4 5 11 3 1 9.5 2.2 1.5 1.20 1.05 1.10 Element Type Letter Type Envelope Sort Envelopes Cycle Time (in minutes) 1 2 8 2 2 10 3 1 Perf Rating Normal Time= 15.36 minutes Allowance Factor is given as 15% Sta... Date Added: 2009-06-25 20:14:15 |
| 44st.pdf Path: Princeton >> COS >> 126 Fall, 2008 Description: S y m b o l T a b le 4 .4 S y m b o l T a b le s Symbol table. Key-value pair abstraction. Insert a key with specified value. Given a key, search for the corresponding value. ! ! Ex. [DNS lookup] Insert URL with specified IP address. Given URL, fi... Date Added: 2009-06-25 20:15:54 |
| final05.pdf Path: Rutgers >> MAE >> 388 Fall, 2009 Description: 14:650:388 CAD in ME Final Exam Deadline: 12/18/06, 11:59pm Objective: Comprehensive exam on part modeling, assembly and animation. Instructions: Work on your own to create nine parts (bolt[1-4],base, axle, top, arm[1-2]); assemble them using app... Date Added: 2009-06-25 20:16:25 |
| review.pdf Path: Rutgers >> MAE >> 388 Fall, 2009 Description: Example 1: Example 2: Example 3: Example 4: Example 5: ... Date Added: 2009-06-25 20:16:31 |
| week8.ppt Path: Allan Hancock College >> COMP >> 2070 Fall, 2009 Description: 1 C O MP 5 1 1 6 Semester 1, 2009 Lecture 8 Auto-configuration and Boot Protocols, VPNs and NATs The University of Sydney 2 Comer Readings Chapter 22 BOOTP/DHCP Chapter 19 19.1 19.11 VPNs and NATs The University of Sydney 3 Overview ... Date Added: 2009-06-25 20:16:50 |
| 1996exam.doc Path: Allan Hancock College >> PSB >> 317 Fall, 2009 Description: PSB317 - LAND ADMINISTRATION 3 - boundary reinstatement principles FRIDAY, 30 AUGUST 1996 Examination time is one hour. Students should attempt all questions for a total of 64 marks. GROUP 1 - (a total of 12 marks) 1 mark 1 Indicate briefly why cadas... Date Added: 2009-06-25 20:16:57 |
| fig6.27.doc Path: Old Dominion >> CS >> 270 Fall, 2008 Description: ... Date Added: 2009-06-25 20:19:25 |
| CE340_SU2009.pdf Path: Penn State >> CUC >> 176 Fall, 2009 Description: The Pennsylvania State University CE 340 Structural Analysis Summer Semester 2009 MTRF 9:35AM 10:50AM, 173 Willard Prerequisite: E MCH 213 Textbook: Structural Analysis, 7th Ed., R.C. Hibbeler References: Fundamentals of Structural Analysis, 2nd Ed... Date Added: 2009-06-25 20:23:09 |
| geosimulation_ch3.pdf Path: CUNY Baruch >> GEOG >> 383 Fall, 2009 Description: ... Date Added: 2009-06-25 20:23:35 |
| matlabc2.pdf Path: Cal Poly >> MA >> 2132 Fall, 2009 Description: MA 2132 Matlab 2 If you have the second edition of the Matlab Manual, then read Chapter 9 and 10 before starting these problems. If you have the third edition of the Matlab Manual, then read Chapter 11 and 12 before starting these problems. (1) Fin... Date Added: 2009-06-25 20:32:30 |
| MY_LIFE_powerpoint.ppt Path: UF >> EME >> 4401 Fall, 2008 Description: MYLIFE By:KristenHoepfner Background IwasbornSeptember25,1987 IgrewupinWeston,FL(asuburbofFt. Lauderdale)butmyfamilynowlivesin Columbus,OH. InfiveyearshopefullyIwillbeteaching overseasforafewyearsthencoming backtoteachhighschoolSpecialEdin innerc... Date Added: 2009-06-25 20:34:03 |
| index.txt Path: Berkeley >> ASTRO >> 00213486 Fall, 2009 Description: 13.800003 176.96400 6.5970730 -0.51378087 161.77657 176.96400 197.35400 -43.290998 9.1219251 70.209763 197.35400 217.89801 47.515620 -8.0587132 33.312168 ... Date Added: 2009-06-25 20:34:08 |
| g312-syl.doc Path: Maryland >> GEOG >> 312 Fall, 2008 Description: Syllabus April 13, 2009 GEOGRAPHY 312 (Old 320) CANADA, The UNITED STATES, And ADJACENT AREAS MW 9:00 A.M. - 11:50 A.M. (Lefrak Hall 2166) I. Introduction course: A. What I hope you will take away from this An introduction to the physical geography ... Date Added: 2009-06-25 20:34:52 |
| 68571_1.pdf Path: Pittsburgh >> AEI >> 10038 Fall, 2009 Description: ... Date Added: 2009-06-25 20:41:32 |
| margulis.1974.gaia.pdf Path: Concordia Chicago >> GEOSCI >> 238 Fall, 2008 Description: ... Date Added: 2009-06-25 20:51:31 |
| archer.1997.fossil_neut.pdf Path: Concordia Chicago >> GEOSCI >> 234 Fall, 2009 Description: ... Date Added: 2009-06-25 20:51:35 |
| Thesis Proposal Powis_Jeremy.pdf Path: Penn State >> JRP >> 272 Fall, 2009 Description: THESISPROPOSAL COMPLETEPROPOSAL 329INNOVATIONBOULEVARD STATECOLLEGE,PA JEREMYR.POWIS STRUCTURALOPTION ADVISOR:PROFESSORM.KEVINPARFITT DECEMBER17TH,2007 THESISPROPOSAL EXECUTIVESUMMARY 329 Innovation Boulevard is a completed... Date Added: 2009-06-25 20:53:26 |
| SolutionSp09Ch1.docx Path: Towson >> PAGES >> 600 Fall, 2009 Description: Solutions of COSC600 HW1 Ch.1 1.5 static int ones( int n ) { if( n < 2 ) return n; return n % 2 + ones( n / 2 ); } 1.7 1.8 1.10 1.12 ... Date Added: 2009-06-25 20:54:21 |
| 320 -- Chapter 5 (Study Problems).doc Path: CSU Fullerton >> FIN >> 320 Fall, 2009 Description: Study Problem 5-1 a. Keystrokes 2nd P/Y 1 ENTER CE/C CE/C 2nd CLR TVM 5000 +/- PV 10 N 10 I/Y CPT FV Display P/Y = 1.00 P/Y = 1.00 0.00 0.00 PV = - 5,000.00 N = 10.00 I/Y = 10.00 FV = 12,968.71 Comments Sets number of payments per year at 1 Clears di... Date Added: 2009-06-25 20:55:30 |
| CommonDialog.ppt Path: IUPUI >> CPT >> 388 Fall, 2009 Description: Adding Common Dialog Control s s Not on standard Toolbox To add this custom control, select Components from Project menu 1999, by Que Education and Training, Appendix A, pages 769-776 of Introduction to Computer Programming with Visual Basic 6: A... Date Added: 2009-06-25 20:57:07 |
| realplayer directions.ppt Path: Kennesaw >> ONLINE >> 1101 Fall, 2009 Description: UsingRealPlayer Dragsliderleftand righttofastforward orrewind Volumecontrol Timerfollowsprogress ofprogram ... Date Added: 2009-06-25 21:14:07 |
| hw2sol.pdf Path: Case Western >> ENGR >> 210 Fall, 2009 Description: Homework Solutions 2 (2-14) In figure P2-13, v1 = -8V, v4 = 8V, and v6 = 6V. Find the other element voltages. To solve this problem the basic concept of the KVL loop must be used, consider each loop of devices add together to equal zero as KVL state... Date Added: 2009-06-25 21:21:28 |
| PQ Test3.doc Path: UF >> STA >> 3024 Summer, 2008 Description: STA 3024 EXAM 3 Practice Problems Summer A 2009 NOTE: These are just Practice Problems. This is NOT meant to look just like the test, and it is NOT the only thing that you should study. Make sure you know all the material from the notes, quizzes, ... Date Added: 2009-06-25 21:32:10 |
| PolynomialProductProblems.pdf Path: San Jose State >> MS >> 100 Fall, 2008 Description: Worksheet #10Polynomial Product Problems E. White Fall 2004 Multiply out each of the following and simplify. (1) x (x + 1) (4) (x 3) (x + 4) (7) (x 5) (x + 3) (10) (x 3) (x 3) (13) (y 3) (y 2) (16) (x 2 y ) 2 (2) 2 x (x 3) (5) (x 6) (x + 2)... Date Added: 2009-06-25 21:32:59 |
| 0300-bedacht-arecomsready.pdf Path: Allan Hancock College >> USA >> 1923 Fall, 2009 Description: Bedacht: Are the Communists Ready? [March 1923] 1 Are the Communists Ready? by Max Bedacht Published in The Liberator, v. 6, no. 3, whole no. 59 (March 1923), pp. 8-10. November 1917 to March 1923 - five years of struggle, five years of suffering,... Date Added: 2009-06-25 21:33:04 |
| HW_8.pdf Path: Cincinnati >> ENFD >> 382 Fall, 2008 Description: BASIC THERMODYNAMICS SPRING 2006 HOMEWORK ASSIGNMENT NO. 8 Notes 1. Due by Wednesday, May 24, 2 PM. 2. You can turn your work in to me or to the TA. Hand delivery, fax (556-3773) or email to the TA is acceptable. See the syllabus for TAs contact in... Date Added: 2009-06-25 21:43:38 |
| rocc.doc Path: Dickinson State >> CS >> 766 Fall, 2009 Description: A New Method for Concurrency Control in Centralized Database Systems Victor T.S. Shi and William Perrizo Computer Science, North Dakota State University Fargo, ND 58105, USA Abstract The Internet has been growing so fast that the number of users acce... Date Added: 2009-06-25 21:45:13 |
| quiz8.doc Path: CSU San Marcos >> PS >> 100 Fall, 2009 Description: PSCI 100 Spring 1997 Dr. Nichols QUIZ #8 Both the Dye/Zeigler and Harrigan texts address the question of how much difference exists between the Republican and Democratic parties - but they reach opposite conclusions! State the conclusion of either te... Date Added: 2009-06-25 21:48:53 |
| PRS0311.pdf Path: UMass (Amherst) >> CH >> 112 Fall, 2009 Description: A) For nitruos acid, HNO2, Ka = 4.5 10-4. What is the equilibrium constant for the following reaction? NO2- + 1) 2.2 10-11 2) 2.2 10-3 3) 2.2 10 3 4) 4.5 10-10 5) None of the above Answer: We have Ka, so we write the equation for Ka. HNO2 + H2O NO2-... Date Added: 2009-06-25 21:49:23 |
| webquestrubric.doc Path: S.E. Louisiana >> ETEC >> 645 Fall, 2008 Description: Name_ Date_ WebQuest 010points answered2 questions AmericanHeroWebQuestRubric Pointsearned 1120points answered4 questions 5pointsfound1 otherfact 1125points sections 34pointshada littleofcolorand wasneat 5pointsalways cooperated 5pointsshared with... Date Added: 2009-06-25 21:53:22 |
| L3TrackPhi.ps Path: Stanford >> MEETING >> 050719 Fall, 2009 Description: %!PS-Adobe-2.0 %Title: /a/bbr-nfs03/det/trg/trg/dwalker/RELEASES/18.0.4/workdir/L3TrackPhi.ps: c1 %Creator: ROOT Version 4.03/02 %CreationDate: Tue Jul 19 13:45:58 2005 %EndComments %BeginProlog /s {stroke} def /l {lineto} def /m {moveto} def /t {tra... Date Added: 2009-06-25 21:55:59 |
| Week05_PR_F07a_T15.xls Path: USC >> CSCI >> 577 Fall, 2009 Description: Team Number: Week: Program Size (SLOC) Base Added Deleted Modified Reused # of COTS Total New SLOC Effort (Hours) Project Mgmt. Requirements COTS Assessment Design Life Cycle Planning Configuration Mgmt. Feasibility Analysis Code COTS Tailoring COTS ... Date Added: 2009-06-25 21:59:18 |
| ch01.ppt Path: Armstrong >> ITEC >> 1300 Spring, 2008 Description: Chapter 1: Becoming Skilled at Information Technology Fluency with Information Technology Third Edition by Lawrence Snyder Copyright 2008 Pearson Education, Inc. Publishing as Pearson Addison-Wesley Terms of Endearment Learning the language of IT... Date Added: 2009-06-25 21:59:36 |
| index.txt Path: Berkeley >> ASTRO >> 00207281 Fall, 2009 Description: 9.8000011 31.500000 6.1328200 -0.075542680 719.90473 31.500000 34.300003 5.8689137 0.0000000 35.386435 155.63100 275.42502 25.265874 -4.2662848 54.398393 ... Date Added: 2009-06-25 21:59:40 |
| CUIN3111-Assign#1-Cryptogram.doc Path: U. Houston >> CUIN >> 3111 Fall, 2008 Description: CUIN 3111 Cryptogram Created by Puzzlemaker at DiscoverySchool.com ... Date Added: 2009-06-25 22:06:23 |
| lab1.pdf Path: Oregon State >> ECE >> 573 Fall, 2008 Description: ECE 471 Lab Schedule Lab1: Week #1: Practice using the software tools. Write a small 8051 assembly program. Wire wrap practice Week #2: Build the core of your system. Week #3: Get it working, write a short demo program. Lab3: Week #4: Add peripheral ... Date Added: 2009-06-25 22:08:42 |
| words.txt Path: Wisconsin Milwaukee >> LIB >> 3298 Fall, 2009 Description: 15th 33584:15523:1607:494 171 58568:61065:1097:435 3-5 30827:13249:1301:514 a 23401:16354:459:336 24294:14851:459:336 activities 16077:14613:3930:553 against 19879:17065:3164:355 alumni 31389:14910:2858:336 an 29960:14890:1020:355 and 35089:12675:158... Date Added: 2009-06-25 22:11:27 |
| Reflective entry HIPPA.rtf Path: Penn State >> DLK >> 236 Fall, 2009 Description: Often we use our computers to send and receive patient healthcare information without thinking about HIPPA. I personally transmit data on my computer with patient information. The data does not contain the name of the patient, but usually it does con... Date Added: 2009-06-25 22:13:30 |
| L10Relational&LogicalOps.ppt Path: UMBC >> PUB >> 104 Fall, 2009 Description: Relational and Logical Operators Topics Relational Operators and Expressions The if Statement The if-else Statement Nesting of if-else Statements Logical Operators and Expressions Truth Tables Reading Sections 2.6, 4.10, 4.11 CMSC 104, Versio... Date Added: 2009-06-25 22:14:35 |
| L16.ppt Path: UMBC >> PUB >> 104 Fall, 2009 Description: Functions, Part 2 of 3 Topics Functions That Return a Value Parameter Passing Local Variables Header Files Reading Sections 5.1 5.7 L16 Functions Can Return Values /* * averageTwo - calculates and returns the average of two numbers * Inputs: ... Date Added: 2009-06-25 22:14:49 |
| L05Algorithms2.ppt Path: UMBC >> PUB >> 104 Fall, 2009 Description: Algorithms, Part 2 of 3 Topics Problem Solving Examples Pseudocode Control Structures 1 Problem Solving Decode this sentence: Pdeo eo pda yknnayp wjosan. We have just come up with a specific solution to a problem. Can this solution be gen... Date Added: 2009-06-25 22:14:54 |
| L10Relational.ppt Path: UMBC >> PUB >> 104 Fall, 2009 Description: Relational and Logical Operators Topics Relational Operators and Expressions The if Statement The if-else Statement Nesting of if-else Statements Logical Operators and Expressions Truth Tables Reading Sections 2.6, 4.10, 4.11 CMSC 104, Versio... Date Added: 2009-06-25 22:15:07 |
| L05Algorithms2.ppt Path: UMBC >> PUB >> 104 Fall, 2009 Description: Algorithms, Part 2 of 3 Topics Problem Solving Examples Pseudocode Control Structures 1 Problem Solving Decode this sentence: Pdeo eo pda yknnayp wjosan. We have just come up with a specific solution to a problem. Can this solution be gen... Date Added: 2009-06-25 22:15:09 |
| TECH1[1] revised.pdf Path: Penn State >> DJB >> 350 Fall, 2009 Description: Dan Baker Construction Management Faculty Advisor: Dr. Riley Bed Bath & Beyond/ Christmas Tree Shops 300 Ikea Drive Paramus, New Jersey Technical Assignment 1 Table of Contents A. Site Plans and Vicinity maps . 2,3 B. Local Conditions . 4 C. Client ... Date Added: 2009-06-25 22:18:16 |
| jcc05.pdf Path: Auburn >> XZQ >> 0001 Fall, 2009 Description: Improving the Performance of I/O-Intensive Applications on Clusters of Workstations Xiao Qin (xqin@cs.nmt.edu) Department of Computer Science, New Mexico Institute of Mining and Technology, 801 Leroy Place, Socorro, New Mexico 87801-4796, USA Hong ... Date Added: 2009-06-25 22:20:03 |
| dissertation.pdf Path: Auburn >> XZQ >> 0001 Fall, 2009 Description: Dynamic I/O-Aware Load Balancing and Resource Management for Clusters by XIAO QIN A DISSERTATION Presented to the Faculty of The Graduate College at the University of Nebraska In Partial Fulfillment of Requirements For the Degree of Doctor of Phi... Date Added: 2009-06-25 22:20:11 |
| YKL162C-A.t2k.dssp-ehl2-logo.pdf Path: UCSC >> YKL >> 162 Fall, 2009 Description: YKL162C-A.t2k DSSP-EHL2 2 1 CCCC 1 C H X X X X X 10 20 30 40 HE T E T S E TS E S H 50 EEEC CCECCCCCCCCCCECC HH H C C CCC ECE MTLHHKLVLSMLLGLSITPEGDLPLSGQDIFYQYSFSSFYNIHDERIREQ C H X X H H C X X X X X X E H E H H E E C X X X X ... Date Added: 2009-06-25 22:20:55 |
| Chapter 2.doc Path: Penn State >> CMP >> 5302 Fall, 2009 Description: ChristopherPatterson 12309 Mis204 Chapter2 1. Describeinyourownwords,thehistoryoftheinternet? a. TheinternetgotitsstartaspartofaU.S.DepartmentofDefensesystemthat wouldallowscientiststheabilitytoshareinformationfromdifferentlocations,and stillbefuncti... Date Added: 2009-06-25 22:21:22 |
| theoryexam2[1].doc Path: GA Southern >> SC >> 00700 Fall, 2009 Description: 1. Describe the historical evolution of the TRA. Describe in detail the relationship between the four determinants of the theory as they relate to behavior. . Reasoned Action Theory is rooted in the field of Social Psychology. Social Psychologists at... Date Added: 2009-06-25 22:28:52 |
| using_solver.xls Path: VCU >> MGMT >> 171 Fall, 2008 Description: -2 4 3 12 INTRODUCTION TO USING SOLVER IN EXCEL Solver can be used to solve for the value(s) of an input variable or input variables that will accomplish one of three objectives: 1. make the value of the function in the TARGET CELL a minimum, 2. ... Date Added: 2009-06-25 22:31:25 |
| RAD7001ds.pdf Path: Colorado State >> RAD >> 7001 Fall, 2009 Description: NUCLEAR RADIATION DETECTOR MODEL RAD-7001 BULLETIN RAD7001 General Description The RAD-7001 Nuclear Radiation Detector provides nuclear emergency monitoring to a geographically distributed, wireless weather web. It continuously detects ionizing radi... Date Added: 2009-06-25 22:42:20 |
| 06-Biometrics-Lecture-6-Part2-2008-10-27 Path: University of Toronto >> MATH >> MAT 400 Fall, 2008 Description: Master SC Information and Communication Security 1 Biometrics http:/scgwww.epfl.ch/courses Dr. Andrzej Drygajlo Speech Processing and Biometrics Group Signal Processing Institute Ecole Polytechnique Fdrale de Lausanne (EPFL) Center for Interdisci... Date Added: 2009-06-25 22:44:44 |
| Ecoli.pdf Path: Texas A&M >> FSTC >> 606 Fall, 2008 Description: Microorganisms Causing Foodborne Disease Family Enterobacteriaceae Pathogenic Escherichia coli Escherichia coli Named after German bacteriologist Theodor Escherich E. coli is a normal inhabitant of the intestine of humans and warm-blooded animals ... Date Added: 2009-06-25 22:46:36 |
| ch3GrammarTypes.pdf Path: Ill. Chicago >> EECS >> 476 Fall, 2009 Description: pp, ?n[ q Zolkw#r, 4b-aPl Grammar Class nrestricted Context sensitive Context free Regular Machine Class T\ ring machine Linear-bounded automaron Pushdown automaton Finite-state automaton Table 9.L. Classesof gralnma,rsand abstract machines. _> ... Date Added: 2009-06-25 22:47:36 |
| SRS_Content_002.doc Path: Georgia Tech >> CS >> 3911 Fall, 2008 Description: 1. Introduction 1.1 Purpose This Software Requirements Specification (SRS) describes the function and performance requirements of the intervention therapies monitoring tool project. This SRS will provide the client and the projects members the curren... Date Added: 2009-06-25 22:47:54 |
| lecture8_6.pdf Path: Yale >> CS >> 112 Fall, 2009 Description: Outline CS 112 Introduction to Programming Lecture #8: Conditional Statements (continue), and Loop Statements Richard Yang Admin. and review statements (continue) q Loop statements q Conditional 2 Admin. r Assignment r You Review r Flow of contr... Date Added: 2009-06-25 22:53:02 |
| 03-Fungi and Bryophytes.ppt Path: Colorado State >> LS >> 103 Fall, 2009 Description: Agenda Quiz on Algae and Cyanobacteria Announcements Plant Experiments Fungi, Lichen, Byrophytes Lecture Fungi, Lichen, Byrophytes Lab Next week Lab Practical 1 on Cyanobacteria, Algae, Fungi, Lichen, and Bryophytes Kingdom Fungi Zygomycota... Date Added: 2009-06-25 22:53:06 |
| T0456.t04.o_notor-logo.pdf Path: UCSC >> T >> 0456 Fall, 2009 Description: T0456.t04 o_notor 3 2 1 MHHHHHHSSGRENLYFQGTFAERYNIVCMLGKGSFGEVLKCKDRITQQEYAVKVINKASAKNKDTSTILREVELLKKLDHPNIMKLFEILEDSSSFYIVG 1 10 20 30 40 50 60 70 80 90 N 3 2 1 GN H N BH ABN H MN H GN P N A BA ELYTGGELFDEIIKRKRFSEHDAARIIKQVFSGITYMHKHNIVH... Date Added: 2009-06-25 22:53:33 |
| ILO02tahl.pdf Path: NSUOK >> ALEXA >> 001 Fall, 2009 Description: INTERNATIONAL LAW AND ORGANIZATIONS POLITICAL SCIENCE 4343 TT 9:30-10:45 Instructor: James Alexan der 318 Sem inary Hall Tel: (o) X3512 (h) 453-9073 until 9:00 p.m.1 e-mail: alexa001@cherokee.nsuok.edu Fall 2002 Rm: SH 232 Office Hours: BA - M, 4-... Date Added: 2009-06-25 22:53:44 |
| 19730201.TXT Path: Penn State >> BUB >> 1973 Fall, 2009 Description: Sheet1 STATE COLLEGE, PENNSYLVANIA DAILY WEATHER SUMMARY - Latest Complete Day [1200 UT - 1200 UT] -02/01/73 High Temperature Low Temperature Mean Temperature Rain or Liquid Equivalent Snow and/or Ice Pellets Snow Depth 28 Rank (1=Warmest, 78=Colde... Date Added: 2009-06-25 22:54:52 |
| ITA123XSyllabus.doc Path: UCSB >> OPERA >> 123 Fall, 2009 Description: University of California at Santa Barbara French and Italian Department Italian 123X ITALIAN OPERA SYLLABUS Summer 2002 Professor Antonio Artese E-mail: artese@french-ital.ucsb.edu Web site for course material: www.french-ital.ucsb.edu/projects/leona... Date Added: 2009-06-25 23:00:40 |
| tut_13.pdf Path: Allan Hancock College >> MATH >> 132 Fall, 2009 Description: MACQUARIE UNIVERSITY DEPARTMENT OF MATHEMATICS MATH132 MATHEMATICS IA (ADVANCED) (2009 D1) TUTORIAL QUESTIONS FOR WEEK 13 1. Find a unit vector n perpendicular to the plane determined by the points A(0, 2, 1), B (1, 1, 2) and C (1, 1, 0). 2. Find ... Date Added: 2009-06-25 23:00:42 |
| Gecco2004.ppt Path: MO St. Louis >> CS >> 6340 Fall, 2009 Description: Adapting Representation in Genetic Programming Cezary Z. Janikow UMSL Work partly done at NASA/JSC Roadmap Search Space and Redundant Representations Constrained GP Technology CGP ACGP Adaptable CGP ACGP1.1.1 methodology Some results ACGP2.1 (NEW... Date Added: 2009-06-25 23:01:38 |
| lec21.ps Path: Iowa State >> CS >> 633 Fall, 2009 Description: %!PS-Adobe-2.0 %Creator: dvips(k) 5.86 Copyright 1999 Radical Eye Software %Title: Notes.dvi %Pages: 4 %PageOrder: Ascend %BoundingBox: 0 0 612 792 %EndComments %DVIPSWebPage: (www.radicaleye.com) %DVIPSCommandLine: dvips -t letter -o Notes.ps Notes.... Date Added: 2009-06-25 23:02:50 |
| ibgp.pdf Path: UMass (Amherst) >> ECE >> 697 Fall, 2009 Description: ABSTRACT T $ F F $7 R Q 0 p7 7 A D )\"HHPC 68ne% i@\'` \"B8a( EiE BD%\"a86 il% PS Q 7 0 b 7 ` A 0 b 7 p A ! Q 7 ` 7 7 F ` p \"scCgEBDEB7BAE8C%S es\" fo%S8 %HEBDA PS ` D ( W D... Date Added: 2009-06-25 23:07:32 |
| worksheet3.new.pdf Path: Michigan State University >> PHY >> 201 Fall, 2008 Description: 4 414 Z unvkhhw 5= Surjudp Rujdql}dwlrq r Uhdglqj Lq wklv zrunvkhhw |rx zloo frqwlqxh wkh zrun vwduwhg lq zrunvkhhw 4hydoxdwlqj wkh huuru ixqfwlrq ri d uhdo ru frpsoh{ qxpehu xvlqj wuxqfdwhg srzhu vhulhv1 \\ x zloo uhxvh pxfk ri wkh fr gh zulwwhq eh... Date Added: 2009-06-25 23:08:22 |
| GEY207.pdf Path: Maine >> PDFS >> 207 Fall, 2009 Description: 1. 2. 3. 4. 5. 6. 7. 8. 9. 10. 11. 12. UNIVERSITY OF SOUTHERN MAINE STUDENT INPUT FOR TEACHING FACULTY EVALUATIONS - GEOSCIENCES - SPRING 2007 269 STUDENTS RESPONDED ENTIRE DEPT QUESTION MEDIAN MEAN STD. NO 1 2 DEV. RESPONSE HOW PREPARED WAS THE INS... Date Added: 2009-06-25 23:08:45 |
| Oct3Paper.doc Path: SUNY Albany >> SS >> 974429 Fall, 2009 Description: Google to Push for More Electrical Efficiency in PCs A company famous for its web searching abilities is now expanding its horizons to other areas of the computer world. Google calls for an update to current PC power supplies. This upgrade could save... Date Added: 2009-06-25 23:12:16 |
| problem7.pdf Path: Syracuse >> PHY >> 215 Fall, 2009 Description: PHY 215 - Problem Set #7 - Due Friday October 28, 2005 1 The Assignment Do the following problems from the textbook (University Physics): 7.65, 12.65, 12.60 1 ... Date Added: 2009-06-25 23:14:43 |
| readme.txt Path: W. Alabama >> ECE >> 355 Fall, 2009 Description: File name Description tutorial-1.ppt Introduction to UNIX Inter Process Communication tutorial-2.ppt Introduction to SDL and MSC tutorial-3.ppt Project description tutorial-4.ppt Introduction to HMSC tutorial-5.ppt Software reliability mo... Date Added: 2009-06-25 23:15:36 |
| 553a.ppt Path: Rutgers >> LIS >> 553 Fall, 2009 Description: Digital Libraries Technology, Economics, Content, Services and Users Everything Digital every child can stretch a hand across a keyboard and reach every book ever written, every painting ever painted, every symphony ever composed.\" - Bill Clintons ... Date Added: 2009-06-25 23:16:25 |
| outline.pdf Path: Contra Costa College >> ENGR >> 471 Fall, 2009 Description: CONCORDIA UNIVERSITY Linear Systems ENGR 613/2 & ENGR 471/2 Instructor: Chun-Yi Su Office: H549-9 Phone: 848-3168 Email: cysu@me.concordia.ca Lectures: 10:15-11:30 on Wednesdays Office Hours: when available and Fridays Web: http:/me.concordia.ca/~cy... Date Added: 2009-06-25 23:23:12 |
| hw5-fall07.pdf Path: CUNY Baruch >> ECO >> 721 Fall, 2009 Description: Homework 5 Econometrics: ECO 721 Fall 2007 Due Tuesday, December 11 at 5pm You must turn in this assignment either by email or in hardcopy to me (at my oce or you can leave it in the dept. oce) by 5pm on Tuesday, December 11. If you turn in a hard co... Date Added: 2009-06-25 23:26:13 |
| tech-2.pdf Path: Penn State >> EJY >> 112 Fall, 2009 Description: Eric Yanovich Structural Technical Report 2 October 31 , 2005 st Faculty Advisor Professor Kevin Parfitt Renaissance Schaumburg Hotel and Convention Center Schaumburg, Illinois Pro-Con Structural Study of Alternate Floor Systems Due: October 31... Date Added: 2009-06-25 23:27:14 |
| 5.pdf Path: N.C. State >> MA >> 242 Fall, 2008 Description: ... Date Added: 2009-06-25 23:30:15 |
| 286-wd-mip.pdf Path: Harvard >> CS >> 286 Fall, 2009 Description: maximize ! {v\" : \" corresponds to a toplevel bid} For each atomic s! xi j For each OR ; v! p s! v! p s! + \" v!i id s! \" s!i ; id For each AND d s! \" s!i ; id ; v! p s! + \" v!i id ; v!i M s!i , i d For each XOR s! id id \" s!... Date Added: 2009-06-25 23:30:33 |
| Noir_et_Blanc_reseaux_mesures.pdf Path: NSULA >> GGR >> 7022 Fall, 2009 Description: Instrumentations Instrumentations et rseaux de mesures Les rseaux de mesures Le grand manitou Canada Qubec NOAA Instruments de mesures de mesures Manipuler les donnes sur le climat? climat? Nathalie Barrette 2009 Gnralits Instruments ... Date Added: 2009-06-25 23:37:22 |
| Probability Lesson.pdf Path: Wisc Stevens Point >> MBLUE >> 523 Fall, 2009 Description: Grade Level(s): Fifth Objective(s) and Content Standard(s): Students will: Review the concept of impossibility in probability (Data Analysis and Probability for Grades 3-5 NCTM Standard: describe events as likely or unlikely and discuss the degree o... Date Added: 2009-06-25 23:38:02 |
| Lecture2.txt Path: Midwestern State University >> CS >> 580 Fall, 2009 Description: - Lecture1 - @nocolor - Lecture1 Basic terminology -- Terminology from Goetz process isolated, independently-executing program owning OS-based resources such as memory, file handles, security credentials threads multiple streams of execu... Date Added: 2009-06-25 23:48:31 |
| HW2.pdf Path: Penn State >> ME >> 564 Fall, 2009 Description: Homework #1 ME 564, Rahn Assigned: 2/15, Due: 2/23 Name: _ Instructions: Return these assignment sheets stapled to the top of your completed homework assignment. Place answers in boxes provided or fill in the blanks on these sheets. An empty box or... Date Added: 2009-06-25 23:51:41 |
| p101n28.pdf Path: Sveriges lantbruksuniversitet >> JUNK >> 1011828 Fall, 2009 Description: PHYS 101 Lecture 28a Lecture 28a - Pascal\'s Principle Whats important: Pascal\'s principle Demonstrations: Pascal\'s vases; books-on-a-bag (hydraulic press) Text: Walker, Sec. 15.3 Problems: Static pressure 28a - 1 Just because the pressure is inde... Date Added: 2009-06-25 23:52:27 |
| AE568_HW 3.pdf Path: Iowa State >> AE >> 568 Fall, 2009 Description: Instructor: Tae Hyun Kim (3101 NSRIC) Phone: 515-294-7136, Email: thkim@iastate.edu A E 568X Pretreatment of Biomass Homework #3. Organic chemistry (Due; 2/3) Write the chemical formulae of following carbohydrates in Fischer and Haworth structures.... Date Added: 2009-06-25 23:56:50 |
| proeinstructions.pdf Path: Clemson >> ME >> 323 Fall, 2009 Description: ME323 Model Instructions in Pro/Engineer From your home directory on a SUN workstation, type proe. It will take the program a minute or so to start. First we need to change a few things in the Pro/E environment before we go forward with making the ... Date Added: 2009-06-26 00:01:20 |
| homework.6.pdf Path: Kentucky >> PHY >> 361 Fall, 2008 Description: vutgir6qYpihgfedcba6XYXWVPUTSRQAGD w w Hq H H H H ` P IH F vutxft6qYpihgfedcba6XYXWVPUTSRQAGs w Hq H H H H ` P IH F D w Hq H H H H ` P IH F D vyBr6qYpihgfedcba6XYXWVPUTSRQAGp w o Hr H H H H ` PIH F D vyxvftdsqYpihgfedcba6XYXWVPUTSRQAGnm w k ege d ... Date Added: 2009-06-26 00:02:53 |
| manal.pdf Path: Utah >> NEW >> 308099 Fall, 2009 Description: Monday Lab 1999 El wt.% MSAN F Na K Fe Si Al Ca Mn Mg Cl Ti 0.00 0.00 0.01 0.57 25.97 0.00 19.32 0.08 11.44 0.00 0.03 RJAB RJAB RJAB TBAH TBAH BHH 0.00 0.38 0.01 0.00 0.06 0.00 39.08 0.00 0.03 0.05 0.02 0.00 0.46 0.01 0.02 0.04 0.00 38.62 0.00 0.00 0... Date Added: 2009-06-26 00:03:29 |
| Book_Review_Baldauf_and_Kaplan_by_Prithvi.pdf Path: East Los Angeles College >> OPEN >> 16269 Fall, 2009 Description: BOOK REVIEW RICHARD B. BALDAUF JR. AND ROBERT B. KAPLAN (Eds.). Language Planning and Policy in the Pacific, Vol. 1: Fiji, The Philippines and Vanuatu. Clevedon, UK: Multilingual Matters Ltd., 2006. pp. 239. Hb Reviewed by PRITHVI SHRESTHA The Paci... Date Added: 2009-06-26 00:05:51 |
| LightNotes.pdf Path: BYU >> IT >> 441 Fall, 2008 Description: Light - based Instrumentation Last Updated Feb 1999 Introduction Light-based instrumentation is attractive from several viewpoints. Many of the devices involved are cheap and the interfacing circuitry is often simple. Light is immune to electrical i... Date Added: 2009-06-26 00:07:15 |
| Designer Feedback and Solutions.pdf Path: Penn State >> CAH >> 280 Fall, 2009 Description: Designer Feedback Designer Lutron Schematic Design Presentations Chris Hoyman The School of Forest Resources Building Dr. Mistrick, Faculty Advisor Tuesday, December 6, 2005 Barbara- Make the building more interesting. Make Totally green building? ... Date Added: 2009-06-26 00:07:42 |
| L4_4.pdf Path: University of Toronto >> AST >> 221 Fall, 2009 Description: Puzzle: SPACE SURVIVAL RULE # 1: An astronaut is accidentally left behind the space shuttle by his careless colleagues. Which way should he aim to catch up? Puzzle: SPACE SURVIVAL RULE # 1: An astronaut is accidentally left behind the space shuttle ... Date Added: 2009-06-26 00:07:46 |
| 1010CA2.pdf Path: Laurentian >> ECON >> 1010 Fall, 2009 Description: ECONOMICS 1010C WED. SEPT 29th _ 1. In each of the following case calculate and indicate the whether price elasticity of demand is elastic,... Date Added: 2009-06-26 00:15:30 |
| 10c.pdf Path: University of Toronto >> STA >> 250 Fall, 2009 Description: B T B B $ 9 B 7 ( @ d Q \" ! C 4 2 $ \' ( \" $ 4 # 2 ! 9 ) & | x x } q { q p k k q l u k | i... Date Added: 2009-06-26 00:22:47 |
|
|
Get Started With Course Hero Today!
Get study guides, join study groups, and more!
Sign up in seconds with your Facebook account!
Course Hero is a Facebook Application Partner.
Click below to sign-up for FREE.
Our Social Learning Network was built to provide students and key learning partners like professors a platform to share, meet and collaborate while accelerating their comprehension of course-related theories and concepts. We are committed to providing you immediate access to a growing wealth of study materials and an unparalleled academic network of students, professors and other key partners. Why do you care? Because you want the best grade possible and at times need a 24/7 resource that’s responsive to your needs. |
|
What People Are Saying About Course Hero
|
|||
|
|||
|
Explore the benefits of joining Course Hero's social learning network.
|
|||
![]() |
Get millions of study materials now!Need lecture notes for a missed class or want insightful explanation of the theories and concepts you learn in class? Look no further, Course Hero’s Study Materials empowers you to find a broad and deep set of materials that can help you right now!
Click below to sign-up for FREE.
|
||
![]() |
Get over 200,000 textbook solutions now!Having difficulty with your homework and need documents that are relevant for your Textbook? Don't be frustrated. Course Hero's Textbook Help presents you study materials from many college courses.
Click below to sign-up for FREE.
|
||
![]() |
Meet over 300,000 students and your fellow classmates now!Want to meet your current classmates or those that took the class last year? Don’t worry or have anxiety. Course Hero’s Study Groups gives you the seamless opportunity to develop both anonymous or direct relationships with those classmates whom you want to meet and get help from right now!
Click below to sign-up for FREE.
|
||


