Course Solutions And Notes - 3b9b2b0d 09
| 48774a5f.pdf Path: Wisconsin >> WILL >> 0096 Fall, 2009 Description: ... Date Added: 2009-06-24 11:21:40 |
| 48774af8.pdf Path: Wisconsin >> WILL >> 0096 Fall, 2009 Description: ... Date Added: 2009-06-24 11:22:19 |
| 487748b6.pdf Path: Wisconsin >> WILL >> 0096 Fall, 2009 Description: ... Date Added: 2009-06-24 11:22:29 |
| 487749b2.pdf Path: Wisconsin >> WILL >> 0096 Fall, 2009 Description: ... Date Added: 2009-06-24 11:22:45 |
| 5c4.pdf Path: Wisconsin >> WILL >> 0053 Fall, 2009 Description: ... Date Added: 2009-06-24 11:25:01 |
| 48772ae7.pdf Path: Wisconsin >> WILL >> 0088 Fall, 2009 Description: ... Date Added: 2009-06-24 11:26:31 |
| 48772c02.pdf Path: Wisconsin >> WILL >> 0088 Fall, 2009 Description: ... Date Added: 2009-06-24 11:27:29 |
| 4876f3f0.pdf Path: Wisconsin >> WILL >> 0073 Fall, 2009 Description: ... Date Added: 2009-06-24 11:28:25 |
| 4876f35f.pdf Path: Wisconsin >> WILL >> 0073 Fall, 2009 Description: ... Date Added: 2009-06-24 11:29:31 |
| 2bc3.pdf Path: Wisconsin >> WILL >> 0063 Fall, 2009 Description: ... Date Added: 2009-06-24 11:32:45 |
| 2c11.pdf Path: Wisconsin >> WILL >> 0063 Fall, 2009 Description: ... Date Added: 2009-06-24 11:33:09 |
| 3b9b1d8a.pdf Path: Wisconsin >> WILL >> 0030 Fall, 2009 Description: ... Date Added: 2009-06-24 11:34:01 |
| 3b9b1d97.pdf Path: Wisconsin >> WILL >> 0030 Fall, 2009 Description: ... Date Added: 2009-06-24 11:34:13 |
| 3b9b1db3.pdf Path: Wisconsin >> WILL >> 0030 Fall, 2009 Description: ... Date Added: 2009-06-24 11:34:17 |
| 48774b54.pdf Path: Wisconsin >> WILL >> 0097 Fall, 2009 Description: ... Date Added: 2009-06-24 11:35:43 |
| 3b9b0a05.pdf Path: Wisconsin >> WILL >> 0013 Fall, 2009 Description: ... Date Added: 2009-06-24 11:37:51 |
| 3b9b0623.pdf Path: Wisconsin >> WILL >> 0013 Fall, 2009 Description: ... Date Added: 2009-06-24 11:38:43 |
| 3b9b08a4.pdf Path: Wisconsin >> WILL >> 0013 Fall, 2009 Description: ... Date Added: 2009-06-24 11:39:09 |
| 3b9b09b6.pdf Path: Wisconsin >> WILL >> 0013 Fall, 2009 Description: ... Date Added: 2009-06-24 11:39:26 |
| 3b9b3acd.pdf Path: Wisconsin >> WILL >> 0038 Fall, 2009 Description: ... Date Added: 2009-06-24 11:39:38 |
| 3b9b3b4e.pdf Path: Wisconsin >> WILL >> 0038 Fall, 2009 Description: ... Date Added: 2009-06-24 11:39:53 |
| 3b9b3b37.pdf Path: Wisconsin >> WILL >> 0038 Fall, 2009 Description: ... Date Added: 2009-06-24 11:40:02 |
| 3b9b3b68.pdf Path: Wisconsin >> WILL >> 0038 Fall, 2009 Description: ... Date Added: 2009-06-24 11:40:12 |
| 48772a95.pdf Path: Wisconsin >> WILL >> 0087 Fall, 2009 Description: ... Date Added: 2009-06-24 11:41:44 |
| 48772a97.pdf Path: Wisconsin >> WILL >> 0087 Fall, 2009 Description: ... Date Added: 2009-06-24 11:41:44 |
| 487727b7.pdf Path: Wisconsin >> WILL >> 0087 Fall, 2009 Description: ... Date Added: 2009-06-24 11:42:01 |
| 48777dea.pdf Path: Wisconsin >> WILL >> 0112 Fall, 2009 Description: ... Date Added: 2009-06-24 11:42:59 |
| 48777e2e.pdf Path: Wisconsin >> WILL >> 0112 Fall, 2009 Description: ... Date Added: 2009-06-24 11:43:08 |
| 48777e3e.pdf Path: Wisconsin >> WILL >> 0112 Fall, 2009 Description: ... Date Added: 2009-06-24 11:43:09 |
| 48777edb.pdf Path: Wisconsin >> WILL >> 0112 Fall, 2009 Description: ... Date Added: 2009-06-24 11:43:44 |
| 3b9ad56f.pdf Path: Wisconsin >> WILL >> 0003 Fall, 2009 Description: ... Date Added: 2009-06-24 11:46:18 |
| 3b9af2e7.pdf Path: Wisconsin >> WILL >> 0022 Fall, 2009 Description: ... Date Added: 2009-06-24 11:46:30 |
| 3b9af2cd.pdf Path: Wisconsin >> WILL >> 0022 Fall, 2009 Description: ... Date Added: 2009-06-24 11:46:30 |
| a17.pdf Path: Wisconsin >> WILL >> 0054 Fall, 2009 Description: ... Date Added: 2009-06-24 11:48:52 |
| 3b9b48d1.pdf Path: Wisconsin >> WILL >> 0042 Fall, 2009 Description: ... Date Added: 2009-06-24 11:50:56 |
| web-assignment.3.pdf Path: SUNY Stony Brook >> CHE >> 131 Fall, 2008 Description: CHE 131 Web Assignment 3 Organic Synthesis In this assignment, you will need to provide synthetic routes to different organic molecules, based on the palette of reactions we have discussed in CHE 131. The table below is a schematic representation of... Date Added: 2009-06-24 11:51:37 |
| Module12.pdf Path: MSJC >> PSYC >> 101 Fall, 2009 Description: Introduction to Psychology, 7th Edition, Rod Plotnik Module 12: Remembering Forgetting Introduction to Psychology, 7th Edition, Rod Plotnik Module 12: Remembering & Forgetting ORGNIZATION OF MEMORIES Network t... Date Added: 2009-06-24 11:53:44 |
| How to create a log using System Monitor in Windows.pdf Path: Minnesota >> INET >> 4031 Fall, 2008 Description: How to create a log using System Monitor in Windows http:/support.microsoft.com/kb/248345 How to create a log using System Monitor in Windows This article was previously published under Q248345 This article describes how to create log files using ... Date Added: 2009-06-24 11:55:42 |
| chem350_mack_2005_test1.pdf Path: Cincinnati >> CHEM >> 350 Fall, 2008 Description: ... Date Added: 2009-06-24 11:57:59 |
| 070402BiomedicalSensors2.ppt Path: George Mason >> BENG >> 401 Fall, 2008 Description: Biomedical Sensors From last class: Performance measurement Transducers Kinds of sensors pO2 (electrochemical sensor) Electrode Electrolyte Interface Electrode C eeC+ : Cation Electrolyte (neutral charge) C+, A- in solution Current flow C C C+ ... Date Added: 2009-06-24 11:58:11 |
| lecture5_Biomaterials.pdf Path: George Mason >> BENG >> 401 Fall, 2008 Description: Announcements This Wednesday we\'ll go through an ECG circuit including the right leg drive. If you know it, you can work on LabView or on etching your circuit. How to etch your circuit? Karen is running that: her schedule: Mondays, Tuesdays, Thursd... Date Added: 2009-06-24 11:58:13 |
| math305_spring09.pdf Path: Southern Illinois University, Carbondale >> MATH >> 305 Fall, 2008 Description: Math 305: Introduction to Ordinary Differential Equations I Spring 2009, Section 3 MWF 2:00 2:50 pm EGRA 410 Instructor: Dr. Jianhong Xu, Neckers 267, Phone: 453-6510, E-mail: jxu@math.siu.edu, Web: http:/www.math.siu.edu/xu/math305/ Office Hours: ... Date Added: 2009-06-24 12:03:48 |
| key2test2.pdf Path: Tennessee >> MATH >> 341 Fall, 2009 Description: MATH 341 Second Midterm Exam October 27, 2006 Name ID number x 1. Let f : [0, 2] R be given by f (x) = 1+x . Use - argument, prove that f has a limit at x = 1. Solution: Guess L = 1 . 2 > 0, = 2 > 0, 0 < |x - 1| < , we have x 1 - 1+x 2 |2x - ... Date Added: 2009-06-24 12:07:06 |
| masonsrule.pdf Path: UCF >> EEL >> 3657 Fall, 2008 Description: ... Date Added: 2009-06-24 12:18:18 |
| quiz3_2007_answers.pdf Path: Oakland University >> FIN >> 40610 Fall, 2009 Description: Quiz 3 Solutions Security Analysis - Finance 40610 Professor Shane A. Corwin Fall Semester 2007 Instructions: Please answer all of the questions completely and show all of your work. You may use a formula sheet and a calculator. The quiz is worth 25... Date Added: 2009-06-24 12:22:48 |
| Quiz2Fall03.pdf Path: Tennessee >> STAT >> 201 Fall, 2009 Description: 201 Quiz 2 Dr. Bensmail Question 1: September 12 , 2003 165 182 208 226 235 282 292 312 33 15 80 99 Calculate the Five point summary? Question 2: Observe the data below: 1|0 2|3 3|1 4|0 5|112 5|00001 6|39 1. Calculate the mean, median and the mod... Date Added: 2009-06-24 12:24:15 |
| Homework2.pdf Path: Iowa State >> STAT >> 101 Fall, 2008 Description: STATISTICS 101 Section A - Homework 2 Due Wednesday, June 3, 2009 1. A study examining the health risks of smoking measured the cholesterol levels of people who had smoked for at least 25 years and people of similar ages who had smoked for no more th... Date Added: 2009-06-24 12:35:59 |
| psy420_ch12_lab.doc Path: CSU Northridge >> PSY >> 420 Fall, 2009 Description: Chapter 12. Lab Exercise Name (Please print): _ Date: _ 1. A student was interested in determining the effects of two kinds of verbal reinforcement on childrens performance on a simple motor-coordination task. Children were assigned randomly to one o... Date Added: 2009-06-24 12:55:14 |
| chapter22.pdf Path: Glendale Community College >> BIO >> 181 Fall, 2008 Description: Chapter 22 Descent with Modification: A Darwinian View of Life Evolution - the processes that have transformed life on Earth from its earliest forms to the vast diversity that characterizes it today Early Philosophy Socrates and Plato Old Testament N... Date Added: 2009-06-24 13:03:25 |
| Digestive_Cadaver_List.pdf Path: Glendale Community College >> BIO >> 202 Fall, 2008 Description: Digestive Cadaver List 1 Cadaver Organ Checklist 1. 2. 3. 4. 5. 6. 7. 8. 9. Diaphragm Parietal peritoneum Visceral peritoneum Parietal pleura Visceral pleura Parotid salivary gland Submandibular salivary gland Esophagus Stomach a. Cardiac region of... Date Added: 2009-06-24 13:05:40 |
| chapter4_lec3_sp06.ppt Path: N.E. Illinois >> MIS >> 4200 Fall, 2009 Description: CHAPTER 4 DataModelingLecture2 Review Data Modeling Relationships Connectivity Cardinality Optionality Relationship Strength and Weak Entities Weakentitymeetstwoconditions Existencedependent: Cannotexistwithoutentitywithwhichithasa relat... Date Added: 2009-06-24 13:07:25 |
| 10.PlantStruc.pdf Path: Cuyamaca College >> BIO >> 210 Fall, 2008 Description: Bio 210: Lecture 10.Plant Anatomy Tu 04 Mar 03 1 News course website: http:/www.cuyamaca.net/Paul.Kingston lecture outlines study guides SoLoE docs status of the Survey of Life on Earth Selene 2 Plant Structure ... Date Added: 2009-06-24 13:10:40 |
| GISSYLLABUS.pdf Path: St. Olaf >> ES >> 255 Fall, 2009 Description: Remote Sensing and GIS Environmental Studies 255 Fall, 2003 Prof. Charles Umbanhowar Jr. Science Center 258, x3397, ceumb Office Hours: T 11:45-1:15, W 8:00-10:00 or by appointment Text: Lo, C.P. and A.K.W. Yeung. 2002. Concepts and techniques of G... Date Added: 2009-06-24 13:15:41 |
| CONOPS.pdf Path: Penn State >> STM >> 5066 Fall, 2009 Description: System Inputs Affordability System Outputs The overall system must be affordable, which includes extra parts such as an additional battery and alternator. Weather conditions System must remain functional and remain in position under harsh weather ... Date Added: 2009-06-24 13:16:45 |
| YNL013C.t2k.w0.5-logo.pdf Path: UCSC >> YNL >> 013 Fall, 2009 Description: YNL013C.t2k w0.5 2 1 M L V I I V 1 10 20 30 40 H 2 1 Y EL I V E H Y L I I LL LLLLLL FLLP L LV F FI FFFF L L L H N N V V V XXXXXX XXXXXXXXXXXXXXXXXXXXX XXXXX W F V I A F Y Y I I I V V V A X T I L V I Y I V T S K V T Y Y Y Y I I I... Date Added: 2009-06-24 13:16:55 |
| YNL067W-A.t2k.alpha-logo.pdf Path: UCSC >> YNL >> 067 Fall, 2009 Description: YNL067W-A.t2k ALPHA 1 E E EABBEB E A B B B A A A S EEC B XXXXXXX A H H H H H X X X X X X X H H H H H H X X X X X C I H H A H E XXXXXXX B H H SB E T A H X X X X H H H H H X I I I H X X X X XXXXXXXXXXXXX H I I HH H H HHHHH I I... Date Added: 2009-06-24 13:17:13 |
| YNL053W.t04.near-backbone-11-logo.pdf Path: UCSC >> YNL >> 053 Fall, 2009 Description: YNL053W.t04 near-backbone-11 3 2 1 BJD H E A E XXKCXXX X I DI C G A B X D A I G D I X X X G BA D A B D B DA B D D B D C E E XXXXXXEXXXXXC X X A B D D E E A C C A A A A A A AA B A B X D B D G A D D X X X X J E A D D F D H D D A D B ... Date Added: 2009-06-24 13:17:26 |
| T0393.t04.pb-logo.pdf Path: UCSC >> M >> 0393 Fall, 2009 Description: T0393.t04 pb 6 5 4 3 2 1 1 10 20 30 40 D 6 5 4 3 2 1 DFK P D EHJM NOPA FBD DFBFK M N 51 60 70 80 90 OPA 6 5 4 3 2 1 DFDFK M PMBD D FK M NOPAFKBA D FKD 101 110 120 130 140 FKM 6 5 4 3 2 1 NOPAD FEHPA DM D D BF... Date Added: 2009-06-24 13:22:03 |
| helproom.pdf Path: Iowa State >> ECON >> 102 Fall, 2008 Description: The Help Room 1. The Economic Help Room is located in 301 Curtiss. Help Room hours are: 8:30 - 5:00 8:30 - 7:00 8:30 - 4:00 MWTh: Tuesday: Friday There is always at least one person in the Help Room that can assist you with problem sets, questions ... Date Added: 2009-06-24 13:22:27 |
| YKL007W.t2k.CB_burial_14_7-logo.pdf Path: UCSC >> YKL >> 007 Fall, 2009 Description: YKL007W.t2k CB_BURIAL_14_7 3 2 1 AAA C A B CB C BBBBC BA C D C D D X X X X X X X X 1 10 20 30 40 A 3 2 1 B A X DB DE EFBDFDBABEB EDB EDBDEB DBA EDBEF BDEB C B DD B D ADECCBD F C ABB D D D ECE D D E D E E C C C C A C G D CBDDADCCCDCCC... Date Added: 2009-06-24 13:25:43 |
| YKL068W-A.t2k.str2-logo.pdf Path: UCSC >> YKL >> 068 Fall, 2009 Description: YKL068W-A.t2k STR2 3 2 1 CC 1 A A C C A H C C H C Z C H Z Y A C C C H H A C Y T C C C H C C Z C T H C S C C A C S C S T Z H Z S Y S Z T H XXX H X XXXXXXXXXXXXXXXXXXXX C H H H X X X H T H T C C C C C S X X X X X H H X H HHHHHH XXX T H H... Date Added: 2009-06-24 13:26:58 |
| YKL089W.t2k.w0.5-logo.pdf Path: UCSC >> YKL >> 089 Fall, 2009 Description: YKL089W.t2k w0.5 6 5 4 3 2 1 Y L L D M M 10 20 30 40 H 6 5 4 3 2 1 R K T G H H H H X 51 60 70 80 90 T 6 5 4 3 2 1 H E T S T H F Y L K E X X XXX S X P A XX L S X D K A XX XXXXXXXXXXXXXXXXXXXXXXX F E D P D E E E D ... Date Added: 2009-06-24 13:27:06 |
| project36_file1.pdf Path: Lake County >> ECE >> 445 Fall, 2009 Description: SG2525A SG3525A REGULATING PULSE WIDTH MODULATORS . . . . . . . . . . 8 TO 35 V OPERATION 5.1 V REFERENCE TRIMMED TO 1 % 100 Hz TO 500 KHz OSCILLATOR RANGE SEPARATE OSCILLATOR SYNC TERMINAL ADJUSTABLE DEADTIME CONTROL INTERNAL SOFT-START PULSE-B... Date Added: 2009-06-24 13:50:11 |
| 2N5192.pdf Path: Lake County >> ECE >> 110 Fall, 2009 Description: DatasheetArchive Request For Quotation .com Order the parts you need from our real-time inventory database. Simply complete a request for quotation form with your part information and a sales representative will respond to you with price and availa... Date Added: 2009-06-24 13:55:17 |
| guidelines.pdf Path: Sveriges lantbruksuniversitet >> SHE >> 505 Fall, 2009 Description: YOUR VIDEO REPORT: UNDERSTANDING RACE VIDEO AT SCSU BULEY LIBRARY There is a very enlightening video Understanding Race by Films for the Humanities that I have placed on reserve for the class at Southern in the Curriculum Lab on the 3rd floor of Bule... Date Added: 2009-06-24 13:56:14 |
| Geometric continuity_week13.pdf Path: UF >> CIS >> 6905 Fall, 2008 Description: Geometric continuity Geometric continuity (GC) is a constructive way of describing when two manifolds meet with Ck continuity along a common interface. In essence, two manifolds A and B join Gk continuity if there exists a parameterization of A and B... Date Added: 2009-06-24 13:57:14 |
| GibbsFreeEnergyData_text_.pdf Path: MTSU >> PHYS >> 3610 Fall, 2008 Description: ... Date Added: 2009-06-24 14:00:26 |
| handout26.pdf Path: Cornell >> PHYS >> 213 Fall, 2008 Description: H igh Voltage Induction One practical application of an RL circuit is the generation of a high-voltage transient from a low-voltage DC source. a) What is the current in the inductor with the switch in position A? b) Close the switch to position B. Wh... Date Added: 2009-06-24 14:01:22 |
| chapter7_2009.pdf Path: Heartland Community College >> ACC >> 200 Fall, 2009 Description: Chapter 7 Cash and Receivables This chapter examines various aspects of accounting for cash and accounts receivable. After studying this chapter, you should be able to: 1. Identify and explain the management issues and internal control issues relate... Date Added: 2009-06-24 14:05:48 |
| YGL210W.t2k.stride-ebghtl-logo.pdf Path: UCSC >> YGL >> 210 Fall, 2009 Description: YGL210W.t2k EBGHTL 3 2 1 CC H TTTCCCCCCCTCCC H H E E T G X X X X X X X X CTT TTTTTCE H E G G X X X X X X 1 10 20 30 40 T 3 2 1 E T H T T E EE X X TCX T C 51 60 70 80 90 T 3 2 1 E T H T E T HH X X T G G G T H 3 2 1 ... Date Added: 2009-06-24 14:06:36 |
| YGL251C.t2k.dssp-ebghstl-logo.pdf Path: UCSC >> YGL >> 251 Fall, 2009 Description: YGL251C.t2k EBGHSTL 3 2 1 C X C H HCXX X X C S T H H H X X H X X C C C C H H C H H H H C H C H H H H H H H H H H H H H H H H H H H H H H H H H T H H H H C C H H H H C C C T H H C C C C XXXXXXXXXXXXXXXXXXXXXXX X X X X X X X X X X X X X X X X X ... Date Added: 2009-06-24 14:06:51 |
| alpha-Ferrite_Pearlite.pdf Path: Bethel VA >> CHE >> 418 Fall, 2009 Description: W. F. Smith, \"Foundations of Materials Science and Engineering,\" 2nd Edition, McGraw McGraw-Hill, New York, 1993. New York 1993 ... Date Added: 2009-06-24 14:07:42 |
| alphaFerritePerlite.pdf Path: Bethel VA >> CHE >> 418 Fall, 2009 Description: W. F. Smith, \"Foundations of Materials Science and Engineering,\" 2nd Edition, McGraw McGraw-Hill, New York, 1993. New York 1993 ... Date Added: 2009-06-24 14:07:44 |
| directionalposter.pdf Path: Harford CC >> ART >> 204 Fall, 2009 Description: Art 204 Typography Spring 2007 Jones Assignment No. 2 Directional Poster: From Your House to Joppa J003 _ In this assignment you will design a typographic poster that reveals the directional path between your home and the Joppa Hall J003 Mac lab st... Date Added: 2009-06-24 14:08:46 |
| Lin_Webcasting adoption.pdf Path: Kentucky >> JAT >> 520 Fall, 2009 Description: Iournal of Broadcasting & Electronic Mcdia/Svptemhei 2004 Webcasting Adoption: Technology Fluidity^ User Innovativeness, and Media Substitution Carolyn A. Lin Even though a tremendous adoption growthtriggered by the increased broadband connections t... Date Added: 2009-06-24 14:15:31 |
| Pol00F-7Week.pdf Path: Bowling Green >> ACCT >> 2102 Fall, 2009 Description: POLICIES AND RULES Principles of Accounting - ACCT 2102 Seven Weeks - Fall Semester, 2000 General Policies 1. Classroom interaction and lectures are considered to be the most important ways of learning in this course. It is your classroom experiences... Date Added: 2009-06-24 14:17:38 |
| info.pdf Path: UCSB >> ECE >> 235 Fall, 2008 Description: Department of Electrical & Computer Engineering University of California, Santa Barbara ECE 235 Fall 2007 Shynk H.O. #1 ECE 235 COURSE INFORMATION Title: Stochastic Processes in Engineering Lectures: Tuesday, Thursday 6:30 8:30 p.m., Webb Hall 11... Date Added: 2009-06-24 14:19:27 |
| Homework8.pdf Path: Delaware >> MEEG >> 332 Fall, 2008 Description: MEEG332 Fluid Mechanics II Spring 2009; TR 11:00-12:15 INSTRUCTOR Prof. L. W. Schwartz 309 Spencer Lab Office Hours: TR 5:00-6:00 PM schwartz@udel.edu ph.: 831-6830 TA Zongwen,Lu 131 Spencer Lab Office Hours: M2:00-4:00PM W10:00AM-12:00 lzwchina@udel... Date Added: 2009-06-24 14:20:24 |
| reviewfinal.pdf Path: Edinboro >> MA >> 260 Fall, 2009 Description: M ATH 260: Final Exam Topics Sections we covered this sem ester: Chapte r Chapte r Chapte r Chapte r Chapte r Ch apte r Chapte r Chapte r Chapte r Chapte r Chapte r 1 (All) 2 (All) 3 (All) 4 (All) 5 (Sec 5.1 - 5.2 Only) 6 (W e sk ipped thi... Date Added: 2009-06-24 14:35:26 |
| MSOM_2007.pdf Path: Berkeley >> ATT >> 0155 Fall, 2009 Description: Operations and Management Science Position Stephen M. Ross School of Business at University of Michigan Ann Arbor, Michigan The Operations and Management Science department of the University of Michigan Business School is seeking applicants for a ten... Date Added: 2009-06-24 14:37:37 |
| Heat_Map.pdf Path: National Taiwan University >> CSE >> 757 Fall, 2009 Description: Blockbuster Component Business Model and Heat Map Business Competencies Customers Market Strategy Customer Service Strategy Marketing Strategy Products/Services Merchandise Planning Channel Planning Assortment Planning Space Planning Promotion Planni... Date Added: 2009-06-24 14:39:45 |
| 1154worksheet5.pdf Path: Cal Poly >> MA >> 1252 Fall, 2009 Description: MA 1154 Homework 5 1. a. b. c. d. 2. a. b. c. d. 3. Show all work 4. a. b. c. d. 5. Show all work ... Date Added: 2009-06-24 14:47:13 |
| 542-Project1-A.pdf Path: Illinois Tech >> MATH >> 481 Fall, 2009 Description: 1 Prof. Tomasz R. Bielecki Math 542 - Fall 2007 Project 1 Due on Tuesday, 12/04 Your name: . Exercises 1,2,3 refer to Stochastic Calculus for Finance II: Continuous Time Models by Steven E. Shreve, Chapter 4 (also, see Lawler, Section 9.4). Exerc... Date Added: 2009-06-24 14:48:02 |
| week08.pdf Path: NSC Henderson >> GEY >> 474 Fall, 2009 Description: Week 08 Chapter 06 Soil Moisture and Ground-Water Recharge Zone of aeration > Unsaturated zone > Vadose zone Porosity and Water Content n = 100 Vv V where n is porosity, Vv is the volume of the void space, and V is the volume of the sample. Gravimet... Date Added: 2009-06-24 14:51:51 |
| 13-Hurricanes_nf.pdf Path: Indiana >> GEOG >> 109 Fall, 2008 Description: Hurricanes Readings: A&B Ch. 12 Topics Characteristics Location Structure Development a. Tropical Disturbance b. Tropical Depression c. Tropical Storm G109: Weather and Climate 1. 2. 3. 4. d. e. f. g. Hurricane Influences Path Dissipation 5. Dest... Date Added: 2009-06-24 14:53:50 |
| limits3d.pdf Path: Kennesaw >> MATH >> 2203 Fall, 2008 Description: 34 CHAPTER 3. FUNCTIONS OF SEVERAL VARIABLES 3.3 3.3.1 Limits Elementary Notions We wish to extend the notion of limits studied in Calculus I. Recall that when we write lim f (x) = L, we mean that f can be made as close as we want to xa L, by tak... Date Added: 2009-06-24 14:54:23 |
| RO1.pdf Path: Arizona >> BME >> 630 Fall, 2008 Description: ... Date Added: 2009-06-24 14:54:28 |
| teamex14.pdf Path: Wisconsin >> ECE >> 376 Fall, 2009 Description: c:\\scanned\\ece376c.TIF Page 1 ... Date Added: 2009-06-24 14:55:35 |
| Exam1FS06.pdf Path: Lake County >> ECE >> 430 Fall, 2009 Description: ... Date Added: 2009-06-24 15:06:21 |
| digilent2E_dio1_pinout.pdf Path: Walla Walla University >> ENGR >> 433 Fall, 2009 Description: Digilent 2E FPGA board with DIO1 I/O board attached FPGA Pin numbers Function SW1 SW2 SW3 SW4 SW5 SW6 SW7 SW8 BTN1 BTN2 BTN3 BTN4 BTN5 LD1 LD2 LD3 LD4 LD5 LD6 LD7 LD8 CA CB CC CD CE CF CG DP A1 A2 A3 A4 FPGA pin# 16 18 21 23 27 30 33 35 40 41 42 43 6... Date Added: 2009-06-24 15:11:19 |
| lect14.ps Path: Maryland >> CMSC >> 212 Fall, 2005 Description: %!PS-Adobe-3.0 %Title: Microsoft PowerPoint - lect14 %Creator: PScript5.dll Version 5.2.2 %CreationDate: 10/20/2005 16:15:58 %For: Owner %BoundingBox: (atend) %Pages: (atend) %Orientation: Portrait %PageOrder: Special %DocumentNeededResources: (atend... Date Added: 2009-06-24 15:14:13 |
| lect16small.ps Path: Maryland >> CMSC >> 212 Fall, 2005 Description: %!PS-Adobe-3.0 %Title: Microsoft PowerPoint - lect16 %Creator: PScript5.dll Version 5.2.2 %CreationDate: 10/27/2005 8:57:29 %For: Owner %BoundingBox: (atend) %Pages: (atend) %Orientation: Portrait %PageOrder: Special %DocumentNeededResources: (atend)... Date Added: 2009-06-24 15:14:22 |
| lect18small.pdf Path: Maryland >> CMSC >> 212 Fall, 2005 Description: Announcements G Events G Exam #2 Regrade Requests Due next Monday Many programs need to respond to external activity keyboard mouse network sensors G Reading Notes (Today) Notes (Tuesday) G Many programs can expect input from multiple so... Date Added: 2009-06-24 15:14:23 |
| week08_notes.txt Path: San Diego State >> DESIGN >> 496 Fall, 2009 Description: Adobe After Effects v8.0 (Macintosh PPC) render log for project w8_class_velocity_03.aepRendering started on 12/14/07 at 11:47:13 AM 12/14/07 11:47:13 AM: Starting composition Comp 1. Output To: 496:student_folders:decker_adam:movie collection:Comp... Date Added: 2009-06-24 15:14:33 |
| slau049d.pdf Path: Tennessee >> ECE >> 455 Fall, 2009 Description: MSP430x1xx Family User\'s Guide 2004 Mixed Signal Products SLAU049D IMPORTANT NOTICE Texas Instruments Incorporated and its subsidiaries (TI) reserve the right to make corrections, modifications, enhancements, improvements, and other changes to it... Date Added: 2009-06-24 15:14:40 |
| week08_notes.txt Path: San Diego State >> WEEK >> 496 Fall, 2009 Description: Adobe After Effects v8.0 (Macintosh PPC) render log for project w8_class_velocity_03.aepRendering started on 12/14/07 at 11:47:13 AM 12/14/07 11:47:13 AM: Starting composition Comp 1. Output To: 496:student_folders:decker_adam:movie collection:Comp... Date Added: 2009-06-24 15:14:50 |
| Introduction.pdf Path: Lake County >> ECE >> 461 Fall, 2009 Description: University of Illinois Lecture Notes Introduction to Digital Communication Systems ECE 361 Fall 1995 q q q q q q q q 1995 by Dilip V. Sarwate All rights reserved. No part of this manuscript is to be reproduced without the written consent of... Date Added: 2009-06-24 15:17:05 |
| HW07.pdf Path: Lake County >> ECE >> 461 Fall, 2009 Description: University of Illinois 1.(a) (b) Problem Set #7: Solutions Page 1 of 2 ECE 361 Fall 1998 E0 = squared distance of (c00 ,c01 ) from origin = (c00 )2 + (c 01 )2 . Similarly, E1 = (c10 )2 + (c 11 )2 . The receiver decides that s0 was transmitted if (... Date Added: 2009-06-24 15:17:26 |
| lab6_notes.pdf Path: Lake County >> ECE >> 486 Fall, 2009 Description: ... Date Added: 2009-06-24 15:23:15 |
| 4_2DissStaceyS.pdf Path: Chesapeake College >> MAT >> 113 Fall, 2009 Description: 1. Write the equation log 5 125 = y in its equivalent exponential form. Solution: log 5 125 = y Use the fact that y = log b x means b y = x y So using that we can conclude that . log 5 125 = y Means 5 = 125 2. Write the equation 8 = 300 in its equiva... Date Added: 2009-06-24 15:23:21 |
| Dongri_Luo.pdf Path: FIU >> KCHAT >> 001 Fall, 2009 Description: Dongri Luo Computer Network Information Center Chinese Academy of Sciences Phone: +8610-5881-2354 Email: luodongri@cnic.cn EDUCATION: 2006.9-2009.8 Computer Network Information Center ,Chinese Academy of Sciences, Beijing, China. Master of Computer ... Date Added: 2009-06-24 15:23:44 |
| Guangyuan_Liu.pdf Path: FIU >> KCHAT >> 001 Fall, 2009 Description: Guangyuan Liu Computer Network Information Center Chinese Academy of Sciences lgy@cnic.cn +86 010 5881 2352 Education 2002 2006 Shandong University Bachelor of engineering degree in computer science and technology 2006 - Now Computer Network Info... Date Added: 2009-06-24 15:23:45 |
| hw3_96.pdf Path: Uni. Worcester >> CS >> 504 Fall, 2008 Description: C.S.504 H.W. #3 Due: October 16/21, 1996 1. (5 points) In chess, two rooks attack each other if they are on the same row or on the same column. What is R(n,k), the number of ways to place k nonattacking rooks on an nXn chessboard? For example, R(3,0)... Date Added: 2009-06-24 15:25:19 |
| orientation.pdf Path: University of Toronto >> MAT >> 1300 Fall, 2009 Description: 9.12 Recall Orientation for Manifolds Denition 9.12.1 A (paracompact) Hausdor space M is called an n-dimensional manifold of for each x M open neighbourhood U of x s.t. U is homeomorphic to R n . U is called an open coordinate neighbourhood. (If ... Date Added: 2009-06-24 15:44:12 |
| rrj ch 7.doc Path: Penn State >> KCM >> 5050 Fall, 2009 Description: Reading: SUMMARY: CONNECTION: Peer talking should not be discouraged, it In my placement, I have been should be considered a powerful tool for trying to do some good group learning work in my classroom. I have found some of the classroom Cooperati... Date Added: 2009-06-24 15:46:43 |
| EOC_Solution_21_38.pdf Path: Cal Poly >> PHYS >> 132 Fall, 2009 Description: 21.38. Visualize: Please refer to Figure 21.4. Solve: You can see in Figure 21.4 that the time between two successive instants when the antinodes are at maximum height is half the period, or 1 T . Thus T = 2(0.25 s) = 0.50 s, and so 2 1 1 v 3.0 m / s... Date Added: 2009-06-24 15:57:47 |
| SampleScores.txt Path: Illinois State >> ITK >> 168 Fall, 2008 Description: Last Name,First Name,Labs,Mid1,Mid2,Final Test 43 : Total students McWilliams,Michael,86.2,90.0,79.0,80, Norris,Kate,87.7,72.0,62.0,77, Sterling,Benjamin,83.8,84.0,70.0,77, Sims,Claire,71.5,77.0,62.0,72, Ouderkirk,Matthew,60.8,60.0,39.0,62, Kaluza,Kr... Date Added: 2009-06-24 16:02:29 |
| YJL020C.t2k.dssp-ebghstl-logo.pdf Path: UCSC >> YJL >> 020 Fall, 2009 Description: YJL020C.t2k EBGHSTL 3 2 1 CCCC CCC CC CC CC C T X S E E B TBSGTESSSSSTTTTGGS T T T T T B S STBTBBTTBS S S T S B T T S S G E S E G E T G E T S B T B E T S G T T S B X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X XXXXXXXTEXXX... Date Added: 2009-06-24 16:03:08 |
| VashonLetter.pdf Path: Cleveland State >> HIS >> 215 Fall, 2009 Description: Collection: African American Newspapers Publication: THE NORTH STAR Date: June 13, 1850 Title: African Colonization. The following letter from Mr. Vashon should Location: Rochester, New York African Colonization. The following letter from Mr. Vashon ... Date Added: 2009-06-24 16:09:33 |
| midtermboard.pdf Path: Oregon >> ARCH >> 384 Fall, 2008 Description: Amanda Asa ARCH 384 Diego Urrutia Midterm Review Spring 2009 where adventure is the destination conference room offices kitchen conference room storage SECTION 01 RR RR down deck The concept behind the Springfield Outdoor Exploraiton Stati... Date Added: 2009-06-24 16:12:16 |
| T0411.t06.str2-logo.pdf Path: UCSC >> T >> 0411 Fall, 2009 Description: T0411.t06 str2 5 4 3 2 1 1 10 20 30 40 H 5 4 3 2 1 TS T T H T T QP Q G 51 60 70 80 90 H 5 4 3 2 1 T T T TG H T T QP Q S 101 110 120 H T T Q PQ S H 130 GKRGGEAQKVASSHGYSNTSLYPGSMNDWVSHGGDKLDL T 100 EYSIVHIP... Date Added: 2009-06-24 16:16:44 |
| 134.pdf Path: Yale >> GEOLOGY >> 1980 Fall, 2009 Description: ... Date Added: 2009-06-24 16:17:37 |
| 060119_ZPD256B07.pdf Path: Wisconsin >> SH >> 060119 Fall, 2009 Description: ... Date Added: 2009-06-24 16:18:27 |
| sh060119_tilt04.pdf Path: Wisconsin >> SH >> 060119 Fall, 2009 Description: 100 10 mean( 2 50 Hz) mean( 51 99 Hz) mean( 100 148 Hz) mean( 149 197 Hz) mean( 198 246 Hz) Tilt Power (binned by frequency) vs Time sh060119 5 0 21.5 21.6 21.7 21.8 21.9 22 100 10 mean( mean( mean( mean( mean( 247 296 345 393 442 2... Date Added: 2009-06-24 16:18:33 |
| figureSO_33.html.doc Path: Ill. Chicago >> CHEM >> 52409 Fall, 2009 Description: ... Date Added: 2009-06-24 16:19:39 |
| Joanne Koegler.doc Path: Charleston Law >> BU >> 468 Fall, 2009 Description: Article Summary Reaching & Changing Frontline Employees Submitted By: Joanne Koegler 960158640 Submitted To: Gene Deszca Class: BU 468 Date: March 22, 2000 Article: Reaching and changing frontline employees Source: Harvard Business Review, May/June... Date Added: 2009-06-24 16:19:52 |
| assgn3ex3.pdf Path: BU >> CS >> 320 Fall, 2009 Description: BU CAS CS 320 (Summer I, 2009) Concepts of Programming Languages Assignment 3 Due: June 8, 2009 Total: 150 points Exercise 1 (30 points) See the on-line le assignment3.sats. Exercise 2 (50 points) See the on-line le assignment3.sats. Exercise 3 (70 ... Date Added: 2009-06-24 16:21:59 |
| p25Process.pdf Path: ASU >> CSE >> 562 Fall, 2009 Description: Version 1.0 p25Process.fm 6 Framework Services to Support Life-Cycle Processes 6.1 Conceptual Definition and Rationale (1) Framework services for life-cycle processes provide support for defining, carrying out, and tracking system development for ... Date Added: 2009-06-24 16:22:08 |
| Penta.ppt Path: Maryland >> PHYS >> 402 Spring, 2002 Description: Pentaquarks and Large Nc QCD: The Good, The Bad and The Ugly Apologies Large Nc and the existence of exotics Large Nc and multiplets of exotics Apologies TheLatinisinduedeferenceto MeaMaximaCulpa Linguistic theCouncilofTrento Talking about pe... Date Added: 2009-06-24 16:22:46 |
| syllabus.ps Path: Stevens >> CS >> 601 Fall, 2009 Description: %!PS-Adobe-2.0 %Creator: dvips(k) 5.86 Copyright 1999 Radical Eye Software %Title: syllabus.dvi %Pages: 2 %PageOrder: Ascend %BoundingBox: 0 0 612 792 %EndComments %DVIPSWebPage: (www.radicaleye.com) %DVIPSCommandLine: dvips syllabus -o %DVIPSParamet... Date Added: 2009-06-24 16:24:03 |
| 2078.txt Path: UNC >> DOCS >> 2078 Fall, 2009 Description: The Project Gutenberg EBook of Thais, by Anatole France This eBook is for the use of anyone anywhere at no cost and with almost no restrictions whatsoever. You may copy it, give it away or re-use it under the terms of the Project Gutenberg License ... Date Added: 2009-06-24 16:26:11 |
| hw7.pdf Path: UF >> CDA >> 3101 Fall, 2008 Description: CDA 3101: HW 7 assignment (revised) Assigned Fri. Oct 28, due Fri. Nov 4. All problems are from the textbook unless otherwise specied. Turn hardcopy in class, stapled, with your name and CDA 3101 Homework 7 clearly printed on it. As a reminder, the... Date Added: 2009-06-24 16:26:20 |
| ferne_2006_saem_bic_ha_fcd.pdf Path: Ill. Chicago >> SAEM >> 0506 Fall, 2009 Description: The Emergency Department Evaluation of Patients with a Sudden or Severe Headache Learning Objectives Review the optimal way in which the clinical evaluation, diagnostic testing, and treatment of Emergency Department patients with acute cephalgia an... Date Added: 2009-06-24 16:36:38 |
| hw3sol.pdf Path: Maryland >> ENEE >> 312 Fall, 2008 Description: ... Date Added: 2009-06-24 16:52:44 |
| Lecture 16 (February 20 2008).ppt Path: St. Francis IL >> CHEM >> 255 Fall, 2009 Description: Lipids and Membranes Saturated vs Unsaturated Saturated (no DBs) Less fluid, pack close together Higher melting points Often solid at RT Unsaturated (one or more DBs) DB are cis configuration Lower melting points Likely liquid at RT FAs Nom... Date Added: 2009-06-24 16:53:00 |
| Syllabus163Spr08.pdf Path: Concordia Chicago >> MATH >> 163 Fall, 2008 Description: Math 16300, section 33 Spring 2008 Karen Lange Office: Math/Stat 202 E-mail: klange@math.uchicago.edu Course Website: www.math.uchicago.edu/~klange/163Spr08.html Office Hours: Friday 4-5 PM, Sunday 12:30-2:00 PM, and one other hour to be determined. ... Date Added: 2009-06-24 16:54:13 |
| 621hw3_06.pdf Path: SUNY Albany >> AECO >> 621 Fall, 2009 Description: ECO621 Spring 2006 HOMEWORK SET #3 DUE February 16 ~ ~ x~ ~ 1. Let the 1 m random vector x N ( ; ). Partition x = (~1 x2 ), where x1 is 1 m1 and x2 is 1 m2 (m1 + m2 = m). Partition and conformably. ~ a. Transform y1 y2 ) = (~1 x2)C , where ~ x~ ?1 C ... Date Added: 2009-06-24 17:02:55 |
| 04.patnt.pdf Path: Mich Tech >> GENENG >> 3000 Fall, 2009 Description: ENG 3000 Session 4 The Design Process II Patents and Engineering Patent Search and Presentations /home/engfac/oppliger/classes/eng3000/04.patents.sdd Engineering Design Process (review) 1) Identify the problem or need 2) Clarify specifications Wha... Date Added: 2009-06-24 17:06:03 |
| 2008925_r01o_0600267.pdf Path: Stanford >> NATRE >> 1035 Fall, 2009 Description: IN THE UNITED STATES COURT FOR THE DISTRICT OF UTAH CENTRAL DIVISION IN RE NATURES SUNSHINE PRODUCTS INC. SECURITIES LITIGATION MEMORANDUM DECISION AND ORDER GRANTING IN PART PLAINTIFFS MOTION FOR CLASS CERTIFICATION, APPOINTMENT OF CLASS REPRESENTA... Date Added: 2009-06-24 17:07:16 |
| slau049d.pdf Path: UNC Charlotte >> MSP >> 430 Fall, 2009 Description: MSP430x1xx Family User\'s Guide 2004 Mixed Signal Products SLAU049D IMPORTANT NOTICE Texas Instruments Incorporated and its subsidiaries (TI) reserve the right to make corrections, modifications, enhancements, improvements, and other changes to it... Date Added: 2009-06-24 17:07:26 |
| slau049dnew.pdf Path: UNC Charlotte >> MSP >> 430 Fall, 2009 Description: MSP430x1xx Family User\'s Guide 2004 Mixed Signal Products SLAU049D IMPORTANT NOTICE Texas Instruments Incorporated and its subsidiaries (TI) reserve the right to make corrections, modifications, enhancements, improvements, and other changes to it... Date Added: 2009-06-24 17:07:26 |
| YPL110C.t2k.w0.5-logo.pdf Path: UCSC >> YPL >> 110 Fall, 2009 Description: 4 3 2 1 E H M A X XXXXXXXXXXXXXXXXX K R V S Y N G L L E L L I N G L K Q P S D E K G N I D F L XX A G D XXXXXXXX XXXXXXXXXXXXXXXXXXXX S L D L K T D V A L L I H A A L N E H N D G E L V E L S L L A L L G L X L X T 4 3... Date Added: 2009-06-24 17:08:12 |
| lecture13.pdf Path: University of Illinois, Urbana Champaign >> ASTRO >> 230 Fall, 2009 Description: Astronomy 230 This class (Lecture 13): Life in the Solar System Heath Murra Joel Bonasera Midterm 1 hour exam in this classroom. It will cover mater... Date Added: 2009-06-24 17:10:04 |
| page16.pdf Path: Kent State >> MATH >> 61052 Fall, 2008 Description: ... Date Added: 2009-06-24 17:12:05 |
| page25.pdf Path: Kent State >> MATH >> 61052 Fall, 2008 Description: ... Date Added: 2009-06-24 17:12:07 |
| page52.pdf Path: Kent State >> MATH >> 61052 Fall, 2008 Description: ... Date Added: 2009-06-24 17:12:12 |
| register-sheet.pdf Path: Michigan >> EECS >> 203 Fall, 2008 Description: ... Date Added: 2009-06-24 17:13:46 |
| matched_t_pairs.doc Path: El Paso CC >> MATH >> 244 Fall, 2009 Description: Matched t Pairs The Matched t Pairs is a great way of increasing the probability that you will actually detect the effect you are seeking. Lets consider a medical situation. About a year ago I read an article concerning the effectiveness of birth co... Date Added: 2009-06-24 17:15:21 |
| Access Project 3.ppt Path: N.E. Illinois >> CS >> 317 Fall, 2009 Description: M i c r o s o f t Office 2003 Introductory Concepts and Techniques Access Project 3 Maintaining a Database Using the Design and Update Features of Access Objectives Add, change, and delete records Search for records Filter records Update a ta... Date Added: 2009-06-24 17:20:02 |
| 07070715.pdf Path: Wisconsin >> TC >> 070707 Fall, 2009 Description: ... Date Added: 2009-06-24 17:22:42 |
| Session 6.ppt Path: UMKC >> BMA >> 360 Fall, 2008 Description: Staffing BMA 360 Session 6 Human Resource Management Interpret practices support the entire organization Explain the importance of the person-joborganization match and how it can be established Planning for human resou... Date Added: 2009-06-24 17:23:08 |
| 23699.txt Path: UNC >> DOCS >> 23699 Fall, 2009 Description: The Project Gutenberg EBook of Abijah\'s Bubble, by F. Hopkinson Smith This eBook is for the use of anyone anywhere at no cost and with almost no restrictions whatsoever. You may copy it, give it away or re-use it under the terms of the Project Gute... Date Added: 2009-06-24 17:28:16 |
| Lec07-division.pdf Path: North-West Uni. >> ECE >> 361 Fall, 2009 Description: Computer Architecture ECE 361 Lecture 7: ALU Design : Division 361 div.1 Outline of Todays Lecture Introduction to Todays Lecture Divide Questions and Administrative Matters Introduction to Single cycle processor design 361 div.2 1 Divide: ... Date Added: 2009-06-24 17:31:41 |
| YML123C.t2k.w0.5-logo.pdf Path: UCSC >> YML >> 123 Fall, 2009 Description: YML123C.t2k w0.5 4 3 2 1 XXX E P E E D X E X E D L L XXXXXXX E L A L X D S N S L X X X L X X XXXXX I L D L T S A XXX S S E D S S R X X X X X E S L E L T X X X X D L X A XXXXXXX S L A L L L XXXXXXX L A S V S L 1 10 ... Date Added: 2009-06-24 17:31:50 |
| financialmanagement.pdf Path: Michigan State University >> AEC >> 853 Spring, 2008 Description: Spring 2002 AEC 853 Financial Management in Agriculture SELECTED READINGS Background Reading on the U.S. Food Industry Beierlein, et. al. Principles of Agribusiness Management, Chapter 1. Barry, et. al. Financial Management in Agriculture, Chapter ... Date Added: 2009-06-24 17:34:59 |
| 23974-readme.txt Path: UNC >> DOCS >> 23974 Fall, 2009 Description: The Project Gutenberg EBook The Tao Teh King, or the Tao and its Characteristics by Lao-Tze This eBook is for the use of anyone anywhere at no cost and with almost no restrictions whatsoever. You may copy it, give it away or re-use it under the t... Date Added: 2009-06-24 17:39:30 |
| basicUnixCommands.pdf Path: North-West Uni. >> CS >> 340 Fall, 2009 Description: Getting around in Linux/Unix Alan M. Durham Computer Science Department University of So Paulo, Brazil alan@ime.usp.br 3/26/2003 Prof. Alan Durham - IBI5011 Introd. Comp. para Bioinformtica - USP 1 Logging in: everyone is a user Unix/linux ... Date Added: 2009-06-24 17:47:08 |
| hardVmag.txt Path: Berkeley >> ASTRO >> 00113120 Fall, 2009 Description: chi^2/nu= 64.261552 / 1580.00 The fit is rejectable at 0.0000000 % Confidence #index t1 t2 fade_index delta_mag_pk hindex dhindex rate1 drate1 rate2 drate2 logr dlogr 0 0.1328 0.1532 -2.29 0.0 0.46 1.49 1.09E+0... Date Added: 2009-06-24 17:47:45 |
| Homework Set 4-revised.pdf Path: Portland >> MTH >> 582 Fall, 2008 Description: MTH4 /582 Spring 2009 Homework Set 4 Due Date: Wednesday June 3rd 1. Read the article from Chance Magazine (Vo. 21, No.4/Fall 2008). Write a short reflection about the article. In particular, a. Discuss what you learned from the article. b. Discuss... Date Added: 2009-06-24 17:47:49 |
| Lab 4.pdf Path: Portland >> MTH >> 582 Fall, 2008 Description: Math482/582 Spring2009 Lab 4 Name(s) _ In this lab we will explore the relationship between women tennis players rankings and their earnings. The data set below provides information from the Womens Tennis Association on earnings and rankings for ... Date Added: 2009-06-24 17:47:51 |
| Terminology_studysheet2_09.pdf Path: UCSB >> G >> 191 Fall, 2009 Description: Geog 191 Terminology: Linear programming problem Three components of an optimization problem canonical form slack variable surplus variable artificial variable simplex method role of reduced costs, ratio test, pivot operations eco... Date Added: 2009-06-24 17:48:04 |
| C1_e3_su_08.doc Path: UNC Wilmington >> CHM >> 101 Fall, 2009 Description: CHM101 NAME Exam III Summer 2008 Raw Score TScore You will have 75 minutes to complete the exam. There is one best answer to each question and all questions are worth the same number of points. Sign your name on the answer sheet above the Gen... Date Added: 2009-06-24 17:52:44 |
| Chapter06.xls Path: YCP >> ACC >> 220 Fall, 2009 Description: CHAPTER 6 MERCHANDISING ACTIVITIES OVERVIEW OF BRIEF EXERCISES, EXERCISES, PROBLEMS, AND CRITICAL THINKING CASES Brief Exercises B. Ex. 6.1 B. Ex. 6.2 B. Ex. 6.3 B. Ex. 6.4 B. Ex. 6.5 B. Ex. 6.6 Topic Computation of gross profit Accounts receivable s... Date Added: 2009-06-24 17:55:48 |
| hahn.pdf Path: Washington >> GS >> 55104 Fall, 2009 Description: ... Date Added: 2009-06-24 18:04:50 |
| Lewisstruct.pdf Path: Grossmont >> CHEMISTRY >> 141 Fall, 2009 Description: Lewis Structures General Chemistry I Guidelines for Drawing Lewis Structures Rules 1. Determine the skeleton structure. (a) H is always a terminal atom and has only one bond. (b) In simple compounds, O and X (halogens) are terminal atoms. If X is... Date Added: 2009-06-24 18:05:43 |
| aminesamideswhst key.doc Path: Grossmont >> CHEMISTRY >> 116 Fall, 2009 Description: WORKSHEET FOR AMINES AND AMIDES 1. Show by means of an equation how ethylamine can act as a base. H2 C H3C NH2 H2 C H3C NH3+Cl- + HCl 2. Compare the solubility of methylethylamine with 1-propanol and explain the difference. Both compound have abo... Date Added: 2009-06-24 18:05:46 |
| curriculum plan.doc Path: Lehigh >> JLH >> 210 Fall, 2008 Description: Jesse Huth Curriculum for an IBE Major in Industrial Engineering Freshman Year Fall Semester Eck 081 4 Phy 11 4 Phy 12 1 Math 23 4 IBE 95 1 Engr 1 3 Wind Ens. 1 Total 18 Spring Semester Acct 151 3 Comm 160 4 Eco 1 4 Phys 21 4 Phys 22 1 IBE Workshop 3... Date Added: 2009-06-24 18:06:06 |
| q04sol.pdf Path: CSU Northridge >> COMP >> 182 Fall, 2009 Description: (Y rAmr/i~ ~ 15\'7 2J)\'\" ~ .z.(~ ~ l !aIM2-74~h /\" -rk~ \" \"\'-\"\'4\'D 51? . ~ . . ~ _ 1~o 2-74- ~ mk: J~\'f 3+f) ~ . - . 1?1 / ~ I~ . 2(3 /~ \'340 ~ 7\'k r\';\'fbi\' -r:JO /\". \'6l7 1Bo It> uu.s Jf7-~ h~ Ut/n t- ~.r)#f,fe, ~bu-1nL (]f... Date Added: 2009-06-24 18:08:54 |
| Vecchi08.pdf Path: Arizona >> GEOG >> 530 Fall, 2008 Description: Eos, Vol. 89, No. 9, 26 February 2008 Examining the Tropical Pacifics Response to Global Warming PAGES 81, 83 The response of the tropical Pacific to increasing greenhouse gases represents an exciting intersection of theory, modeling, and observatio... Date Added: 2009-06-24 18:12:31 |
| Final Paper presentation Path: Cornell >> ECON >> 4730 Fall, 2008 Description: Balloga, 1 Abram Balloga ECON 4730 Final Paper 12/5/08 Staple Theory and Catching up Process My research paper will analyze south East Asian economies and the catching up process through the lens of Staple Theory. A staple economy is one relying on o... Date Added: 2009-06-25 14:59:29 |
| T0412.t04.w0.5-logo.pdf Path: UCSC >> T >> 0412 Fall, 2009 Description: T0412.t04 w0.5 3 2 1 1 10 20 30 40 G 3 2 1 H T ZYA ZT SYZA ZY Z 51 60 70 80 90 T 3 2 1 ZYZYH T H T T H 101 110 120 130 140 T 3 2 1 T T YA Y TS ZYQPQ GH 151 160 H 170 KQNYDRYLELLLNGVQQLKKSDSFHQPI T 150 MARI... Date Added: 2009-06-25 18:20:20 |
| T0412.t2k.w0.5-logo.pdf Path: UCSC >> T >> 0412 Fall, 2009 Description: T0412.t2k w0.5 3 2 1 1 10 20 30 40 S 3 2 1 H TS YA ZT A ZYZ S YZ 51 60 70 80 90 T 3 2 1 ZY H H T H 101 110 120 130 140 T 3 2 1 T T ZA YZYZ T S ZA 151 160 H 170 KQNYDRYLELLLNGVQQLKKSDSFHQPI T 150 MARIRQVREQ... Date Added: 2009-06-25 18:20:27 |
| HD108639.bigplot.ps.ps Path: Cal Poly Pomona >> A >> 12013 Fall, 2009 Description: %!PS-Adobe-2.0 %Title: PS-File including EPS-File HD108639.bigplot.ps %Creator: Andy\'s eps2ps Utility, Ver. 0.00 %For: penprase@aci5.astronomy.pomona.edu %Pages: 1 %Orientation: Portrait %BoundingBox: (atend) %DocumentFonts: (atend) %BeginSetup %Incl... Date Added: 2009-06-25 18:22:00 |
| warehouse-management.pdf Path: Allan Hancock College >> CS >> 9116 Fall, 2009 Description: A Warehouse Management System COMP9116 Project Draft Requirements September 8, 2005 Due date Week 14 Please note: this is a draft assignment specication. Please notify any problems in the specication. 1 The project The project is to construct a sp... Date Added: 2009-06-25 18:22:38 |
| DensityEstimation.pdf Path: Utah State >> CS >> 7680 Fall, 2008 Description: Statistical Learning Statistical Learning: Density Estimation - Nonparametric Techniques Xiaojun Qi The relationship between the observations and their labels (i.e., the semantic interpretations of the observations) can be modeled probabilistically.... Date Added: 2009-06-25 18:24:18 |
| 46_NatalieR.pdf Path: Allan Hancock College >> LINKS >> 131 Fall, 2009 Description: architectural ghost strategy diagrams Ghosted Civic Precinct NATALIE ROBINSON In The Fall of Public Man Richard Sennett describes the failure of the modernist civic space, arguing that dead public space contributes to why people turn inwards, isolat... Date Added: 2009-06-25 18:24:40 |
| mm1.ppt Path: Illinois State >> EAF >> 512 Fall, 2009 Description: MIXED METHODOLOGY CombiningQualitativeand QuantitativeApproaches Chapter1 TrishaKlassEAF510 PARTI ParadigmsandPolitics ofResearch Chapter1 IntroductiontoMixedMethod andMixedModelStudiesinthe SocialandBehavioralSciences PARADIGMWARSAND MIXEDMET... Date Added: 2009-06-25 18:25:13 |
| hw3.pdf Path: Auburn >> INSY >> 3400 Fall, 2008 Description: INSY 3400 STOCHASTIC OPERATIONS RESEARCH (due date: September 24, 2001) Name:_ 1. Problem 1 page 753. ID:_ 2. Problem 2 page 753. Homework No: 2 1 3. Problem 4 page 753. 4. Problem 6 page 753. Homework No: 2 2 5. Problem 8 page 753. 6. Pro... Date Added: 2009-06-25 18:27:45 |
| YIL014W.t2k.dssp-ehl2-logo.pdf Path: UCSC >> YIL >> 014 Fall, 2009 Description: YIL014W.t2k DSSP-EHL2 2 1 C C H E C H C C C H H C C C C C C C H C C X X X X X X X X X X X X E C X X X X X X X X X X X X X X H C HHH 1 10 20 30 40 H 2 1 CCCC X H E C C C X X X X X X X E T E T T H H H H C C X X X C X C C C C X ... Date Added: 2009-06-25 18:29:04 |
| YIL066W-A.t2k.str2-logo.pdf Path: UCSC >> YIL >> 066 Fall, 2009 Description: YIL066W-A.t2k STR2 3 2 1 CC 1 AEZ Z ZA Z C H Z CCCT ZZHHMQMMCCCCSTCYCCC A CHA T C C C H Z Y YYZSSC Y YAASCCS Y C C C H T C C E H Y M C H H SSTCC H H C A S T H C H T H Q H S SHGGTH T H C H T Y H CC C Z P Z E Y P H P C Z S P Y C H H C Q C XXXXHX X X ... Date Added: 2009-06-25 18:29:13 |
| IAT201_Week10.pdf Path: Sveriges lantbruksuniversitet >> IAT >> 201 Fall, 2009 Description: Evaluation IAT 201 Week 10 Lyn Bartram Administrivia Quiz will be marked by the end of tomorrow We will email you about pickup options Experiment participant search E m a il l y n @ s fu . c a These slides were adapted from Sharp, Preece, Roge... Date Added: 2009-06-25 18:31:58 |
| solutions.pdf Path: Allan Hancock College >> COMP >> 309 Fall, 2009 Description: Question 1 (a) 2 7320 1 1 3 1 1 3 3211 1 Solution (a) 2 7320 1 1 3 1 1 3 3211 1 13 17 16 32 3 3 = 3 14 23 0 1 8 13 26 4 10 13 3 3 = 0 1 4 10 [5 marks] (b) Explain how and why Linux Threads, as implemented by Xavier Leroy, and the P... Date Added: 2009-06-25 18:32:53 |
| jcven10.txt Path: UNC >> DOCS >> 2957 Fall, 2009 Description: *The Project Gutenberg Etext of Venice, by Jacques Casanova* #7 in our series by Jacques Casanova Copyright laws are changing all over the world, be sure to check the laws for your country before redistributing these files! Please take a look at th... Date Added: 2009-06-25 18:36:20 |
| tp4.txt Path: Neumont >> IFT >> 1166 Fall, 2009 Description: IFT1166 - Travail pratique #4 - 06/04/98 CALCULATRICE INTERACTIVE Marc Feeley - Le TP4 a pour but de vous faire pratiquer la matire suivante: - hritage simple, ... Date Added: 2009-06-25 18:38:04 |
| prob4.pdf Path: UPR Mayagüez >> ICOM >> 4015 Fall, 2009 Description: Universidad de Puerto Rico Recinto Universitario de Mayagez Departamento de Ingeniera Elctrica y de Computadoras ICOM 4015: Programacin Avanzada Problemario 4 (Entregar 21-Noviembre-2001) Es este problemario continuars expandiendo la funcionalidad d... Date Added: 2009-06-25 18:38:07 |
| resume.doc Path: SUNY Albany >> NJ >> 7043 Fall, 2009 Description: Nierria Jones E-mail: socaqueen05@hotmail.com 110C Essex Circle 597 East 59th Street Guilderland, NY 12222 Brooklyn, NY 11234 518. 869. 9748 718. 763. 6883 _ OBJECTIVE: To obtain a position, with your company, that will allow me to utilize my marketi... Date Added: 2009-06-25 18:39:34 |
| chap8.doc Path: Penn State >> KLT >> 5057 Fall, 2009 Description: KatlynTaylor 11607 MIS204 Chap8 1. Standaloneutilityprogramsofferimprovementsoverfeaturesbuiltintotheoperating systemorprovidefeaturesnotincludedintheoperatingsystem. 2. Networkoperatingsystemsareoperatingsystemsthatorganizeandcoordinatehow multiple... Date Added: 2009-06-25 18:42:14 |
| hw.txt Path: Georgia Tech >> CS >> 1321 Fall, 2008 Description: Here is a list of homework problems intended to be due sometime after Oct 5, 2001. Due dates seem to be under questioning, but these problems still look good. We can certainly change this, but these are the ones I feel are more significant. Look t... Date Added: 2009-06-25 18:44:03 |
| NS9pframes.pdf Path: Texas A&M >> ENDS >> 231 Fall, 2008 Description: ENDS 231 Note Set 9 F2007abn Pinned Frames and Arches A FRAME is made up of members where at least one member has more than 3 forces on it - Usually stationary and fully constrained A PINNED FRAME has member connected by pins - Considered non... Date Added: 2009-06-25 18:44:10 |
| workex.pdf Path: Texas A&M >> ARCH >> 331 Fall, 2008 Description: ARCH 331 S2009abn ARCH 331. Examples of Work The format required by the syllabus for the assignments (see below) is enforced in order for you to practice organization with respect to problem solving (as well as necessary record keeping). Although i... Date Added: 2009-06-25 18:44:12 |
| pa2.doc Path: UPR Mayagüez >> PA >> 4029 Fall, 2009 Description: ICOM 4029 Compiler Writing 2 Handout Programming Assignment II Due Friday, September 24, 2004 i. Overview Programming assignments II-V will direct you to design and build a compiler for Cool. Each assignment will cover one component of the compiler... Date Added: 2009-06-25 18:46:26 |
| p26_021.pdf Path: St. Michael >> CH >> 212 Fall, 2009 Description: 21. The charges on capacitors 2 and 3 are the same, so these capacitors may be replaced by an equivalent capacitance determined from 1 1 C2 + C3 1 = + = . Ceq C2 C3 C2 C3 Thus, Ceq = C2 C3 /(C2 + C3 ). The charge on the equivalent capacitor is the sa... Date Added: 2009-06-25 18:47:48 |
| 20042SummerNJITPhys202011grades.doc Path: NJIT >> PHYS >> 202 Fall, 2009 Description: New Jersey Institute of Technology College of Science and Liberal Arts Department of Physics Introductory Astronomy and Cosmology, Section 011 Phys 202011 Summer 2004 Mondays, 09:00 a.m. to 10:40 a.m. Kupfrian Hall, Room 108 Tuesdays, 09:00 a.m. to 1... Date Added: 2009-06-25 18:53:03 |
| SRNotes.ppt Path: Oregon State >> PH >> 203 Spring, 2008 Description: Which law is also known as the law of inertia? 1. Newtons First Law 2. Newtons Second Law 3. Newtons Third Law 4. Murphys Law 5. None of the above. 4/1/09 Oregon State University PH 203M, Lecture #1 1 Q: What is an inertial reference frame? A: It... Date Added: 2009-06-25 18:54:19 |
| OceanCirc-fig5.4.pdf Path: Rutgers >> MS >> 451 Fall, 2004 Description: from Ocean Circulation, A. Colling (Editor), The Open University, 2nd edition, 286pp., ButterworthHeinemann, Boston, 2001. ... Date Added: 2009-06-25 18:55:49 |
| hardVmag.txt Path: Berkeley >> ASTRO >> 00152325 Fall, 2009 Description: chi^2/nu= 8.9201974 / 66.0000 The fit is rejectable at 4.1065542e-16 % Confidence #index t1 t2 fade_index delta_mag_pk hindex dhindex rate1 drate1 rate2 drate2 logr dlogr 0 64.1015 86.5108 -0.26 0.0 0.03 3.21 5.13E-0... Date Added: 2009-06-25 18:56:57 |
| Lecture12.ppt Path: Eckerd >> CS >> 110 Fall, 2009 Description: CS110 Lecture12 Homework 6 assigned today, due after Spring Break Quiz or Quiz Show on Thursday Today\'s lecture: Binary numbers and other number systems Today\'s lab: Meyer Lab 2 12-1 Chapter 2 Binary Values and Number Systems Modifications by H... Date Added: 2009-06-25 18:57:23 |
| Question 6.doc Path: N.E. Illinois >> CIS >> 3900 Fall, 2009 Description: Question 6 I have written a java program to display one poker hand. There are no listeners in the program. The only thing the user can do right now is close (X) the window. Modify the program to allow the user to click on up to four cards. If the use... Date Added: 2009-06-25 18:58:58 |
| 1169_exam2005a.pdf Path: Allan Hancock College >> PHYS >> 1169 Fall, 2009 Description: ... Date Added: 2009-06-25 19:07:01 |
| collegeRequirements.pdf Path: Delaware >> CIS >> 475 Fall, 2009 Description: C OLLEGE OF ARTS AND SCIENCES COLLEGE OF ARTS AND SCIENCES UNDERGRADUATE PROGRAMS Geography History Irish Studies Islamic Studies Jewish Studies Journalism Latin American Studies Legal Studies Liberal Studies Linguistics and Cognitive Scie... Date Added: 2009-06-25 19:07:32 |
| Assignment05.ps Path: Toledo >> ASSIGNMENT >> 334 Fall, 2009 Description: %!PS-Adobe-2.0 %Creator: dvips(k) 5.86 Copyright 1999 Radical Eye Software %Title: Assignment05.dvi %Pages: 2 %PageOrder: Ascend %BoundingBox: 0 0 612 792 %DocumentFonts: CMBX12 CMR10 CMMI10 CMR8 CMSY10 CMSY8 CMMI8 CMR6 CMBX10 %+ CMEX10 %EndComments ... Date Added: 2009-06-25 19:07:41 |
| Exam1 Details.doc Path: Dallas >> EE >> 6331 Fall, 2008 Description: EE6331 Exam 1 Details The first exam for EE 6331 will be in the TI Auditorium(ECSS2.102) at 4 pm on Thursday, February 14. ... Date Added: 2009-06-25 19:10:04 |
| The road ahead for capitalism in China.pdf Path: University of Hawaii - Hilo >> COB >> 205 Fall, 2009 Description: 2006 special edition The road ahead for capitalism in China Article at a glance Two starkly contrasting possible futures exist for China: a market economy under the rule of law or crony capitalism. The right way ahead lies in furthering economic, s... Date Added: 2009-06-25 19:13:21 |
| h8.pdf Path: Rutgers >> CS >> 171 Fall, 2009 Description: CS 171 Homework Assignment 8 Given: November 02, 2005 Due: November 09, 2005 This assignment is due by the end of class on the due date. The point value of each problem is shown in [ ]. To receive full credit all your answers should be carefully jus... Date Added: 2009-06-25 19:13:35 |
| Biology.xls Path: Uni. Westminster >> AIS >> 0816 Fall, 2009 Description: Column1 Mean 595.07 Standard Error 5.22 Median 597 Mode 566 Standard Deviation 28.61 Sample Variance 818.75 Kurtosis -1.04 Skewness 0.19 Range 96 Minimum 551 Maximum 647 Sum 17852 Count 30 t-Test: Two-Sample Assuming Unequal Variances Variable 1 Var... Date Added: 2009-06-25 19:23:35 |
| S5.pdf Path: Duke >> STA >> 122 Fall, 2008 Description: R2WinBUGS tutorial By Hedibert Freitas Lopes Graduate School of Business University of Chicago Nonlinear growth curve Example from the winbugs manual at http:/www.mrc-bsu.cam.ac.uk/bugs/ 1 Data Why use R2WinBUGS? No need to open WinBUGS. Automa... Date Added: 2009-06-25 19:25:28 |
| hw4s.pdf Path: Kentucky >> MS >> 533 Fall, 2009 Description: Math 533 Homework 4 Solutions 1 4. (a) Let (r) = |B (x,r)| B (x,r) u(y ) dS (y ). As in the proof of the Mean Value Property, we can calculate (r) = r n (u) (y ) dy B (x,r ) so that if u is subharmonic, is an increasing function. Since limr0 (... Date Added: 2009-06-25 19:31:58 |
| Horizon_Review.pdf Path: Oakland University >> CSE >> 598 Fall, 2009 Description: Folding@Home and Genome@Home: Using distributed computing to tackle previously intractable problems in computational biology Stefan M. Larson1,2, Christopher D. Snow1,2, Michael Shirts1, and Vijay S. Pande1,2,* 1 Chemistry Department and 2Biophysi... Date Added: 2009-06-25 19:34:08 |
| musicreview.pdf Path: MIT >> MIT >> 15575 Fall, 2009 Description: A Review of Economic Properties of Music Distribution Michael X. Zhang This Draft: 15th November 2002 Abstract Music industry is facing the music now. Big stakeholders try very hard to maintain their positions while other players see opportunities i... Date Added: 2009-06-25 19:34:38 |
| proj.ps Path: Maryland >> ENEE >> 644 Fall, 2008 Description: %!PS-Adobe-3.0 %BoundingBox: (atend) %Pages: (atend) %PageOrder: (atend) %DocumentFonts: (atend) %Creator: Frame 5.1 %DocumentData: Clean7Bit %EndComments %BeginProlog %- Frame ps_prolog 5.0, for use with Frame 5.0 products %- This ps_prolog file is ... Date Added: 2009-06-25 19:38:27 |
| 2006 LBSPG Cabinet review.pdf Path: Sveriges lantbruksuniversitet >> CMNS >> 230 Fall, 2009 Description: OFFICE OF THE MINISTER FOR ECONOMIC DEVELOPMENT The Chair CABINET REVIEW OF THE LARGE BUDGET SCREEN PRODUCTION GRANT PROPOSAL 1 That Cabinet agree to retain the Large Budget Screen Production Grant without amendments and that officials continue to mo... Date Added: 2009-06-25 19:38:45 |
| Simmy_Portrait of Vincent Van Gogh.doc Path: Sveriges lantbruksuniversitet >> CMNS >> 488 Fall, 2009 Description: Insert Portrait of Vincent Van Gogh (insert from website) How I dont know much too much about art but how I was exposed to Van Gogh from an early age(give examples) I decided to do my case study on Vincent Van Gogh and his artistic works that have b... Date Added: 2009-06-25 19:40:31 |
| asg6.ps Path: Case Western >> EECS >> 338 Fall, 2009 Description: %!PS %Version: 3.15 %DocumentFonts: (atend) %Pages: (atend) %EndComments %ident \"@(#)lp:filter/postscript/postscript/dpost.ps % % Version 3.16 prologue for troff files. % /#copies 1 store /aspectratio 1 def /formsperpage 1 def /landscape false def /l... Date Added: 2009-06-25 19:41:04 |
| 01-April20Flyer_Back.pdf Path: UC Davis >> ATT >> 0013 Fall, 2009 Description: ... Date Added: 2009-06-25 19:43:05 |
| ch13.ppt Path: Presbyterian >> CH >> 242 Fall, 2009 Description: Chapter Thirteen: Recursion Big Java by Cay Horstmann Copyright 2008 by John Wiley & Sons. All rights reserved. Chapter Goals To learn about the method of recursion To understand the relationship between recursion and iteration To analyze proble... Date Added: 2009-06-25 19:44:35 |
| PH1120B08LabRules.pdf Path: Uni. Worcester >> RPK >> 101 Fall, 2009 Description: PH 1120B08 Labs (Electricity and Magnetism) Lab Instructor: Rudra P Kafle Office: OH-114 E-mail: rpk101@wpi.edu Office Phone: x 5758 Thursday, Oct 30, 2008 Office Hours: Please send me an e-mail if you have any questions or confusion about the labs... Date Added: 2009-06-25 19:44:54 |
| AkansuNJIT1STWAVELETSSYMPAPRIL301990.pdf Path: NJIT >> NJITSYMP >> 1990 Fall, 2009 Description: 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 ... Date Added: 2009-06-25 19:45:15 |
| 26180.txt Path: UNC >> DOCS >> 26180 Fall, 2009 Description: The Project Gutenberg EBook of Mother America, by Sam McClatchie This eBook is for the use of anyone anywhere at no cost and with almost no restrictions whatsoever. You may copy it, give it away or re-use it under the terms of the Project Gutenberg... Date Added: 2009-06-25 19:49:15 |
| review3.pdf Path: Penn State >> MATH >> 230 Spring, 2008 Description: 6 Section 13.6 Cylinders = surface of all lines parallel to a given line L through a given curve C . Example1: y = x2 . Example2: x2 + y 2 = 1. ellipsoid: y2 z2 x2 + 2 + 2 =1 a2 b c z2 x2 y2 = 2+ 2 2 c a b z x2 y2 = 2+ 2 c a b cone: paraboloid... Date Added: 2009-06-25 19:49:54 |
| scores.xls Path: Iowa State >> MATH >> 166 Fall, 2008 Description: UNIV ID Final Exam Course Grade 02828 88 A 06434 F 10261 F 11165 14 F 11902 52 D+ 14382 69 B 16299 76 C 17694 55 C 20213 80 B24190 54 F 25663 59 C 27310 22 F 33109 87 A 40580 95 B+ 41133 94 A45047 88 B+ 51102 F 54772 81 D 59286 91 B61337 82 C 62439 8... Date Added: 2009-06-25 19:50:19 |
| FoodGuidePyramid.pdf Path: N. Michigan >> CS >> 255 Fall, 2008 Description: gY P\"g%YP%UYv0S\"0 g\"g0g%B\"0gvUgY#Y PW0Ug\"0Ug66 P!0gv0# PG0Y \"20)\'%YB6Pg\"BY\"{#B \"20)G vc\"Y\"%YB0R0Pg%Y\"0vg\" ! Y!c602#Y!6{#Y!%#g0~ on zyx p t |... Date Added: 2009-06-25 19:50:20 |
| Chromosomal Sex in Humans.ppt Path: CSU LA >> BIO >> 388 Fall, 2009 Description: Chromosomal Sex in Humans Human karyotype XY XX Chromosomal Sex in Birds Protandry male to female Protogyny Temperature of incubation determines sex Green Sea Turtle Haploid or Diploid Worker 32 chromosomes Queen 32 chromosomes Drones 16... Date Added: 2009-06-25 19:53:42 |
| sgf00z.txt Path: University of Illinois, Urbana Champaign >> IOP >> 20030706 Fall, 2009 Description: UPPER AIR CALCULATIONS AND PLOTTING (Ver 5.28A-LINUX-X11) Current filename: /noaaport/nwstg/convert/03070600_upa.wxp Date: 0000Z 6 JUL 03 Searching for KSGF. Searching the city database file for: KSGF . Date:0000Z 6 JUL 03 Station: KSGF WMO ... Date Added: 2009-06-25 20:04:29 |
| save.txt Path: Arizona >> PATH >> 8012007 Fall, 2009 Description: 1 00:00:31 Slide1 Slide Slide1 31 2 00:01:46 Slide2 Slide Slide2 106 3 00:02:19 Slide3 Slide Slide3 139 4 00:04:17 Slide4 Slide Slide4 257 5 00:05:19 Slide5 Slide Slide5 319 6 00:06:35 Slide6 Slide Slide6 395 7 00:07:02 Slide7 Slide Slide... Date Added: 2009-06-25 20:05:00 |
| cs154a_15_IO_Overview_Hard_Disks_and_RAID.ppt Path: UC Davis >> CS >> 154 Fall, 2008 Description: CS154A Computer Architecture Winter 2006 I/O Overview, Hard Disks and RAID Configurations Sudip Chahal Adapted from material developed by: Stephen Brown and Zvonko Vranesic, University of Toronto Mary Jane Irwin, Pennsylvania State University David ... Date Added: 2009-06-25 20:05:40 |
| hw5_pg10.pdf Path: UCSD >> ECE >> 252 Fall, 2009 Description: ... Date Added: 2009-06-25 20:06:05 |
| 1025-hourwich-spapostle.pdf Path: Allan Hancock College >> USA >> 1919 Fall, 2009 Description: Hourwich: The Socialist Party Apostle Speaks [Oct. 1919] 1 The Socialist Party Apostle Speaks. by Nicholas I. Hourwich. As published in The Communist [Chicago, CPA], new series v. 1, no. 5 (Oct. 25, 1919), pp. 6-7. After a long period of silence t... Date Added: 2009-06-25 20:07:19 |
| slides_vision.pdf Path: Uni. Worcester >> CS >> 534 Fall, 2008 Description: ... Date Added: 2009-06-25 20:10:21 |
| Gaddis_ch_01.ppt Path: Idaho State >> CIS >> 220 Fall, 2008 Description: Copyright 2007 Pearson Education, Inc. Publishing as Pearson Addison-Wesley Slide 1- 1 Chapter 1 Introduction to Programming and Visual Basic 2005 Copyright 2007 Pearson Education, Inc. Publishing as Pearson Addison-Wesley 1.1 Computer Syste... Date Added: 2009-06-25 20:12:23 |
| slee45.pdf Path: University of Illinois, Urbana Champaign >> CS >> 498 Fall, 2008 Description: Suk Kyu Lee CS498 Critique Principle of Animation To me this paper was interesting in a sense that I have never thought about the animation and the drawing techniques. In page 56, I was intrigued by the quote You do not make drawings just because the... Date Added: 2009-06-25 20:13:24 |
| week12.ppt Path: Allan Hancock College >> COMP >> 2070 Fall, 2009 Description: 1 COMP 5116 Semester 1, 2009 Lecture 12 DNS, Applications Part 1 The University of Sydney 2 Comer Readings Chapter 23 - DNS Chapter 24 - Telnet (24.1-24.5) Chapter 25 - FTP (25.1-25.10) Chapter 26 - E-mail Chapter 27 - WWW (27.1-27.8) The U... Date Added: 2009-06-25 20:16:51 |
| F05_Week_7.pdf Path: WVU >> EE >> 480 Fall, 2008 Description: WEST VIRGINIA UNIVERSITY COLLEGE OF ENGINEERING AND MINERAL RESOURCES Lane Department of Computer Science and Electrical Engineering DESIGN PROJECT TEAM WEEKLY REPORT TEAM NO/TITLE: Team 21: NSA/Identix Biometrics Demo Member Brendan Forst Jeffrey ... Date Added: 2009-06-25 20:19:40 |
| nim.pdf Path: Université du Québec à Montréal >> MGL >> 7160 Fall, 2009 Description: ... Date Added: 2009-06-25 20:25:28 |
| Spanishlit- Arlt.doc Path: Texas >> ASK >> 254 Fall, 2009 Description: Alana Kalin Final Exam Marcela Sola: Argentine Literature History and Erdosain: Understanding Argentine Society through Eyes of a Madman Jorge Luis Borges once wrote, Life and death have been lacking in my life. Borges, arguably Argentinas most famou... Date Added: 2009-06-25 20:26:58 |
| Tuvalu_GG104.ppt Path: University of Hawaii - Hilo >> GG >> 104 Fall, 2009 Description: TUVALU TUVALU AtollLiving JaneTaafakiSam November29th,2007 Whatisanatoll? Whatisanatoll? Anatollisanoceanicreefformation,often havingacharacteristicringlikeshape surroundingalagoon.Atollsareformed whencoralreefgrowsarounda volcanicislandthatlater... Date Added: 2009-06-25 20:28:09 |
| InternalScreeningTurnin.txt Path: Georgia Tech >> CS >> 4480 Fall, 2008 Description: vti_encoding:SR|utf8-nl vti_timelastmodified:TR|07 Apr 2004 17:03:19 -0000 vti_extenderversion:SR|6.0.2.5516 vti_backlinkinfo:VX|index.html vti_author:SR|DAVINCI\\irfan vti_modifiedby:SR|DAVINCI\\irfan vti_nexttolasttimemodified:TW|07 Apr 2004 17:03:26... Date Added: 2009-06-25 20:30:35 |
| AgnesNelsonapplication-0001.doc Path: Washington >> MAILMAN >> 20090506 Fall, 2009 Description: Agnes C. Nelson Memorial Scholarship Department of Economics and Political Science University of Washington Academic Year 2009 - 2010 The Agnes C. Nelson Memorial Scholarship is offered to students majoring in Economics and/or Political Science who d... Date Added: 2009-06-25 20:30:52 |
| AgnesNelsonapplication-0001.doc Path: Washington >> MAILMAN >> 20090416 Fall, 2009 Description: Agnes C. Nelson Memorial Scholarship Department of Economics and Political Science University of Washington Academic Year 2009 - 2010 The Agnes C. Nelson Memorial Scholarship is offered to students majoring in Economics and/or Political Science who d... Date Added: 2009-06-25 20:31:02 |
| AgnesNelsonapplication-0001.doc Path: Washington >> MAILMAN >> 20090429 Fall, 2009 Description: Agnes C. Nelson Memorial Scholarship Department of Economics and Political Science University of Washington Academic Year 2009 - 2010 The Agnes C. Nelson Memorial Scholarship is offered to students majoring in Economics and/or Political Science who d... Date Added: 2009-06-25 20:31:05 |
| Lesson Plans for Group Project.doc Path: N. Georgia >> ADCHAN >> 8684 Fall, 2009 Description: Group Members: Samia Ahmed, Malorie Barnett Alison Chandler, Lauren Cordell, Kimberly Smith Group Project Lesson Plan Lesson Plan Title: Developed by: Subject Area: Grade Level: Purpose of the Activity: Learning Objectives (include at least one Geor... Date Added: 2009-06-25 20:31:15 |
| gauss_ep_flu.txt Path: Berkeley >> ASTRO >> 00213486 Fall, 2009 Description: # Ep lEiso 1.003 119.986 1.006 120.252 1.024 120.822 1.034 120.670 1.040 120.163 1.053 120.387 1.061 121.006 1.068 121.298 1.079 119.937 1.079 120.447 1.087 120.257 1.100 120.012 1.105 120.775 1.115 120.415 1.125 120.077 1.129 120.526 1.147 120.306 1... Date Added: 2009-06-25 20:34:10 |
| unix_tutorial.ps Path: Stanford >> STAT >> 201 Fall, 2009 Description: %!PS-Adobe-2.0 %Creator: dvips(k) 5.86 Copyright 1999 Radical Eye Software %Title: unix_tutorial.dvi %Pages: 4 %PageOrder: Ascend %BoundingBox: 0 0 612 792 %EndComments %DVIPSWebPage: (www.radicaleye.com) %DVIPSCommandLine: dvips unix_tutorial.dvi %D... Date Added: 2009-06-25 20:35:07 |
| Lab6.pdf Path: SUNY Buffalo >> CSE >> 115 Fall, 2009 Description: CSE115 Lab 6 Spring 2009 Introduction In this lab you will write a simple game! The game will present the user with two buttons. One is the correct button, one is the incorrect one. If the player clicks on the correct button one point is added to t... Date Added: 2009-06-25 20:38:45 |
| hw2.ps Path: UCLA >> EE >> 243 Fall, 2009 Description: # # # ## # # ## # # ## # # ## # # ## # # ## # # ## # # ## # # ## # # ## # # # ## # # ## # # ## # # ## # # ## # # ## # # ## # # ## # # ## # # ## # # ## # # # ## # # ## # # ## # # ## # # ## # # ## # # ## # # ## # # ## # # ## # # # ## # # ## # # ## # #... Date Added: 2009-06-25 20:39:53 |
| T0403.t2k.dssp-ehl2-logo.pdf Path: UCSC >> T >> 0403 Fall, 2009 Description: T0403.t2k dssp-ehl2 2 1 10 20 30 40 E 2 1 E E 51 60 70 80 90 E 2 1 E E E 101 110 120 130 140 H 2 1 E E 151 160 170 180 190 E 2 1 E 201 210 220 230 240 E 2 1 E 251 260 270 280 290 E 2 1 H E 301 310 320 ... Date Added: 2009-06-25 20:40:03 |
| Lab04.pdf Path: Texas >> BOT >> 321 Fall, 2009 Description: Laboratory 4: PHYLUM HETEROKONTOPHYTA, PHYLUM RHODOPHYTA PHYLUM HETEROKONTOPHYTA (Part 2): CLASS PHAEOPHYCEAE (brown algae) - Part 2 Draw the material seen in stations #1 AND #2: 1. LAMINARIA - This is a small specimen of Laminaria. Large specimens ... Date Added: 2009-06-25 20:40:28 |
| 324exam3s07.pdf Path: Texas >> BOT >> 321 Fall, 2009 Description: Name _ EXAMINATION III Biology 324 Apr. 23, 2007 Instructions: 1. Place your name on each page, since the examinations may be separated during the grading process. 2. There are 12 numbered questions (and one bonus question) on 6 numbered pages. Be ... Date Added: 2009-06-25 20:40:35 |
| hw3.ps Path: Washington >> EE >> 531 Fall, 2009 Description: %!PS-Adobe-2.0 %Creator: dvips(k) 5.92b Copyright 2002 Radical Eye Software %Title: hw3.dvi %Pages: 1 %PageOrder: Ascend %BoundingBox: 0 0 596 842 %DocumentFonts: CMR17 CMR12 CMMI12 CMMI8 CMSY10 CMR8 CMSY8 %EndComments %DVIPSWebPage: (www.radicaleye.... Date Added: 2009-06-25 20:41:11 |
| CS103 Project Teams, Spring 2008.xls Path: Vanderbilt >> CS >> 103 Fall, 2009 Description: Team Team Correspondent Julianne Landry Lora Aboulmouna Neha Patel Cole Carlson Peter DelNero Melanie Gault Sarah Hodges Brittany Jenkins G. Davis Flowers Jeff Markle Drew Hauser Kevin Rilling Nurhidayah Md Shukor Laura McBride Mohd S. Ab Hakam Dyla... Date Added: 2009-06-25 20:42:06 |
| 000935_1.pdf Path: Pittsburgh >> AEI >> 5443 Fall, 2009 Description: ... Date Added: 2009-06-25 20:44:06 |
| T0452.t04.CB_burial_14_7-logo.pdf Path: UCSC >> T >> 0452 Fall, 2009 Description: T0452.t04 CB_burial_14_7 3 2 1 1 10 20 30 40 BE 3 2 1 FG FEF DEGFDF DBD A DA B BEDFDF D B DA D 51 60 70 80 90 BDB 3 2 1 E BDA D FD FEB BE FG F DE EDBEF 101 110 120 130 140 D 3 2 1 FEB E FG F GF EFE DFDBD... Date Added: 2009-06-25 20:47:20 |
| midfall08key.pdf Path: San Jose State >> EE >> 224 Fall, 2008 Description: EE224 Fall 08 Midterm key CSDan := 973 10 18 18 L := 0.13 Ld := 1.0 18 18 CSDpn := 267 10 CSDpp := 189 10 An := 10500 Ap := 26200 CSDap := 1203 10 Tpp( Wp , Cl) := Ap Cl Wp L Tpn( Wn , Cl) := An Cl Wn L CSDn( Wn) := CSDan ( Wn Ld ) ... Date Added: 2009-06-25 20:51:02 |
| stratford.2000.med_sap_modl.pdf Path: Concordia Chicago >> GEOSCI >> 234 Fall, 2009 Description: ... Date Added: 2009-06-25 20:51:36 |
| worked simple example for solverstat by jim bence.xls Path: Michigan State University >> FW >> 877 Fall, 2008 Description: Title: linear model example Weighted Regression SD for X\'s Observations SD for Y ParametersConstants N N N 22 3 ANOVA Source Model Residual Total R 1 New Observations 0 0 Sum Sq. Degr. Fred.Mean Sq. F calc. Crit. F(.05) Passed Prob. Check 648.75 2 ... Date Added: 2009-06-25 20:53:21 |
| m051nt.doc Path: East Los Angeles College >> M >> 051 Fall, 2009 Description: M051 Preface to Miao songs and stories. Document E. By Yang Yung-xing. Notes. Line 3. The Ndu-na-yi-mo, * ; was the great river which flowed through the ancient Miao homeland. Under Chinese pressure they had ultimately to abandon the homeland, cro... Date Added: 2009-06-25 20:53:44 |
| Design_Review.ppt Path: Mississippi State >> ECE >> 4522 Fall, 2009 Description: RECALIBRATION ALARM RECALIBRATION SYSTEM SYSTEM Recalibration Alarm System 1 SENIOR DESIGN 1 : MISSISSIPPI STATE UNIVERSITY Team Members Recalibration Alarm System 2 Amanda D.Wilcox Team Leader Dr. Nicolas H.Younan Advisor Alex Kua Brian W.Hag... Date Added: 2009-06-25 20:56:38 |
| PICserialClass.rtf Path: Santa Clara >> COEN >> 120 Fall, 2009 Description: PICserialClass Report on Configuration PICVxWorks Overridden Properties Subjects: CG Metaclasses: CGGeneral Properties: GeneratedCodeInBrowser: True InitialLayoutAs2.3: False CPP_Roundtrip Metaclasses: General Properties: RoundtripScheme: Basic CPP_C... Date Added: 2009-06-25 20:56:44 |
| VBNetIntro.ppt Path: IUPUI >> CPT >> 388 Fall, 2009 Description: VisualBasic.NET ComprehensiveConcepts andTechniques Whats new in VB .NET adapted from a presentation on Introduction to Visual Basic .NET by Jeff Quasney Course Technology Introduction to Visual Studio .NET 2 An Overview Introduction to Visual ... Date Added: 2009-06-25 20:57:08 |
| Java1.pdf Path: Wisconsin Milwaukee >> CS >> 631 Fall, 2009 Description: q x x y s i d y d qp q xs x y )hy ph uhaeffrg dvq ustrgpdu)uhh s hi gFhy )peu tus&)rpf9 ustrprp p~ ahi 9vhdrgFhy )puaedhfrp ) dvahu i ) 9 dhrg 9k vhddrhfpu x p y s q g ysged p q q oese g q d x p yes q yd g q g g y p ys p q g d i... Date Added: 2009-06-25 20:57:58 |
| concepts.txt Path: W. Alabama >> ECE >> 427 Fall, 2009 Description: +- | Lec-10 +- +- | Outline - handouts today - Lec-10 - announcements - Terrible Tuesday Technical Turmoils continued, we\'re trying to schedule a time in MC-1085 - Midterm review next wed in class -... Date Added: 2009-06-25 21:00:34 |
| ps4.pdf Path: Arizona >> PHYS >> 579 Fall, 2009 Description: PHYS 579C problem set 4 Fall 2006 Due: Sep 27 (Wednesday) Read Georgi, Ch 5 for non-linear sigma model, Ch 2. 1. For SU(3)SU(3) current (Ta = a /2, where a being eight Gell-Mann matrices) ja = q Ta q, j5a = q 5 Ta q, 1 jLa = (ja j5a ... Date Added: 2009-06-25 21:08:56 |
| YHR158C.t2k.CB_burial_14_7-logo.pdf Path: UCSC >> YHR >> 158 Fall, 2009 Description: YHR158C.t2k CB_BURIAL_14_7 3 2 1 AAAA X 1 10 20 30 40 A 3 2 1 X D E F G F E D B D E F G F E D A B D F E D F E F D A B E E B F F D E B A D F C D E D B CCDCDDA C C E F D G EE C G E D CXXCXXXXXEEDEXXEXXXXXXXEX C D EDBC D C D D D D E ... Date Added: 2009-06-25 21:10:06 |
| design_tips.pdf Path: North-West Uni. >> PA >> 110 Fall, 2009 Description: Designing your project The most ecient way to complete your project is by designing it and implementing it in an incremental fashion. First decide what the major parts of the project are, then start adding details. At each step write code that compil... Date Added: 2009-06-25 21:14:13 |
| Lec24_web.pdf Path: Penn State >> CHEM >> 110 Fall, 2008 Description: CHEMISTRY 12 CHEMISTRY LECTURE 24 ENERGY ENERGY KINETIC ENERGY mechanical (moving mass mv2) [ joule = kg m2/s2] POTENTIAL ENERGY mechanical (mass in a place where force can act) electrical (moving charge) chemical (bonds) nuclear (binding e... Date Added: 2009-06-25 21:15:58 |
| Baran, Paul_Teaching Resume.doc Path: CSU Northridge >> PMB >> 64311 Fall, 2009 Description: PAUL BARAN 1033 11th Street #F, Santa Monica, CA (310) 989 8264 pbaran@stanfordalumni.org EDUCATION CALIFORNIA STATE UNIVERSITY, NORTHRIDGE - Northridge, California Single Subject CLAD Teaching Credential anticipated June 2007 STANFORD UNIVERSITY ... Date Added: 2009-06-25 21:16:32 |
| prob2isoelastkey.xls Path: Montana >> AGEC >> 210 Fall, 2009 Description: AGEC 210 Spring 2009 1 Price of Fuel = Price of Herbicides = Fuel 5 2.5 1 0.75 0.5 a. Herb 0 0.25 0.5 1 2 2 12 sub ratio 10 6 0.5 0.25 price ratio 6 6 6 6 problem set 2 Answer Key 1 galllon of fuel and 0.50 gallons of herbicide per acre (this is ... Date Added: 2009-06-25 21:18:00 |
| 515.s07.final.with_answers.pdf Path: CSU Chico >> EXAMS >> 515 Fall, 2009 Description: CSCI515 Spring2007 NAME:_ Minutes:_ FINALEXAM Thistestcontains9questionswithatotalof85points 14 5pointseach 58 10pointseach 9 25point Youhave1hourand50minutestocompletethisexam. Youmayuseonetwosided(ortwoonesided)8.5x11sheetofnotes.Youmus... Date Added: 2009-06-25 21:20:17 |
| radvt0.txt Path: Berkeley >> ASTRO >> 00213823 Fall, 2009 Description: # t1 t2 dt rad_min rad_max cts err scl bg bg_rat wt 0.073443 0.073838 0.000396 0. 16. 9.69 3.18 0.809533 1.000000 0.307692 1 0.073838 0.073986 0.000148 0. 16. 9.00 ... Date Added: 2009-06-25 21:21:33 |
| sept19.txt Path: Duke >> CPS >> 100 Fall, 2009 Description: <?xml version=\"1.0\" encoding=\"UTF-8\"?> <Error><Code>NoSuchKey</Code><Message>The specified key does not exist.</Message><Key>09910286463ae8b56624941d30681ba74de78c54.txt</Key><RequestId>0A5D02B6A79785CC</RequestId><HostId>50X8PGryrthgnER64CfcUhVueBca... Date Added: 2009-06-25 21:22:08 |
| Cooking the Books The Cost to the Economy - Brookings.pdf Path: Ill. Chicago >> ACTG >> 516 Fall, 2008 Description: The Brookings Institution POLICY BRIEF August 2002 Related Brookings Resources Following the Money: Corporate Disclosure in an Age of Globalization George Benston, Michael Bromwich, Robert E. Litan, Alfred Wagenhofer AEI-Brookings Joint Center for ... Date Added: 2009-06-25 21:28:04 |
| Request for Bringing New Materials into the Cleanroom.pdf Path: Dallas >> RAR >> 011300 Fall, 2009 Description: Request for Bringing New Materials into the Cleanroom Roger Robbins Cleanroom Safety Officer Name_ Email Address _ 6/25/2008 Date_ Phone_ Supervisor_ or Company _ Supervisor Email Address _ Phone_ = Material_ Common Name, Trade Name and CAS number... Date Added: 2009-06-25 21:33:15 |
| brian.ppt Path: Colorado State >> AT >> 741 Fall, 2004 Description: AirborneCloudRadar AirborneCloudRadar 94.9GHzRadar WakasaBayCampaign BrianGriffith,AT741 AirborneCloudRadar AirborneCloudRadar 94GHzradardesignedtofacilitate measurementsofverticallayerstructure,radar backscatterandradiativepropertiesofall preva... Date Added: 2009-06-25 21:33:20 |
| L14Switch.ppt Path: UMBC >> PUB >> 104 Fall, 2009 Description: The switch statement So many ways to go A multi-selection statement CMSC 104 Multiple Seclections with if if (day = 0 ) { printf (Sunday); } if (day = 1 ) { printf (Monday); } if (day = 2) { printf (Tuesday); } if (day = 3) { printf (Wednesday); }... Date Added: 2009-06-25 21:41:42 |
| APPENDIX.pdf Path: Cincinnati >> ENFD >> 382 Fall, 2008 Description: APPENDIX 1 PROPERTY TABLES AND CHARTS (SI UNITS) Copyright The McGraw-Hill Companies, Inc. Permission required for reproduction or display. FIGURE A-9 T-s diagram for water. A-1 (Source: Lester Haar, John S. Gallagher, and George S. Kell, NBS/N... Date Added: 2009-06-25 21:43:42 |
| syls98.doc Path: CSU San Marcos >> PS >> 399 Fall, 2009 Description: Political Science 399 RESEARCH DESIGN, METHODS, and APPROACHES IN POLITICAL SCIENCE TR, 12:00 - 1:15 ACD 203 Professor Nichols Craven 5305-D Office Hours: MW, 11:00 - 12:00 (and by appt.) 760-750-4198 snichols@csusm.edu Focus: This course is an intro... Date Added: 2009-06-25 21:48:28 |
| quizzes_Quiz_5&6_KEY.pdf Path: Washington >> CHEM >> 239 Fall, 2008 Description: ... Date Added: 2009-06-25 21:49:10 |
| SyllabusF06.pdf Path: UMass (Amherst) >> CH >> 112 Fall, 2009 Description: Chemistry 112 Section 1 Fall 2006 Course Syllabus Instructors Scott Garman: ch112sg@chem.umass.edu Office Lederle 1021K Office Hours - In Chemistry Resource Center Hours TBA 10/16/06 Alejandro P. Heuck: apheuck@biochem.umass.edu Office Lederle 8... Date Added: 2009-06-25 21:49:20 |
| MTurnOnTotalL3Matched.ps Path: Stanford >> MEETING >> 050802 Fall, 2009 Description: %!PS-Adobe-2.0 %Title: /a/bbrnfs03/det/trg/trg/dwalker/RELEASES/18.0.4/workdir/newTurnOnPlots/MTurnOnTotalL3Matc hed.ps: c1 %Creator: ROOT Version 4.03/02 %CreationDate: Tue Aug 2 13:17:56 2005 %EndComments %BeginProlog /s {stroke} def /l {lineto} de... Date Added: 2009-06-25 21:55:59 |
| Fraction worksheet.doc Path: N. Georgia >> ACJACK >> 3190 Fall, 2009 Description: Name_ Fraction Review! Open up Internet Explorer on your computer. Go to the following URL: http:/www.coolmath.com/fractions/index.html You will need to complete activities 1-12. Read all of the information on each section. During each activity you ... Date Added: 2009-06-25 22:04:58 |
| Ten useful Websites.doc Path: N. Georgia >> ACJACK >> 3190 Fall, 2009 Description: Mandi Weaver Useful Websites: 1. www.glc.k12.ga.us/qcc/homepg.asp Description the standards that will be phased out for Mathematics starting next year. 2. www.georgiastandards.org Description: the new standards for Georgia. 3. httphttp:/terri.clarit... Date Added: 2009-06-25 22:04:59 |
| Lab 10 Overview.pdf Path: Washington University in St. Louis >> CSE >> 131 Fall, 2009 Description: ... Date Added: 2009-06-25 22:07:30 |
| cds__5101ks__100207__1ls.txt Path: Berkeley >> DATA >> 100207 Fall, 2009 Description: 0.00000 1.09588 1.01588 0.20000 1.11329 1.04279 0.40000 1.10097 1.02730 0.60000 1.07621 1.00002 0.80000 1.06448 0.98585 1.00000 1.03716 0.95630 1.20000 1.08797 1.01761 1.40000 1.08775 1.01033 1.60000 1.05883 0.97962 1.80000 1.09149 1.01432 2.00000 1.... Date Added: 2009-06-25 22:11:24 |
| T0391.t06.bys-logo.pdf Path: UCSC >> T >> 0391 Fall, 2009 Description: T0391.t06 bys 5 4 3 2 1 1 10 20 30 40 P 5 4 3 2 1 H E PEYPH P HTP E G EPE GTE 51 60 70 80 90 H 5 4 3 2 1 PH GTP EPTP H G TP E P G PE PH GTP E PHP 101 110 120 130 140 HP 5 4 3 2 1 HP E PGTE PE G TPE P H... Date Added: 2009-06-25 22:13:48 |
| Lecture2.ppt Path: USC >> CS >> 377 Fall, 2008 Description: Systems Engineering q q Designing, implementing, deploying and operating systems which include hardware, software and people Objectives To explain why system software is affected by broader system engineering issues To introduce the concept of e... Date Added: 2009-06-25 22:14:19 |
| L18.ppt Path: UMBC >> PUB >> 104 Fall, 2009 Description: Arrays, Part 1 of 2 Topics Definition of a Data Structure Definition of an Array Array Declaration, Initialization, and Access Program Example Using Arrays Reading Sections 6.1 - 6.5 L18 Data Types So far, we have seen only simple data types... Date Added: 2009-06-25 22:14:52 |
| L19Functions3a.ppt Path: UMBC >> PUB >> 104 Fall, 2009 Description: Functions, Part 3 of 3 Topics: Coding Practice o o In-Class Project: The Box In-Class Project: Drawing a Rectangle Reading: None 1 CMSC 104, Version 9/01 Coding Practice Let\'s take the algorithms that we developed in \"Algorithms, Part 3 of 3\"... Date Added: 2009-06-25 22:14:58 |
| L12MoreLoops.ppt Path: UMBC >> PUB >> 104 Fall, 2009 Description: More Loops Topics Counter-Controlled (Definite) Repetition Event-Controlled (Indefinite) Repetition for Loops do-while Loops Choosing an Appropriate Loop Break and Continue Statements Reading Sections 4.1 - 4.6, 4.8, 4.9 Counter-Controlled... Date Added: 2009-06-25 22:15:27 |
| l08_Multiclass.ps Path: Neumont >> IFT >> 3390 Fall, 2009 Description: %!PS-Adobe-2.0 %Creator: dvips(k) 5.92b Copyright 2002 Radical Eye Software %Title: multiclassVectorValuedBaseClassifiers.dvi %Pages: 6 %PageOrder: Ascend %BoundingBox: 0 0 612 792 %DocumentFonts: Times-Roman Times-Bold Times-Italic Symbol CMSY10 %+ ... Date Added: 2009-06-25 22:16:13 |
| Lecture903.ppt Path: Missouri S&T >> CS >> 307 Fall, 2009 Description: CS307 CS307 Software Testing And Software Quality Assurance Quality Frank Liu Lesson Title: Testing Case Design Lesson Process Test Case Design Process Test Clue Identification. Search what need to Clue be tested. Target those inputs which are... Date Added: 2009-06-25 22:19:08 |
| Lecture908.ppt Path: Missouri S&T >> CS >> 307 Fall, 2009 Description: CS307 CS307 Software Testing And Software Quality Assurance Quality Frank Liu Lesson Title: Testing Case Design Lesson Process Test Case Design Process Test Clue Identification. Search what need to Clue be tested. Target those inputs which are... Date Added: 2009-06-25 22:19:20 |
| Chapter 2 Assignment 2 Spring 2004.doc Path: NSUOK >> CS >> 3343 Fall, 2009 Description: 1CS 3343 Chapter 2 Assignment 2 Spring 2004 Date Due:2/2/04 26 points 1. Define the following: a. Bootstrap program b. System call c. Interrupt vector d. Direct memory access e. Memory-mapped I/O f. PIO g. Tracks h. Sectors i. Cylinder j. Random-acce... Date Added: 2009-06-25 22:19:56 |
| YKL139W.t2k.CB_burial_14_7-logo.pdf Path: UCSC >> YKL >> 139 Fall, 2009 Description: YKL139W.t2k CB_BURIAL_14_7 3 2 1 AAAAAAA X ABB B BBBBBBBAABAAAA X X A A BAB AA AAAABAAAAAAAABABBABAAAAABAA A A B A B A B B A B B B B B B B B B B B B B B B B B B B B B B B B B D D D D CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC D D D D D D D... Date Added: 2009-06-25 22:20:25 |
| YKL198C.t2k.str2-logo.pdf Path: UCSC >> YKL >> 198 Fall, 2009 Description: YKL198C.t2k STR2 5 4 3 2 1 CCC 1 SSSSSSSZZSZSTSTTSSSCSCCCSSS STTS S Y CSSSSSSC S S S Y Z ZBYS S Y T S T A T S T ZBZTZZYYSZSTZTSSTTTS T T S B TTSSTSSSTTTTTTTS T T T Y Y XXQ X X X X X XX X XX XXXXXXXX XXXXXXXXXX XXXXXXX C ZCZ C X Z SCC T S CCCC X... Date Added: 2009-06-25 22:20:42 |
| YKL115C.t2k.w0.5-logo.pdf Path: UCSC >> YKL >> 115 Fall, 2009 Description: YKL115C.t2k w0.5 1 M L V I I V 10 20 30 40 H 1 E S E T T I I IF F FLLVLL YG LLL L L P G V YLPVNELRRL G E N V V V XXXXX X XX X XXX XX XXXXXXX XXXXXXXXXX A K L I K K F L XX L I X XX I V I V T S X F L S S X A T Y I I I V V V ... Date Added: 2009-06-25 22:20:53 |
| YKL162C-A.t2k.CB_burial_14_7-logo.pdf Path: UCSC >> YKL >> 162 Fall, 2009 Description: YKL162C-A.t2k CB_BURIAL_14_7 3 2 1 AA X X 1 10 20 30 40 A EDFEFG F E BD FDFEB DF E DF AEDA 50 AA B B AA GGGGF ABBBB B F AX F FFFF C CC CB BBBBA X X X X MTLHHKLVLSMLLGLSITPEGDLPLSGQDIFYQYSFSSFYNIHDERIREQ F E D G C F E E D E D F A E G... Date Added: 2009-06-25 22:20:54 |
| YKL171W.t2k.str2-logo.pdf Path: UCSC >> YKL >> 171 Fall, 2009 Description: YKL171W.t2k STR2 5 4 3 2 1 C T H A Z M T ZHQESSQATT H A C YZZZ Y Z C Y AC CQE A H X X XX S CCCCSYSCYZXEXZYTS A ZYYC E A S Z A S S YX X T X X XX XX X X T T X X Y 1 10 20 30 40 YZ 5 4 3 2 1 YZEYZ A ZT Z A ZY HT H HHHH 51 S X X ... Date Added: 2009-06-25 22:21:08 |
| YKL126W.t2k.str2-logo.pdf Path: UCSC >> YKL >> 126 Fall, 2009 Description: YKL126W.t2k STR2 5 4 3 2 1 CC 1 XXXXXXXXXXXX H H H C C C C C C C C C C C C C H X X X X H C X X X XXXXXXXXX H H C C H C C C H H C C X X X X H X C C X X X C H X X X X X X H H C H H CCC CZZZC C S S S T XXXXX X C TC S X X 10 20 ... Date Added: 2009-06-25 22:21:13 |
| YKL104C.t2k.str2-logo.pdf Path: UCSC >> YKL >> 104 Fall, 2009 Description: YKL104C.t2k STR2 5 4 3 2 1 P C CZMMZY H C M Y CAQZQMQCSCCCCTHHH Y Y H Z C QP T C Z Z S H H H X X XXX X X A AAAA PP CXX X 1 Z S A Z S C M T H Z S C S H T H P E S Y T C H T C T G H C Q S C C G S G X X X X X X X X X X X H 10 20 30 40 A 5 4 3 ... Date Added: 2009-06-25 22:21:27 |
| P2.doc Path: UH Clear Lake >> CSCI >> 3133 Fall, 2008 Description: Programming Assignment 2 Write a C program to calculate the parking fare for customers who park their cars in a parking lot when the following information is given: a) b) c) d) e) A character showing the type of vehicle: C for car, B for bus and T fo... Date Added: 2009-06-25 22:23:39 |
| a885hgsa.txt Path: Mt. Holyoke >> ASOL >> 885 Fall, 2009 Description: -11.2115 8400 -11.1656 8309 -11.1198 8308 -11.0739 8368 -11.0281 8378 -10.9822 8374 -10.9364 8345 -10.8905 8295 -10.8447 8374 -10.7988 8476 -10.7530 8458 -10.7071 8411 -10.6612 8405 -10.6154 8391 -10.5695 8338 -10.5237 8390 -10.4778 8440 -10.4320 831... Date Added: 2009-06-25 22:25:33 |
| symnotes3.pdf Path: Dallas >> TXH >> 081100 Fall, 2009 Description: ... Date Added: 2009-06-25 22:26:21 |
| overton_ieee.pdf Path: Sveriges lantbruksuniversitet >> MACM >> 316 Fall, 2009 Description: q g h i o o m m f d k m dq f o g hq q h i i m h kd Hed`Al$RmHRmR59R5plReH5D5nmR5t5)$5DegHTf m f k k m kq q k i hd m hkd g RHFhVq$R5R50q)TjRmlR5RmlPllR$jHiTkRo$edlt... Date Added: 2009-06-25 22:27:56 |
| Plein changes in the state.pdf Path: Washington >> WEEK >> 492 Fall, 2009 Description: ... Date Added: 2009-06-25 22:29:01 |
| 02-Biometrics-Lecture-2-Part1-2008-09-29 Path: University of Toronto >> MATH >> MAT 400 Fall, 2008 Description: Master SC Information and Communication Security 1 Biometrics http:/scgwww.epfl.ch/courses Dr. Andrzej Drygajlo Speech Processing and Biometrics Group Signal Processing Institute Ecole Polytechnique Fdrale de Lausanne (EPFL) Center for Interdisci... Date Added: 2009-06-25 22:29:08 |
| HardRock-tps.doc Path: San Jose State >> CMPE >> 296 Fall, 2009 Description: Problem Statement: A Textbook Exchange System CMPE 296 Team: HardRock Team Members: Jason Hu Yongyu Athena Wu Alex John Introduction: Every year there are tons of students busy with finding textbooks that they want to use in the beginning of new sem... Date Added: 2009-06-25 22:34:29 |
| summary.pdf Path: Minnesota >> TC >> 1013 Fall, 2009 Description: EngC 1013, Fall 2006 Instructor Lindsay Craig University Writing and Critical Reading: Nature & The Environment Assignment 1: Writing a Summary Read any article in a print media source on an environmental topic. Write a brief, two page (approximately... Date Added: 2009-06-25 22:35:56 |
| quizzes.pdf Path: NYU >> AN >> 313 Fall, 2009 Description: Modern Physics Solutions to quizzes Alvaro Nnez u nunez@cooper.edu Cooper Union, 51 Astor Place, New York, NY 10003. Feb.3rd 1. Using the transformation law for energy-momentum, we get 2 2 v p c2 E E vp = c2 p 2 E 2 = c2 2 2 1 v2 1 v2 c c... Date Added: 2009-06-25 22:36:34 |
| Presentation skills.pdf Path: Alaska Anch >> PADM >> 659 Fall, 2009 Description: PERFECT PRESENTATIONS: Presenting with impact is a skill that can be learned by anyone Based on an article by Dave Howell, in Making Money, Dec. 2006, page 90-91 Introduction Managers A vast majority do not have innate presentation skills Can ... Date Added: 2009-06-25 22:37:06 |
| pspice_rec1.doc Path: SUNY Buffalo >> EE >> 310 Fall, 2009 Description: RECITATION Problems for this week Problems 1.17, 1.18, 1.34, and 1.35 INSTRUCTIONS: Problem 1.17: Consider the voltage-amplifier circuit model shown in Fig. 1.17(b), in which Avo = 10V/V under the following conditions: (a) Ri = 10Rs, RL = 10Ro (b) Ri... Date Added: 2009-06-25 22:42:07 |
| 12a-kidangoamendment.pdf Path: Ohlone >> ORG >> 20040908 Fall, 2009 Description: AMENDMENT TO AGREEMENT This is an Amendment to the Agreement between the Ohlone Community College District formerly known as the Fremont Newark Community College District (hereinafter referred to as Ohlone) and Kidango Inc., a California Public Benef... Date Added: 2009-06-25 22:44:24 |
| 2301 Jane Doe.ppt Path: Del Mar College >> ENGL >> 2301 Fall, 2009 Description: C de re ntials De signing I nstruction Re sponsibilitie s Nobody care how m you know until the know how m s uch y uch you care . WilliamPurke y EDUC2301Hum... Date Added: 2009-06-25 22:45:55 |
| XBeeCodeDevelop.pdf Path: WVU >> CPE >> 313 Fall, 2008 Description: XBee/XBeePROCodeDevelopment Contents XBee/XBee-PRO Code Development Software Development Tools Using the MaxStream Bootloader XBee/XBee-PRO Hardware Components Freescale SMAC Freescale 802.15.4 PHY and MAC Figure 8 ZigBee Stack MaxStream PHY Low Pow... Date Added: 2009-06-25 22:46:07 |
| Exam_3-Answers__Chem_104_.pdf Path: Wisconsin Milwaukee >> CHEM >> 104 Fall, 2008 Description: Exam 3 Answers (Chem 104) 1. A 2. A 3. B 4. B 5. C 6. D 7. D 8. C 9. D 10. C 11. B 12. E 13. D 14. C 15. E 16. E 17. B 18. E 19. C 20. C 21. D 22. D 23. E 24. C 25. B ... Date Added: 2009-06-25 22:47:50 |
| projection.txt Path: University of Illinois, Urbana Champaign >> NPRE >> 435 Fall, 2008 Description: 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 0.000000 ... Date Added: 2009-06-25 22:49:27 |
| HW3.ps Path: West Point >> MA >> 104 Fall, 2009 Description: %!PS-Adobe-2.0 %Creator: dvips 5.72 Copyright 1997 Radical Eye Software (www.radicaleye.com) %Title: D:\\AAA-Rickey\\MA104-Spring05\\HW3.DVI %CreationDate: Tue Mar 29 13:41:05 2005 %Pages: 1 %PageOrder: Ascend %BoundingBox: 0 0 612 792 %DocumentFonts: c... Date Added: 2009-06-25 22:52:54 |
| SOURCES.txt Path: Penn State >> TRAC >> 6650 Fall, 2009 Description: <!DOCTYPE html PUBLIC \"-/W3C/DTD XHTML 1.0 Strict/EN\" \"http:/www.w3.org/TR/xhtml1/DTD/xhtml1-strict.dtd\"> <html xmlns=\"http:/www.w3.org/1999/xhtml\"> <head> <title> Changeset 6650 for weblion/Monorail/trunk/monorail.xam/mon... Date Added: 2009-06-25 22:54:38 |
| LEA.pdf Path: UNL >> ECSE >> 960 Fall, 2009 Description: ... Date Added: 2009-06-25 23:01:09 |
| iogui.doc Path: Pace >> CS >> 396 Fall, 2009 Description: import java.awt.*; import java.applet.*; import java.awt.event.*; public class iogui extends Applet { input_output ioGui = new input_output (this); protected static GridBagConstraints getConstraints (int gx, int gy, double wx, int ipx) { GridBagConst... Date Added: 2009-06-25 23:01:55 |
| ps2.pdf Path: UCSB >> PHYS >> 234 Winter, 2008 Description: Physics 234: Problem Set 2 Due in class: Tues April 21 1. Consider a sphere of ionized hydrogen that is undergoing spherical gravitational collapse. The sphere is held at constant isothermal temperature To , uniform (but time-varying) density and con... Date Added: 2009-06-25 23:02:43 |
| lec23.pdf Path: Iowa State >> CS >> 633 Fall, 2009 Description: ... Date Added: 2009-06-25 23:02:50 |
| parse.pdf Path: New Mexico >> EECE >> 314 Fall, 2009 Description: d xo n 4 xmo n 8 r IIG0d s pmo n r r BH yE5 E50 95 g3 q H@0S e 0 B 9 B@5S B@ 75 9S0 0 B 9 Bl3 0 `atFUF7G98`F@8s41T6rU1`1~IG0fd&1D(kF@UFBG9~ac~IA08a{f1~`i1D(kF@85v4 r rB`G0d tr pCn 5 z txw R H o n y 95u d E@ B d dS3b ... Date Added: 2009-06-25 23:03:22 |
| tman640ch2.ppt Path: MD University College >> TMAN >> 640 Fall, 2009 Description: CHAPTER 2: Project Selection CHAPTER TMAN 640: Project Management Dr. Robert Beauchamp Learning Objectives for Class #2 Learning s Develop an understanding of the various methods projects are selected for funding. Develop an understanding of how t... Date Added: 2009-06-25 23:04:46 |
| hw4.pdf Path: Texas El Paso >> EE >> 2369 Fall, 2008 Description: ... Date Added: 2009-06-25 23:05:30 |
| typinghint.txt Path: Allan Hancock College >> CSC >> 124 Fall, 2009 Description: When writing your typechecker you need to construct visitor that returns a String. In order to facilitate the generation of code later, I recommend that you also store the actual type inside each abstract syntax node. I did this by adding the foll... Date Added: 2009-06-25 23:06:28 |
| STG_Final.pdf Path: Penn State >> JAK >> 535 Fall, 2009 Description: Summer Internship: Final Reflection Serving as the graduate supervisor for the Summer Tour Guides has been a very positive and developmental learning experience. This internship experience not only aligned closely with most of the learning outcomes o... Date Added: 2009-06-25 23:06:47 |
| h2a.ps Path: UC Davis >> MAT >> 235 Fall, 2009 Description: %!PS-Adobe-2.0 %Creator: dvips(k) 5.92b Copyright 2002 Radical Eye Software %Title: h2a.dvi %Pages: 1 %PageOrder: Ascend %BoundingBox: 0 0 596 842 %DocumentFonts: CMR10 CMBX10 CMSY10 CMMI10 CMR7 CMMI5 CMTI10 CMSY7 %+ CMEX10 CMMI7 MSBM10 %EndComments ... Date Added: 2009-06-25 23:12:59 |
| 20060925_prelecture.pdf Path: Vanderbilt >> A >> 102 Fall, 2009 Description: The amount of light seen by a given telescope (which is what we call Brightness) goes down as the distance from the source goes up: 1 B 2 d d d An object that is twice as far away will appear as bright. d A L d A = energy output from the sour... Date Added: 2009-06-25 23:15:22 |
| Henry.SMITH.VAL.rtf Path: UMKC >> ECON >> 506 Fall, 2008 Description: History of Economics Review, No. 31, Winter, 2000 ADAM SMITH AND THE THEORY OF VALUE: Chapter Six Considered * John F. Henry Department of Economics California State University, Sacramento e-mail: henryjf@csus.edu Adam Smith enjoys a rather precario... Date Added: 2009-06-25 23:16:06 |
| SleeperHW2.pdf Path: UNC >> HW >> 111 Fall, 2009 Description: ... Date Added: 2009-06-25 23:25:23 |
| ioe265w03practex21.doc Path: Michigan >> IOE >> 265 Fall, 2008 Description: Fall 2001 IOE 265 Exam II Name: UMID: Section Time: Honor Code and Signature: NOTE: YOU MUST TURN IN YOUR FORMULA SHEET WITH EXAM OR YOU WILL LOSE 5 POINTS! Part 1 (40 points total, 4 points each) For the following questions, circle the best answer.... Date Added: 2009-06-25 23:27:10 |
| sell_mixed_iTree.pdf Path: Harvard >> CS >> 286 Fall, 2009 Description: ... Date Added: 2009-06-25 23:30:36 |
| YJL221C.t2k.dssp-ebghstl-logo.pdf Path: UCSC >> YJL >> 221 Fall, 2009 Description: YJL221C.t2k EBGHSTL 3 2 1 CC X 1 10 20 30 40 G 3 2 1 E TG T S T S H HT H X T GGX X 51 60 70 80 90 T 3 2 1 E T T G E T S H T TCEEEEE C S S E X X X C T G E T T G G H G G T C H S H T E C H H S X X X X X X X X X X X X X ... Date Added: 2009-06-25 23:31:18 |
| KKD .ppt Path: Ill. Chicago >> ACTG >> 516 Fall, 2008 Description: vti_encoding:SR|utf8-nl vti_timelastmodified:TR|22 Nov 2004 20:31:00 -0000 vti_extenderversion:SR|5.0.2.2623 vti_author:SR|2301-ACCT\ am vti_modifiedby:SR|2301-ACCT\ am vti_timecreated:TR|22 Nov 2004 20:31:00 -0000 vti_cacheddtm:TX|22 Nov 2004 20:31:... Date Added: 2009-06-25 23:31:51 |
| ImportantDates.pdf Path: Rutgers >> CHEM >> 311 Fall, 2009 Description: Important Dates for Chem 311 Spring 2007 Jan 17 First lecture begins (IT IS IMPORTANT THAT ALL STUDENTS ATTEND THE LECTURES THEY ARE IMPERATIVE FOR DOING WELL IN THIS COURSE) First Week of Lab. Go to your regularly scheduled lab for check-in, safety... Date Added: 2009-06-25 23:32:53 |
| L24_Wrapup.ppt Path: North-West Uni. >> ECE >> 230 Fall, 2009 Description: ECE230 Lectures Series Wrap Up and Misc Ying Wu Electrical & Computer Engineering Northwestern University yingwu@ece.northwestern.edu What Weve learned (I) Fundamentals of C+ Class Default arguments Constructor/destructor When constructors and ... Date Added: 2009-06-25 23:37:36 |
| ps3.pdf Path: Berkeley >> E >> 100 Fall, 2008 Description: Name: _ SID: _ Discussion Section: _ Problem Set #3 Due Tuesday, September 26, 2006 Problem Sets MUST be word-processed except for graphs and equations. QUESTIONS 1. In 2004, Germanys rate of capital accumulation was much slower than its labor forc... Date Added: 2009-06-25 23:38:15 |
| Article45.pdf Path: Toledo >> UTCWALOCAL >> 4530 Fall, 2009 Description: ... Date Added: 2009-06-25 23:38:15 |
| SSRD_LCO_F07a_T10_v1.3.doc Path: USC >> CSCI >> 577 Fall, 2009 Description: System and Software Requirements Definition (SSRD) Version 1.3 System and Software Requirements Definition (SSRD) REEO Database Team 10 NAME Vishal Patel Kalyani Soniminde Nirav Chheda Parag Shah Samit Vyas Swara Desai Mark Dexter ROLE Project Man... Date Added: 2009-06-25 23:41:07 |
| kotler10_crs.ppt Path: Auburn >> MT >> 331 Fall, 2009 Description: _ is the sum of values that consumers exchange for the benefits of having or using a product or service. 1. Place 2. Purchase 3. Price 4. Premium Kotler / Armstrong 11e, Chapter 10 _ is the sum of values that consumers exchange for the benefits of ... Date Added: 2009-06-25 23:41:50 |
| overton_ieee.pdf Path: McGill >> CS >> 350 Fall, 2009 Description: q g h i o o m m f d k m dq f o g hq q h i i m h kd Hed`Al$RmHRmR59R5plReH5D5nmR5t5)$5DegHTf m f k k m kq q k i hd m hkd g RHFhVq$R5R50q)TjRmlR5RmlPllR$jHiTkRo$edlt... Date Added: 2009-06-25 23:42:21 |
| slides.pdf Path: Allan Hancock College >> COMP >> 830 Fall, 2009 Description: Chapter 30 Security Engineering comp284-Software Engineering 1 Objectives 1. To introduce issues that must be considered in the specification and design of secure software 2. To discuss security risk management and the derivation of security req... Date Added: 2009-06-25 23:44:37 |
| Math1210Midterm2Review.pdf Path: Utah >> MATH >> 1210 Fall, 2008 Description: Math1210 Midterm 2 Review Problems Summer, 2007 Kelly MacArthur Chapter 0 Review, Sample Test Problems (pg 53) #52, 53, 54 Chapter 1 Review Concepts Test Problems (pg 90-91) #8, 11, 19 Sample Test Problems (pg 91) #7, 10, 15, 16, 18, 20 Chapter 2 Rev... Date Added: 2009-06-25 23:45:00 |
| whitlock_s07_ex1.pdf Path: Wisconsin >> CHEM >> 104 Fall, 2008 Description: ... Date Added: 2009-06-25 23:47:18 |
| mpc555dk_ug.pdf Path: ECCD >> MPC >> 555 Fall, 2009 Description: Embedded Target for Motorola MPC555 For Use with Real-Time Workshop Modeling Simulation Implementation Users Guide Version 1 How to Contact The MathWorks: www.mathworks.com comp.soft-sys.matlab support@mathworks.com suggest@mathworks.com bugs@mat... Date Added: 2009-06-25 23:47:20 |
| 520.646-DCT-LT.pdf Path: Johns Hopkins >> ECE >> 646 Fall, 2009 Description: M-Channel Filter Banks: Block and Lapped Transforms Trac D. Tran ECE Department The Johns Hopkins University Baltimore MD 21218 Outline Block transforms DCT: discrete cosine transform Lapped transforms LOT: lapped orthogonal transform TDLT: time-d... Date Added: 2009-06-25 23:48:07 |
| vblast1.pdf Path: Stanford >> EE >> 359 Fall, 2009 Description: IEEE JOURNAL ON SELECTED AREAS IN COMMUNICATIONS, VOL. 17, NO. 11, NOVEMBER 1999 1841 Simplied Processing for High Spectral Efciency Wireless Communication Employing Multi-Element Arrays Gerard J. Foschini, Glen D. Golden, Reinaldo A. Valenzuela, F... Date Added: 2009-06-25 23:48:10 |
| THEORY_WORKSHOP_PROGRAM.pdf Path: Allan Hancock College >> PAGE >> 157420 Fall, 2009 Description: PROGRAM for the MUSIC THEORY WORKSHOP on THEORY MUSICIANSHIP MUSIC CRAFT 1.15 pm Welcome and introduction by Barry Palmer The value of the three AMEB Music Theory Syllabuses Session 1 With two theory markers What do examiners look for when marking ... Date Added: 2009-06-25 23:56:11 |
| Summary Book.pdf Path: Penn State >> KRE >> 124 Fall, 2009 Description: The Research and Economic Development Center Erie, Pa Kristen Eash Advisor : D. Riley Option: Construction Management Date: 4-3-06 Summary Book Page 1 The Research and Economic Development Center (REDC) Kristen Eash http:/www.arche.psu.edu/thesi... Date Added: 2009-06-25 23:58:36 |
| Section3_CorallineAlgae.pdf Path: UCSC >> BIO >> 158 Fall, 2009 Description: 1/28/2009 BIOE 163/OCEA 157 Lab 3 Coralline Algae Discussion 3: Albins, M.A. and M.A. Hixon. 2008. Invasive Indo-Pacific lionfish Pterois volitans reduce recruitment of Atlantic coral-reef fishes. 1. 2. 3. 4. 5. 6. Pick up last weeks handouts Qui... Date Added: 2009-06-26 00:01:06 |
| week2.pdf Path: Drake >> ECON >> 180 Fall, 2009 Description: BUSINESS FIRMS Page 1 Economic definition of a business firm BUSINESS FIRMS What is a business firm? What do firms do? (1) Purchases inputs. Examples: _ _ (2) Uses inputs to produce outputs. (3) Sells outputs. Examples: _ __ Major kinds of firms ... Date Added: 2009-06-26 00:14:29 |
| lec08.pdf Path: Berkeley >> EECS >> 12202 Fall, 2009 Description: EECS 122, Lecture 8 Kevin Fall kfall@cs.berkeley.edu Jean Walrand wlr@eecs.berkeley.edu Bridged Ethernets: Outline Objectives No-Frills Bridge Learning Bridge Loop Avoidance Bridge Limitations EECS 122 - Fall & Walrand 224 Bridged Ethernets Objec... Date Added: 2009-06-26 00:16:11 |
| 217.2005.spring.T1.sol.pdf Path: Roosevelt >> M >> 217 Fall, 2009 Description: MATH 217-01 Test 1 Solutions March 2, 2005 Page 1 of 4 Circle the correct answer for each multiple choice question. You may use books, notes, and calculators. Do problems in any order - but some problems are related to the same reference. Use th... Date Added: 2009-06-26 00:22:04 |
| mean.ps Path: Duke >> X >> 130 Fall, 2009 Description: ... Date Added: 2009-06-26 00:27:51 |
| EightBottles.pdf Path: Mt. Hood Community College >> CH >> 104 Fall, 2008 Description: 5 EIGHT BOTTLES An Introduction to Scientific Investigations Problem solving is not restricted to scientific investigations but is a life long process that involves every aspect of human endeavor. Although every investigator, being human, approaches... Date Added: 2009-06-26 00:30:12 |
| FreezingPointDepression.pdf Path: Mt. Hood Community College >> CH >> 222 Spring, 2008 Description: 53 Molar Mass Determination by Freezing Point Depression If a nonvolatile solute is added to a liquid, a number of physical properties of the pure substance change, including vapor pressure depression, freezing point depression, and boiling point el... Date Added: 2009-06-26 00:30:56 |
| finalGradeRequirements.txt Path: Texas State >> CD >> 3313 Spring, 2009 Description: 382.4 for an A 340 for a B 297.5 for a C 271 points as of now 120 points left If i lose 9 points i will have a B If i lose 51 points i will have a C If i lose 94 points i will have a D... Date Added: 2009-06-26 00:31:28 |
| Quality Systems Frameworks Exercise.doc Path: RIT >> SE >> 450 Fall, 2009 Description: SE 450 Software Processes Systems don\'t produce quality, people do.\" Would you agree? What does this say about the need for quality systems? 2.) Preparing for a Malcolm-Baldrige eval... Date Added: 2009-06-26 00:31:45 |
| watershed_management_agenda.pdf Path: Texas A&M >> NOV >> 1705 Fall, 2009 Description: WATERSHED MANAGEMENT TRAINING CONFERENCE Date: November 17-18, 2005 Location: Fort Worth Plaza Hotel 1701 Commerce Street Fort Worth, TX 76102 Conference Agenda Thursday, November 17, 2005 8:30 9:30 AM Registration and Continental Breakfast 9:30 ... Date Added: 2009-06-26 00:34:48 |
| SonicWALL Manual.pdf Path: UH Clear Lake >> ISAM >> 5439 Fall, 2008 Description: SONICWALL Internet Security Appliances CONTENTS Organization of This Guide . 5 1 INTRODUCTION . 7 SonicWALL Internet Security Appliance Features .. 9 SONICWALL INSTALLATION . 12 Connecting the SonicWALL to the Network . 13 Performing the Initial Co... Date Added: 2009-06-26 00:36:22 |
| 8_4_04 lecture.pdf Path: Washington >> MENGR >> 395 Fall, 2009 Description: ME 395 Summer 2004 What are some economic decision methods? First cost Total life-cycle cost Annual rate of return Payback period Net present worth Discounted cash flow/Internal rate of return Benefit-cost analysis Legal, political, and soci... Date Added: 2009-06-26 00:37:55 |
| keyrecoveryencryption98.pdf Path: Duke >> X >> 182 Fall, 2009 Description: THE OF KEY RECOVERY ,KEYESCROW , TRUSTED THIRD PARTY ENCRYPTION RISKS & A Report by an Ad Hoc Group of Cryptographers and Computer Scientists Hal Abelson Ross Anderson Steven M. Bellovin Josh Benaloh Matt Blaze Whitfield Diffie John Gilmore Peter ... Date Added: 2009-06-26 00:50:21 |
| topic10.pdf Path: SMU - Cox School of Business >> EMIS >> 8361 Fall, 2009 Description: Helgason EMIS 8361 Spring 2006[Topic 10] 1 Helgason EMIS 8361 Spring 2006[Topic 10] 2 Incorporating Inflation Constant Dollar Computations Many commodities go up in price with the passage of time. The observed effect is called inflation. An equ... Date Added: 2009-06-26 00:51:16 |
| board.pdf Path: Virgin Islands >> GROUP >> 499 Fall, 2009 Description: M ICROCONTROLLERS STK500 STARTER KIT AND DEVELOPMENT SYSTEM The Atmel AVR STK500 is a starter kit and development system for Atmels AVR Flash microcontrollers. The STK500 gives designers a quick start to develop code on the AVR combined with featu... Date Added: 2009-06-26 00:52:36 |
| Case Analysis PowerPoint Path: CSU Fullerton >> BUAD >> 501 Spring, 2009 Description: Understanding the Case Method of Learning l What is the case method? Applies the ancient Socratic technique of teaching people how to think and how to ask questions Develops skills in: Diagnosing situations Defining problems Analyzing the sour... Date Added: 2009-06-26 01:15:18 |
| exam05.pdf Path: Lake County >> CPSC >> 226 Fall, 2009 Description: CPSC 226 Your name_ Herbicide Application Exam Fall, 2004 Potentially useful information: 1 acre = 43560 ft2 1 mile = 5280 ft 1 gallon = 3.785 liters = 3785 ml = 128 fluid ounces = 4 quarts = 8 pints 1 pound = 16 ounces 1 acre = 0.405 hectare Show... Date Added: 2009-06-26 01:57:22 |
| hahn.pdf Path: Washington >> GS >> 55103 Fall, 2009 Description: ... Date Added: 2009-06-26 02:08:56 |
| YKL214C.t2k.dssp-ehl2-logo.pdf Path: UCSC >> YKL >> 214 Fall, 2009 Description: YKL214C.t2k DSSP-EHL2 2 1 C C C C H C C H C X X X X X X X X H C HHHHH H X E E C C C C H H X X X X X X X X X X X X E X X CCCCCCCCC X H X C X H X H H C C C C H C H C C E E H C C C H C H C C C H H C H H X X X X X X X X X X X X X HHH CC ... Date Added: 2009-06-26 02:19:41 |
| YKL203C.t2k.dssp-ehl2-logo.pdf Path: UCSC >> YKL >> 203 Fall, 2009 Description: T H 2 1 HHH C X X X X X X H 551 560 570 580 590 H 2 1 H H H H C H CCHHHHCCCCCXCCCCCCCCCCCCC X X X X CCC X X X 601 610 620 630 640 S 2 1 C X H H H H H C C C C C X X X X X X X X X X 651 660 670 680 690 H 2 1 HHHH C C C X X X X... Date Added: 2009-06-26 02:19:50 |
| hw9sol.pdf Path: CUNY Baruch >> MAT >> 320 Fall, 2009 Description: Math 320 Homework 9 solutions Problem 1. True or false? Justify your answer. If f : D R is continuous and D is a closed set, then f (D) is a closed set. FALSE: f dened by f (x) = f (R) = (0, 1] is not closed. 1 1+x2 is continuous on the closed set... Date Added: 2009-06-26 02:27:23 |
| dm5part1.pdf Path: UF >> CIS >> 4930 Fall, 2008 Description: University of Florida CISE department Gator Engineering Clustering Part 1 Dr. Sanjay Ranka Professor Computer and Information Science and Engineering University of Florida, Gainesville University of Florida CISE department Gator Engineering Wh... Date Added: 2009-06-26 02:36:32 |
| lec11.pdf Path: Allan Hancock College >> LING >> 10002003 Fall, 2009 Description: LING1000, 6100 Lectures week 11: Linguistic change and variation Page 1 Revision questions (1) What kind of relationship does English have with (a) German, (b) Common Germanic, (c) French? (2) Why does it seem likely that there was variation in th... Date Added: 2009-06-26 02:43:46 |
| Chap12I.pdf Path: Case Western Reserve University >> ASTR >> 201 Fall, 2009 Description: Chapter 12 Asteroids, Comets, and Dwarf Planets Their Nature, Orbits, and Impacts 12.1 Asteroids and Meteorites Our goals for learning: What are asteroids like? Why is there an asteroid belt? Where do meteorites come from? What are asteroids lik... Date Added: 2009-06-26 02:47:25 |
| tutorial1.pdf Path: University of Toronto >> CSC >> 418 Fall, 2009 Description: CSC 418. Tutorial 1 OpenGL OpenGL: A high-performance, window-system independent, software interface to graphics hardware. Your Program Runs on both Hardware 1 and Hardware 2 GLU (draw sphere) OpenGL (draw polygon) Windows System A Hardware 1 GLUT... Date Added: 2009-06-26 02:47:57 |
| xiulin_Common_Questions_and_Thoughts_for_Lab_1_v2.pdf Path: Cornell >> WEB >> 171 Fall, 2009 Description: CommonQuestionsandThoughtsforLab1 1. Howtodeletedata? Use thecursortohighlight thedatayouwanttodelete;itissimilartohowyou highlightthingsinyourworddocument.Oryoucanputyourcursorbesidethedata youwanttodelete,andrightclickit;thewholerowwillbehighlighte... Date Added: 2009-06-26 03:01:41 |
| chap7.pdf Path: Lake County >> ASTRO >> 100 Fall, 2009 Description: | u r y y wdhernddws p s yr ~ psr zqv ry v |p yr p s s s yr p hr l s hu g p dvWwtitwo{tHjfqti6uvlterU}ivtwHyvkPjwfp u sp zqv ry v q rvouq |p yr yr pr h srp h p ur p s h sr q p h f ddw}itwo{tm{iwfPr)dthtCtbk6ut... Date Added: 2009-06-26 03:08:41 |
| ps1ans Path: USC >> ECON >> 203 Spring, 2009 Description: ECON 205: PRINCIPLES OF MACROECONOMICS FALL 2008 MARK MOORE PROBLEM SET 1: SOLUTIONS 1. To calculate the growth rate of GDP over the 1960s, use the formula [(GDP1970 GDP1960)/ GDP1960], or more simply, [(GDP1970/GDP1960)- 1]. Use a similar calculati... Date Added: 2009-06-26 03:16:03 |
| pr9ec70204.pdf Path: UPenn >> EC >> 70204 Fall, 2009 Description: Problem Set 9 Econ 702, Spring 2004 April 12, 2004 Problem 1 (Fishermen Economy) Consider the fishermen economy that was introduced in class, with an Archipelago with a continuum of islands. There is a fisherman on each island (and the fisherman can... Date Added: 2009-06-26 03:56:12 |
| 5_Schema1.pdf Path: Johns Hopkins >> APL >> 605444 Fall, 2009 Description: XML Schema 605.444 / 635.444 David Silberberg Lecture 5 D. Silberberg XML: Technology & Application Schema - 1 1 Problems with Document Type Definitions (DTDs) XML came out of the SGML world So, too, DTDs came out of the SGML world DTDs are v... Date Added: 2009-06-26 04:00:23 |
| PhylogeneticAnalysis.pdf Path: Lake County >> MCB >> 432 Fall, 2009 Description: Copyright (c) 1992-2008 by Gary J. Olsen From Sequences to Trees Identify Homologous Sequences Align Sequences Select Unambiguous Portions of Sequence Alignment Choose a Tree Inference Method If You Chose a Clustering Method: Put the data in Get a t... Date Added: 2009-06-26 04:20:17 |
| econ70205_13.pdf Path: UPenn >> EC >> 70205 Fall, 2009 Description: 1 1.1 April 22 OLG So far we have been utilizing the NGM with inifinite horizon with no demographic details. This was not because we did not have the tools to consider a finite horizon. Many interesting questions in macroeconmics should be approach... Date Added: 2009-06-26 04:31:26 |
| pr9ec70204.pdf Path: UPenn >> EC >> 70205 Fall, 2009 Description: Problem Set 9 Econ 702, Spring 2004 April 12, 2004 Problem 1 (Fishermen Economy) Consider the fishermen economy that was introduced in class, with an Archipelago with a continuum of islands. There is a fisherman on each island (and the fisherman can... Date Added: 2009-06-26 04:31:31 |
| l12.ps Path: Midwestern State University >> CSE >> 2320 Fall, 2009 Description: %!PS-Adobe-2.0 %Creator: dvipsk 5.58f Copyright 1986, 1994 Radical Eye Software %Title: l12.ul.dvi %Pages: 13 %PageOrder: Ascend %BoundingBox: 0 0 612 792 %DocumentPaperSizes: Letter %EndComments %DVIPSCommandLine: dvips -f l12.ul.dvi %DVIPSParameter... Date Added: 2009-06-26 04:39:12 |
| ism50_lecture9.pdf Path: UCSC >> CMPS >> 050 Fall, 2009 Description: ISM 50 - Business Information Systems Lecture 9 Instructor: Katerina Potika UC Santa Cruz April 29, 2008 Outline Announcements Student Presentation E-commerce (cont\'d) Student Presentation Information Technology Announcements Assignment 3 DUE on Th... Date Added: 2009-06-26 04:49:11 |
| lesson_12.pdf Path: Texas Tech >> M >> 5364 Fall, 2009 Description: A Lesson 12: Making Block Matrices in L TEX Name: Putting vertical lines all the way down the columns is as easy as pie. Just array to make the matrix and insert a vertical bar between the columns where you want a vertical bar. Note that this is exa... Date Added: 2009-06-26 04:57:55 |
| vita_temp.pdf Path: Texas Tech >> M >> 5364 Fall, 2009 Description: VITA DAVID S. GILLIAM PERSONAL INFORMATION Phone (work): Phone (home): Citizenship: Email: EDUCATION: B.S. M.S. Ph.D. Idaho State University Idaho State University University of Utah 1969 1971 1977 (806) 742-2566 (806) 791-4693 U.S.A. gilliam@texas.m... Date Added: 2009-06-26 04:57:56 |
| chapter10.ppt Path: Duke >> X >> 006 Fall, 2009 Description: Solving Problems Recursively q Recursion is an indispensable tool in a programmer\'s toolkit Allows many complex problems to be solved simply Elegance and understanding in code often leads to better programs: easier to modify, extend, verify (and ... Date Added: 2009-06-26 05:26:00 |
| mocFSM-CFSM.pdf Path: Bergen CC >> EE >> 249 Fall, 2009 Description: Models Of Computation for reactive systems Main MOCs: Communicating Finite State Machines Dataflow Process Networks Petri Nets Discrete Event (Abstract) Codesign Finite State Machines Main languages: StateCharts Esterel Dataflow networks ... Date Added: 2009-06-26 05:43:05 |
| week7_aglipay.doc Path: Frostburg >> P >> 492 Fall, 2009 Description: Progress Report for Senior Research Laboratory By: Cheryl W. Aglipay Title: PC-Based Online Power Quality Monitoring Research Advisor and Mentor: Dr. Oguz Soysal Instructor: Dr. Stephen Luzader Course: PHYS 400 (Senior Research and Seminar in Physics... Date Added: 2009-06-26 05:47:34 |
| Soln02047 Path: LSU >> CE >> 2450 Spring, 2009 Description: COSMOS: Complete Online Solutions Manual Organization System Chapter 2, Solution 47. Free-Body Diagram: (a) Fx = 0: - TAB cos 30 + R cos 65 = 0 R= cos 30 TAB cos 65 Fy = 0: - TAB sin 30 + R sin 65 - ( 550 N ) = 0 cos 30 TAB - sin 30 + sin 6... Date Added: 2009-06-27 17:12:38 |
| Soln02089 Path: LSU >> CE >> 2450 Spring, 2009 Description: COSMOS: Complete Online Solutions Manual Organization System Chapter 2, Solution 89. ! \" BA = ( 4 m ) i + ( 20 m ) j - ( 5 m ) k BA = F = F BA ( 4 m )2 + ( 20 m )2 + ( - 5 m )2 = 21 m ! \" BA 2100 N ( 4 m ) i + ( 20 m ) j - ( 5 m ) k = F = 21 ... Date Added: 2009-06-27 17:15:15 |
| Lecture_7 Path: Simon Fraser >> CHEM >> CHEM 121 Spring, 2009 Description: Todays Lecture Types of Chemical Reactions and Solution Stoichiometry 4.9 Acid-Base Reactions 4.10 Oxidation-Reduction Reaction (or Redox Reactions) 4.11 Balancing Redox Reactions p y 4.12 Simple Redox Titrations (review on your own) 1 Definition o... Date Added: 2009-06-27 18:54:52 |
| Study Guide for text - Linear Algebra And Its Applications - David C Lay - 3rd ed.0073 Path: Penn State >> MATH >> 220 Fall, 2008 Description: ... Date Added: 2009-06-28 08:17:00 |
| The%20eye Path: Texas >> BIO 311D >> bio 311d Summer, 2009 Description: ... Date Added: 2009-06-28 16:09:43 |
| HW 6 Path: Texas >> PHY >> 303l Fall, 2007 Description: Kapoor (mk9499) oldhomework 06 Turner (60230) This print-out should have 11 questions. Multiple-choice questions may continue on the next column or page find all choices before answering. 001 (part 1 of 3) 10.0 points A proton has an initial velo... Date Added: 2009-06-28 22:14:30 |
| MSE2001H_7_1 Path: Georgia Tech >> MSE >> 2001 Spring, 2009 Description: 1 Chapter 7 Phase Equilibria and Phase Diagrams Introduction The one-component phase diagram Phase equilibria in a two-component system The eutectic phase diagram The peritectic phase diagram The monotectic phase diagram Complex di C l diagra... Date Added: 2009-06-29 19:01:25 |
| les choristes - extra credit Path: Alabama >> FR >> 323 Spring, 2009 Description: Alison Claire Burnette le 20 avril Reaction Paper: Les Choristes The last installment of the French Film Series for the Spring 2009 featured the French drama Les Choristes. As someone who plans to be a teacher one day, this movie touched me in a spec... Date Added: 2009-06-29 23:13:31 |
| m2l8 Path: USC >> CE >> 358 Fall, 2006 Description: Module 2 Analysis of Statically Indeterminate Structures by the Matrix Force Method Version 2 CE IIT, Kharagpur Lesson 8 The Force Method of Analysis: Beams Version 2 CE IIT, Kharagpur Instructional Objectives After reading this chapter the student... Date Added: 2009-06-30 23:48:21 |
| syllabus 6 Path: NYU >> EXPRESSIVE >> V55.0750 Spring, 2009 Description: ... Date Added: 2009-07-02 18:29:58 |
| chapter 17 - 1 Path: NYU >> PSYCH >> V89.0001 Spring, 2009 Description: ... Date Added: 2009-07-02 18:34:08 |
| 20_Civil_Liberties_64_slides Path: Chadron >> PS >> PS 231 Spring, 2009 Description: Civil Liberties: Protecting Individual Rights Chapter 20 Click to edit Master subtitle style Section 1 Due Process of Law Due Process The government cannot deprive anyone of \"life, liberty or property, without due process.\" n The government must a... Date Added: 2009-07-05 15:16:47 |
| wk4 entrepreneur Path: Agnes Scott >> MGMT >> 303 Spring, 2008 Description: I chose to write about the founder of Taco Bell, Glen Bell. Not many know or even care about Glenn Bell, but he was a successful entrepreneur. Taco Bell is a successful fastfood chain, taking in over $1.8 billion in 2005 (Wikipedia). Bell was born in... Date Added: 2009-07-06 17:27:23 |
| Optional.HW.1 Path: UC Riverside >> ECON >> 200a Fall, 2008 Description: OPTIONAL PROBLEM SET 1 ECONOMICS 200A R. R. RUSSELL FALL 2008 1. Show that, if continuity (C5) is not assumed, each of the following statements is false: (a) (C7)\' (C7). (b) (C7)\" (x) is convex for all x X. 2. Show that strict convexity of (x) re... Date Added: 2009-07-06 20:40:54 |
| Chpt01 Path: 東京大学 >> MGT >> BAM313 Spring, 2009 Description: Contemporary Management Second Edition Gareth R. Jones Texas AM University Charles W. L. Hill University of Washington Irwin/McGraw-Hill The McGraw-Hill Companies, Inc., 2000 1-2 1 Managers and Managing ... Date Added: 2009-07-06 22:46:51 |
| Soln11160 Path: LSU >> CE >> 2460 Spring, 2009 Description: COSMOS: Complete Online Solutions Manual Organization System Chapter 11, Solution 160. Radius of Earth Radius of orbit Normal acceleration R = ( 3960 mi )( 5280 ft/mi ) = 20.908 106 ft r = ( 3960 + 10900 )( 5280 ) = 78.4608 106 ft an = gR 2 r2 a... Date Added: 2009-07-07 11:56:47 |
| practice_exam_1_page1 Path: BYU >> ACCT >> 210 Spring, 2009 Description: 0 !\" % \" \"$%\' ( \" # \' ) !\"\'\"*\"\' $#\' $%!\" # # + #, \' -0 8/20 144/22600460 735309 002 2470 002 . 705 60770 33 7505 046 3 6327426 70 5 7 4 73 7540 7135409 . 204605 0246773 0 5 7 8\" ($# $%!\" %: (% \' \' + ... Date Added: 2009-07-07 18:19:16 |
| homework8-solutions.doc Path: Iowa State >> CPRE >> 288 Fall, 2009 Description: Assigned: 03/21/2007 Due: 03/27/2007 CprE 211 Spring 2007 Homework 8 Name: Lab section #: Email address: NOTE: Homework answers must be typed using a word editor. Handwritten answers will not be accepted. The homework is due in the class on the du... Date Added: 2009-07-08 06:50:48 |
| main6.txt Path: UMBC >> LEC >> 202 Spring, 2009 Description: everest% CC main6.C bstring2.C main6.C: bstring2.C: everest% everest% a.out Tiny Tim age=6 Jane Doe age=27 John Smith age=30 Bugs Bunny age=36 Groucho Marx age=40 Student: Tiny Tim age=6 year=0 gpa=3 Student: Jane Doe age=27 year=2 gpa=3.4 Student... Date Added: 2009-07-08 07:42:49 |
| main3.txt Path: UMBC >> LEC >> 202 Spring, 2009 Description: everest% CC main3.C bstring2.C main3.C: \"main3.C\", line 22: error(1515): a value of type \"Student *\" cannot be assigned to an entity of type \"Person *\" ptrptr = ^ \"main3.C\", line 23: error(1515): a value of type \"F... Date Added: 2009-07-08 07:42:51 |
| 08np-complete.ppt Path: ASU >> CSE >> 450 Fall, 2008 Description: Chapter 8 NP and Computational Intractability Slides by Kevin Wayne. Copyright 2005 PearsonAddison Wesley. All rights reserved. 1 8.3 Definition of NP Decision Problems Decision problem. X is a set of strings. Instance: string s. Algorithm A s... Date Added: 2009-07-08 07:44:48 |
| ps7_cib05.pdf Path: Wellesley >> MAS >> 221 Fall, 2009 Description: 5 Layer Basics Both Adobe Photoshop and Adobe ImageReady let you isolate different parts of an image on layers. Each layer can then be edited as discrete artwork, allowing unlimited flexibility in composing and revising an image. 130 LESSON 5 Layer... Date Added: 2009-07-08 07:59:05 |
| MarsSketch2Scan2.pdf Path: San Diego State >> ART >> 496 Fall, 2008 Description: ... Date Added: 2009-07-08 09:25:10 |
| geoeng.pdf Path: CA Merced >> ENVE >> 118 Fall, 2008 Description: Vol. 64, No. 2, p. 14-18, 59 DOI: 10.2968/064002006 20 reasons why geoengineering may be a bad idea Carbon dioxide emissions are rising so fast that some scientists are seriously considering putting Earth on life support as a last resort. But is thi... Date Added: 2009-07-08 09:28:45 |
| Cover Page Ex 2 Path: Stony Brook University >> CHE >> 131 Fall, 2008 Description: CHE 132 Spring 2009 Exam 02 Form _ Directions 1. Do not open this test until told to do so. 2. Only your Stony Brook ID card (take it out now), #2 pencils, erasers, and a calculator are allowed. All other items must be placed out of sight and rea... Date Added: 2009-07-15 23:04:52 |
| Syllabus Path: BU >> AR >> 100 Spring, 2008 Description: Archaeology 100: Great Discoveries in Archaeology Spring, 2008 Course description: This course introduces students to the great discoveries in archaeology and the way that archaeologists use material culture to reconstruct past human behavior and ... Date Added: 2009-07-16 12:56:35 |
| Geol Quiz 1 Path: Maastricht >> GEOL >> 100 Spring, 2009 Description: Review Assessment: CHAPTER 1 QUIZ Name CHAPTER 1 QUIZ Status Completed Score 19 out of 20 points Instructions All quizzes in this course are untimed, open-book quizzes. You can print out the quiz and work on it as you read the chapter if you like. If... Date Added: 2009-07-16 23:53:14 |
| Chapter 25 Practice Materials Path: Troy >> ACCT >> 2292 Spring, 2008 Description: Chapter 25 Differential Analysis and Product Pricing MULTIPLE CHOICE 1. The amount of increase or decrease in revenue that is expected from a particular course of action as compared with an alternative is termed: a. manufacturing margin b. contributi... Date Added: 2009-07-18 12:03:08 |
| Docs742 Path: Berkeley >> EPS 80 >> 80 Spring, 2009 Description: OVERVIEW RATIONALE USGBC LEED CONCLUSION PERCEPTION Test OVERVIEW RATIONALE USGBC LEED CONCLUSION REALITY Test STEWARD this market transformation OFFER expertise USGBC EDUCATE the industry and the public PROVIDE tools FORUM for indus... Date Added: 2009-07-21 19:14:09 |
| EvsBlaws_ampere Path: Texas A&M >> PHYS >> 208 Spring, 2009 Description: ECoL4jow,5 A r fieic, 2 r cAi D I I -F 75 54 . rt rfmce .cC4M oYr V - e-vc - k4- tVLV-+ ey s L. 44 , I . - / 7 Iofi SCkr4 ovev kv Crrc.%* epecRUy 5 i.tS.L c( ... Date Added: 2009-07-22 01:35:46 |
| IEOR 165 Lecture 16 June 26 2009 Path: Berkeley >> IEOR >> 165 Summer, 2009 Description: Quality Control Overview - X b a r char t con t rol Sample data x1.xn CASE 1 Kno w n m e)n va ri a nce a , ( 2 Also define control level {false alarm} =P xbar-n~N(0,1) =Pxbar>UCLin control =Pxbar-n>UCL-icicnUCL=ic+Z*icn We replace Z wi... Date Added: 2009-07-22 09:47:57 |
| chapter 10 Externalities Path: Texas A&M >> ECON >> 203 Fall, 2009 Description: Chapter 10 Externalities MULTIPLE CHOICE 1. Which of the following is the best statement about markets? a. Markets are usually a good way to organize economic activity. b. Markets are generally inferior to central planning as a way to organize econom... Date Added: 2009-07-22 18:21:20 |
| 16 Path: CA Baptist >> BUS >> BUS217 – Spring, 2009 Description: Chapter 16 Oligopoly MULTIPLE CHOICE 1 . Markets with only a few sellers, each offering a product similar or identical to the others, are typically referred to as a. competitive markets. b. monopoly markets. c. monopolistically competitive markets.... Date Added: 2009-07-23 10:37:43 |
| 1 Path: CA Baptist >> BUS >> BUS217-A Fall, 2009 Description: PowerPoint Lecture Presentation to accompany Principles of Economics, Third Edition N. Gregory Mankiw Prepared by Mark P. Karscig, Central Missouri State University. 1 INTRODUCTION Ten Principles of Economics 1 Copyright 2004 South-Western/Thom... Date Added: 2009-07-23 10:39:37 |
| 6 BIO 326R Metabolism 2 Path: Texas >> BIO326R >> 52035 Spring, 2009 Description: BIO 326R Metabolism 2 Carbohydrates Pyruvate Pyruvate to Acetyl CoA is not considered part of the TCA cycle NAD+ NADH + H+ Alanine CO2 2C Acetyl CoA Lipids 4C Oxaloacetate NADH + H+ Citrate 6C Malate NAD+ Isocitrate NAD+ NADH + H... Date Added: 2009-07-24 20:49:39 |
| ex2soln Path: Purdue >> ECE >> 202 Summer, 2009 Description: ECE 202 - Linear Circuit Analysis II Exam 2 Solutions October 30, 2008 Solution 1 Vout (t) = Vin (t) h(t) = 30 sin[(60t + 1)] 2 t = 60 sin 60 t = 60 sin 60t = 60 sin 60t 1 2 1 40 +1 1 40 = 60 cos(60t) 2 Hence (3) is the correct answer So... Date Added: 2009-07-25 01:09:14 |
| ex2soln Path: Purdue >> ECE >> 202 Summer, 2009 Description: ECE 202 - Linear Circuit Analysis II Exam 2 Solutions October 30, 2008 Solution 1 Vout (t) = Vin (t) h(t) = 30 sin[(60t + 1)] 2 t = 60 sin 60 t = 60 sin 60t = 60 sin 60t 1 2 1 40 +1 1 40 = 60 cos(60t) 2 Hence (3) is the correct answer So... Date Added: 2009-07-25 01:13:54 |
| Assetto341 Path: Rutgers >> POLS >> 101 Spring, 2009 Description: 1 PO 341.001 Western European Government and Politics MWF 1:00 1:50 Clark C142 Dr. V.J. Assetto Clark B-349 491-5369 E-mail: aalerie.assetto@colostate.edu OFFICE HOURS: MWF 2:00 2:50p AND BY APPOINTMENT Fall 2008 COURSE OBJECTIVES: The goal of ... Date Added: 2009-07-25 19:10:35 |
| Berg341 Path: Rutgers >> POLS >> 101 Spring, 2009 Description: PO341 - Comparative European Systems Section 1 Spring 2008 Instructor: Prof. Marni Berg Office: Clark C-332 Phone: 491-3446 Office Hours: M 10 10:50; W noon 1 pm and by appointment e-mail: jeffandmarni@msn.com or marni.berg@colostate.edu COURSE DES... Date Added: 2009-07-25 19:10:40 |
| berg 345 Path: Rutgers >> POLS >> 101 Spring, 2009 Description: PO 345 Russian, East And Central European Politics Dr. Marni Berg Clark C-332 491-3446 E-mail: jeffandmarni@msn.com or marni.berg@colostate.edu Office Hours: Mon. 10:00 10:50am Wed. 12:00 1:00 pm And by appointment Fall 2006 Course Objectives: Th... Date Added: 2009-07-25 19:10:43 |
| Demo S08 Syll Final Path: Rutgers >> POLS >> 101 Spring, 2009 Description: COLLEGE OF THE HOLY CROSS DEMOCRATIZATION Political Science 258 Spring 2008 TTh 2-3:15 p.m. Professor Vickie Langohr 326 Fenwick 793-2763 Vlangohr@holycross.edu The term \"democratization\" refers to the process of transforming an authoritarian politi... Date Added: 2009-07-25 19:11:01 |
| PS374 Path: Rutgers >> 790 >> 374 Spring, 2009 Description: 790:374:01 45438 01 Democratic Political Philosophy, Spring 2009 TTH 7:40-9:00 MU-210 CAC Jonathan McFall jomcfall@yahoo.com mcfall@rci.rutgers.edu Office hours: Immediately following class on Thursday (9:00-10:00) and by appointment THIS SYLLABUS IS... Date Added: 2009-07-25 20:00:48 |
| chmsroom Path: Pensacola Junior College >> CHEM >> 2211 Spring, 2009 Description: Chemistry Study Room Room 9721 (Across from Dr. Grow and Dr. Philips\' Office) In order to assist organic chemistry students with their studies, the Physical Sciences Department has established a study room for chemistry students. In this room you wil... Date Added: 2009-07-26 08:17:58 |
| 2007 R2P-CS Brochure Path: Georgia Tech >> INTA >> 2030 Summer, 2009 Description: http:/www.responsibilitytoprotect.org/index.php/features/556?theme=alt5 ... Date Added: 2009-07-26 14:59:34 |
| CH9 Zumdahl Thermochem 2008 for Web Path: Texas >> CHEM 301 >> 89959 Spring, 2009 Description: Chapter 9 Thermodynamics: The First Law Work/Heat E = q + w = heat + work Reaction Enthalpies 1 Combustion of Gasoline 2C8H18(l) + 25O2(g) 18H2O (l) + 16CO2 (g) Hrxn = -1.09 x 104 kJ 5,450 kJ of energy released per mole of octane Combustion of 1 gal... Date Added: 2009-07-27 11:49:16 |
| Homework #4 Vectors, Horizontal Projectiles Path: Texas A&M >> PHYSICS >> 1301 Spring, 2009 Description: sanchez (es25396) Homework #4 Vectors, Horizontal Projectiles guevara (130101) This print-out should have 12 questions. Multiple-choice questions may continue on the next column or page find all choices before answering. 001 10.0 points A person ... Date Added: 2009-07-30 15:50:26 |
| jaymesbio Path: University of Phoenix >> COM 140 >> COM 140 Spring, 2009 Description: Jaymes Bio Im Jayme, 24 years old. I live in Jonesboro, Arkansas with my mother and 10 year old nephew whom I help take care of. I own 2 beautiful orange tabbys who often remind me of children. I chose the compassionate lifestyle of a vegan, I lo... Date Added: 2009-08-03 02:56:42 |
| ps8.pdf Path: Carnegie Mellon >> CS >> 15384 Fall, 2009 Description: Fall 200715-384 Robotic Manipulation: Problem Set 8 Due: 7 Dec 2007 IMPORTANT: Please show all work and write clearlyall intermediate steps must be shown and legible. You are encouraged to work with other students to nd the answers to these problems,... Date Added: 2009-08-04 03:11:32 |
| Econometric Tests Path: Berkeley >> ECON >> 140 Spring, 2008 Description: Econometric Tests 1. Assumption 1, errors are normally distributed a. Jarque-Berra Test 2. Assumption 2, expected value of the errors is zero. a. T-test on errors, Ho: E(e)=0 3. Assumption 3, No autocorrelation a. Durbin-Watson test b. Durbin\'s H tes... Date Added: 2009-08-06 12:06:57 |
| V. Origins of the WW II Path: Izmir University of Economics >> INTERNATIO >> INT Spring, 2009 Description: The Origins of the Second World War (1929-1935) After 1930 and 1931, the great economic crisis shook up the industrial world and the political regimes. There were also serious failures of the system of collective security in the international affairs... Date Added: 2009-08-06 16:50:51 |
| Econ306Lecture4 Path: Izmir University of Economics >> ECONOMICS >> ECON305 Spring, 2009 Description: International Economics II Lecture Notes 4 Alper Duman July 10, 2009 Alper Duman International Economics II Lecture Notes 4 Foreign Exchange Market Even if general public can acquire FX immediately, bulk of the transactions takes place within tw... Date Added: 2009-08-06 17:12:51 |
| by123 chapter 17 Path: UAB >> BY >> 123 Spring, 2009 Description: CHAPTER 17: FROM GENE TO PROTEIN Proteins are the link between genotype and phenotype Transcription- the synthesis of RNA under the direction of DNA (DNA to RNA, takes place in the nucleus) mRNA- RNA that carries a genetic message from th... Date Added: 2009-08-07 01:51:32 |
| 2002 CBS Casebook_32 Path: Acton School of Business >> CBS >> casebook Spring, 2009 Description: PD PD F- XC h a n g e Vi e w F- XC h a n g e Vi e w er er ! O W N y bu to k lic C m C lic k to bu y N .c O W w .d o c u -tr a c k ! w o .d o c u -tr a c k .c PORTER\'S FIVE FORCES Given how often you have heard (or ... Date Added: 2009-08-08 16:11:02 |
| ECN 302-602 (6), The Government Budget Path: Syracuse >> ECN >> 302 Summer, 2009 Description: ... Date Added: 2009-08-09 20:04:48 |
| Hashtables.pdf Path: Maharishi >> CS >> 435 Fall, 2009 Description: Hashtables The HASHTABLE ADT 1. A Hashtable is a generalized array. The most direct generalization is achieved by Direct-Address Tables, but for many applications, these are impractical. (Example: Employee numbers) 2. Space requirements for storing ... Date Added: 2009-08-10 19:49:23 |
| Instrument Regs Worksheet.doc Path: Uni. Westminster >> IRK >> 0205 Fall, 2009 Description: INSTRUMENT REGS WORKSHEET Answer questions and cite the regulation number associated with the answer. Part 61 1. What is the difference between a Flight Simulator, Flight Training Device and a PCTAD? 61.12- A Flight Simulator is a device that has a f... Date Added: 2009-08-10 19:49:25 |
| ContChartVar.xls Path: NJIT >> JP >> 673 Fall, 2009 Description: CONTROL CHART Template FOR VARIABLES (v. B3 This spreadsheet allows plotting X bar-charts and R- charts using your own data set. In this chart we tested the energy levels of solar cells (in volts) four times a day. FIRST STEP: Coefficients for the ce... Date Added: 2009-08-10 19:49:37 |
| finalreview.doc Path: Acton School of Business >> ECON >> 461 Fall, 2008 Description: Review Questions for Final Exam Fall 2005 Urban Economics 1. Urban Giants (Ades and Glaeser, NBER 4715) See also class notes entitled Optimal City Size. (a) How do trade restrictions in a country impact the size of a dominant city (DC)? (b) Does dic... Date Added: 2009-08-10 19:49:48 |
| physlabf08[1].doc Path: Cal Poly Pomona >> GEO >> 101 Fall, 2009 Description: PHYSICAL GEOGRAPHY ASSIGNMENT 1 LAB 1 Due Oct. 6, (Monday) 2008 1. At the December solstice : How long is sunlight available at the Antarctic Circle, The equator, the Arctic Circle? Where is the subsolar point? What is the approximate distance bet... Date Added: 2009-08-10 19:49:53 |
| Class 2 - students.ppt Path: SMU - Cox School of Business >> MKTG >> 6217 Fall, 2008 Description: Global Strategy Global Marketing Strategy Global Marketing Strategy (Zou The degree to which a firm globalizes across national markets through: standardization of marketing mix coordination of value chai... Date Added: 2009-08-10 19:50:43 |
| T0500.t04.bys-logo.pdf Path: UCSC >> T >> 0500 Fall, 2009 Description: T0500.t04 bys 4 3 2 1 401 410 420 430 440 H 4 3 2 1 E H S H G P T P T H E 451 460 470 480 490 P 4 3 2 1 T P E P E Y H G P T P H E H G T P E P 501 510 520 530 540 H 4 3 2 1 E P E H G P H E P H E P 551 560 570... Date Added: 2009-08-10 19:51:46 |
| hw1.pdf Path: Berkeley >> ASTRO >> 202 Fall, 2009 Description: Homework #1 1. Energetics of a Gas In a lab setting, the energetics of a fluid is generally far simpler than in an astrophysical fluid, where a number of different heating and cooling processes can operate. Since many texts gloss over some of the iss... Date Added: 2009-08-10 19:53:50 |
| Ch5PublicKeyPart1v1.ppt Path: Midwestern State University >> CS >> 427 Fall, 2009 Description: CHAPTER 5: PUBLIC KEY SYSTEMS Secret (symmetric) key systems have been used for centuries. Have worked well in many cases and failed in others. Two problems have been persistent: Key distribution doesn\'t scale well. Authentication (ensuring the mess... Date Added: 2009-08-10 19:54:39 |
| slac-pub-4343.pdf Path: Stanford >> PUBS >> 4250 Fall, 2009 Description: * . =- SLAC-PUB-4343 October 1987 (T/E) Search for the Decay II+ + Limit J. Adler, R.E. A.L. C. Grab, R.F. J. J. Becker, Cassell, Duncan, ,x+vcL and an Upper Decay Constant+ J.S. Brown, K.O. Bunnell, T.H. Burnett, D.E. Dorfan, D.G. G.P. Dubois, H... Date Added: 2009-08-10 19:56:14 |
| week9.ppt Path: East Los Angeles College >> COMP >> 526 Fall, 2009 Description: Dynamic vs. Static Networks Ideally, we would like distributed algorithms to be: dynamic, i.e., be able to respond to changes in the network, and fault-tolerant, i.e., able to recover correctly and gracefully from failures However, for simpli... Date Added: 2009-08-10 19:56:19 |
| fin701hw4&5Q.doc Path: Temple >> FINANCE >> 701 Fall, 2009 Description: Homework 4 & 5 (Fin701 Prof. Mao) Due by 11/7/2006 DD13.1: Suppose the existence of three assets with the following characteristics: A B C E(ri) 0.07 0.09 0.17 bi 0.5 1.0 1.5 Assume that the specific risk can be eliminated through diversification ... Date Added: 2009-08-10 19:56:35 |
| 2.3prac.pdf Path: SWCCD >> MATH >> 250 Fall, 2009 Description: f (r ) = r ( 5 - r 7 ) P ( s ) = s 5 cos s Page 1 g ( x) = x -4 sin x R ( s ) = s -5 cos s P(s) = 8s s + 10 4 Page 2 R( s) = 3+ s s2 + 8 P (t ) = sin t t2 + 4 Page 3 ! P (v ) = v 5 - \" 4 v+3 \" # $ % ! \" 5 \" # $ H (s) = ( s 4 + 4 ... Date Added: 2009-08-10 19:57:21 |
| Quiz 2 B Solutions.doc Path: Iowa State >> STAT >> 104 Fall, 2008 Description: Stat 104, Section E Quiz 2 B (green paper) Name: Solutions_ The ages of individuals in a (made-up) simple random sample of 10 spectators from last week\'s Iowa State football game are given below. 18, 20, 20, 32, 23, 17, 25, 26, 31, 22 List in incr... Date Added: 2009-08-10 19:58:48 |
| exam2p_00key.pdf Path: NMSU >> CHEM >> 112 Fall, 2009 Description: ... Date Added: 2009-08-10 19:59:06 |
| slac-pub-4478.pdf Path: Stanford >> PUBS >> 4250 Fall, 2009 Description: SLAC-PUB-4478 TM 1494 REV May 1988 (Ml THE MAGNETIC PROPERTIES OF THE SLC INTERSECTION REGION SUPERCONDUCTING QUADRUPOLE TRIPLETS A. D. McInturFf. National J. A. Carson, H. E. Fisk REV Fermi Accelerator Laboratory* P. 0. Box 500 \' Batavia, Illinoi... Date Added: 2009-08-10 19:59:12 |
| grille.doc Path: Cal Poly >> MEC >> 2100 Fall, 2009 Description: VALUATION DE LA CONTRIBUTION INDIVIDUELLE AU TRAVAIL D\'QUIPE Grille d\'valuation Nom de l\'valuateur tudiant : _ Signature : _ quipe no : _ Noms de tous les membres de l\'quipe 1. _ 2. _ 3. _ 4. _ 5. _ 6. _ Contribution au bon droulement des runions Ra... Date Added: 2009-08-10 19:59:17 |
| Chem 343 Quiz2_Nov9_with_answers.pdf Path: Ill. Chicago >> CHEM >> 343 Fall, 2008 Description: Chem 343 Quiz 1 Nov 9, 2007 Lab Section (Circle One) M/W 8 AM M/W 4 PM Your Name Point T/R 8 AM T/R 11AM ( /10) _ T/R 2PM Q1. Which form is the correct rotational energy F(J)? (J = 0, 1, 2, 3.) F(J) = (a) B(J+1/2) (b) BJ(J+1)J (c) B(J+1)2 (d) BJ ... Date Added: 2009-08-10 20:00:08 |
| ENVE4608v2.pdf Path: Allan Hancock College >> PAGE >> 82363 Fall, 2009 Description: Applied Aquatic Ecology - ENVE 4608 Unit Coordinator: Dr Anas Ghadouani Graduate Generic Attributes By the completion of this unit you should have further developed the following graduate generic attributes as required by Engineers Australia: 1. Abil... Date Added: 2009-08-10 20:00:10 |
| sh050613_tilt01.ps Path: Wisconsin >> SH >> 050613 Fall, 2009 Description: %!PS-Adobe-3.0 %Creator: MATLAB, The Mathworks, Inc. %Title: sh050613_tilt01.ps %CreationDate: 06/14/2005 14:27:17 %DocumentNeededFonts: Helvetica %DocumentProcessColors: Cyan Magenta Yellow Black %LanguageLevel: 2 %Pages: (atend) %BoundingBox: (aten... Date Added: 2009-08-10 20:01:09 |
| YDR510C-A.t2k.dssp-ebghstl-logo.pdf Path: UCSC >> YDR >> 510 Fall, 2009 Description: YDR510C-A.t2k EBGHSTL 3 2 1 C X C H C X X X H H E HXXEEEEEEEEEH E X E H HHHHHHHHHH 10 TSCTC SS C S TT 20 H H H X X X X X X X X X X X X X CSC X E T E E C E S H E H H H H H H H H X X X X X X X X X X X X X X H EHE E E C E STT S X X CC C ... Date Added: 2009-08-10 20:03:02 |
| Presentation 3.doc Path: Illinois Tech >> COMM >> 428 Fall, 2009 Description: Third Assignment: Group Presentation (200 points) Due dates: Tonight (March 20): group planning session: choose coordinator and divvy up drafting of elements. March 27: Group work session: element drafts are due; begin planning visuals. April 3: ... Date Added: 2009-08-10 20:03:53 |
| COSC105_week_10_handout.pdf Path: IUP >> COSC >> 105 Fall, 2009 Description: Data Abstractions Data Structures $ 14.75 Joe Thompson Earl White Sales Bill Johnson $ 14.50 $ 50,000 Sue Smith $ 24.50 Mary Brown $ 24,000 $ 8.50 Marketing $ 12.50 Data Structures Joe Thompson $ 14.75 Sue Smith Earl White Mary Brown Bill Johnson ... Date Added: 2009-08-10 20:04:09 |
| COSC310_week_10_handout.pdf Path: IUP >> COSC >> 310 Fall, 2009 Description: Priority Queues Felix G. Hamza-Lup - Data Structures (COSC310) 1 Objectives Learn about priority queues Get familiar with the PriorityQueue interface Learn about Heaps Learn about Heapsort Felix G. Hamza-Lup - Data Structures (COSC310) 2 Pr... Date Added: 2009-08-10 20:04:11 |
| pulse1.pdf Path: Toledo >> COMM >> 417 Fall, 2009 Description: ECE 417 Experiment # 2 Baseband Pulse Transmission Winter 2003 1 Purpose This experiment will demonstrate some of the details involved in baseband pulse transmission. You will be asked to design, simulate and implement a digital communication sy... Date Added: 2009-08-10 20:04:13 |
| pracMid.pdf Path: Western Michigan >> STAT >> 160 Fall, 2008 Description: Stat1600 Practice Midterm The following 3 questions refer to the following situation. We wish to predict the mileage per gallon of automobiles based on the level of octane contained in the gasoline used. The octane levels and mileages (MPG\'s) for s... Date Added: 2009-08-10 20:04:19 |
| impuresulfanilamideNMR.pdf Path: NSCC >> CHEM >> 238 Fall, 2009 Description: ... Date Added: 2009-08-10 20:04:59 |
| Stat1.ppt Path: Neumont >> PHY >> 1501 Fall, 2009 Description: Analyse statistique des donnes exprimentales Incertitudes et analyse des erreurs dans les mesures physiques John Taylor Plan Introduction : incertitudes sur les donnes Probabilits Distributions de probabilits Incertitudes, propagation des incer... Date Added: 2009-08-10 20:07:34 |
| Introduction.pdf Path: Western Michigan >> CHEM >> 375 Fall, 2009 Description: JJ Kiddle What is Organic Chemistry? Introduction - 1 Some Organic Structures Some Organic Structures HO O H OH OHH OH H OH Glucose (sugar) HO H H H C C OH H H Ethanol (ethyl alcohol) H O2N N CH3 N Nicotine HO O Cl O O Aspirin CH3 HO HO O CH3 CHEM ... Date Added: 2009-08-10 20:07:48 |
| WP1225.pdf Path: Stanford >> PUBS >> 22427 Fall, 2009 Description: ... Date Added: 2009-08-10 20:08:48 |
| Lecture9.ppt Path: Penn State >> INFSY >> 104 Spring, 2009 Description: Arrays in Functions INFSY 307 Spring 2003 Lecture 9 Arrays in Functions x An indexed variable may be passed to a function. Arrays in Functions void NumbClass:disp_int (int number) { cout < \"The number is \" < number < endl; } Arrays in Functions ... Date Added: 2009-08-10 20:09:03 |
| 490syllabus-general.pdf Path: SD State >> PHYS >> 490 Fall, 2009 Description: South Dakota State University Catalog Description Syllabus Physics 490/590 General Policies 490-590 Seminar . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1-3 Recent developments in the fie... Date Added: 2009-08-10 20:09:25 |
| Free_Fallphys161spring2007.pdf Path: George Mason >> PHYS >> 161 Fall, 2008 Description: Physics 161 Free Fall Introduction This experiment is designed to study the motion of an object that is accelerated by the force of gravity. It also serves as an introduction to the data analysis capabilities of Data Studio. To observe the relations... Date Added: 2009-08-10 20:09:45 |
| quiz1.pdf Path: UNL >> MATH >> 208 Fall, 2008 Description: Math 208 - Summer 2009 Quiz #1 1. Let u = 3j + 4k and v = 10i + 11j - 2k. Find the cosine of the angle between u and v and the vector projv u. 2. Find a unit vector perpendicular to the plane containing the points P (1, 1, 1), Q(2, 1, 3), and R(3, -... Date Added: 2009-08-10 20:09:52 |
| session_15_questions.pdf Path: Claremont >> PHYS >> 108 Fall, 2009 Description: ... Date Added: 2009-08-10 20:10:26 |
| 25_Q02InstructorSolution.pdf Path: Everett CC >> PHYS >> 123 Fall, 2009 Description: Q25.2. Reason: When the mayfly (and hence the magnet) is close to the coil, there is a magnetic flux through the coil determined by = BA, where B is the magnetic field strength at the site of the coil and A is the area of the coil. As the mayfly mov... Date Added: 2009-08-10 20:11:31 |
| Aubrey.txt Path: UT Chattanooga >> ENCH >> 435 Fall, 2009 Description: vti_encoding:SR|utf8-nl vti_timelastmodified:TR|13 Sep 2002 14:33:01 -0000 vti_extenderversion:SR|4.0.2.7802 vti_cacheddtm:TX|13 Sep 2002 14:33:01 -0000 vti_filesize:IR|1969 ... Date Added: 2009-08-10 20:11:50 |
| chapter14.pdf Path: CSU Long Beach >> PS >> 112 Fall, 2009 Description: 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 ... Date Added: 2009-08-10 20:12:31 |
| solutions problem set 2.pdf Path: Western Michigan >> HOMEPAGES >> 3420 Fall, 2009 Description: ... Date Added: 2009-08-10 20:14:01 |
| slac-pub-9538.pdf Path: Stanford >> PUBS >> 9500 Fall, 2009 Description: SLACPUB9538 November 2002 Theory and Simulation of CSR Microbunching in Bunch Compressors Z. Huang , M. Borland Argonne National Laboratory, Argonne, IL 60439 P. Emma Stanford Linear Accelerator Center, Stanford, CA 94309 K.-J. Kim Argonne National ... Date Added: 2009-08-10 20:14:17 |
| muscle-spr09.pdf Path: Indiana >> PHYS >> 215 Fall, 2009 Description: P215 Spring 2009: Skeletal Muscle Physiology Chapter 12: pages 323 - 346 SKELETAL MUSCLE Function: I. Spinal Motor Neurons A. Location: B. Role: II. Neuromuscular Junction (NMJ) = III. Action Potential Transmission Needs: Mechanism: IV. Transve... Date Added: 2009-08-10 20:14:34 |
| Lab5_help_processtree.doc Path: Cleveland State >> CIS >> 545 Fall, 2009 Description: If you are still working on assignment 5, note that the file on my website that described assignment 5, has been changed to Word document, so that the superscript can be displayed in the sentence: \" Note, that if depth = d the number of processes cre... Date Added: 2009-08-10 20:14:38 |
| key4.pdf Path: Georgia Tech >> E >> 4160 Fall, 2009 Description: Assignment 4 (with keys) 2. (Seasonal adjustment) Just as we sometimes want to remove the trend from a series, sometimes we want to seasonally adjust a series before modeling and forecasting it. Seasonal adjustment may be done with moving average me... Date Added: 2009-08-10 20:15:02 |
| RR Donnelly Market Penetration.ppt Path: St. Johns >> BKOTL >> 045 Fall, 2009 Description: R.R. Donnelley There are many ways to get a job done, we focus on getting the job done right Introducti on Leader and provider of printing and related services in a diverse group of markets to a diverse group of clients Business Portfolio: ... Date Added: 2009-08-10 20:16:51 |
| SMIF Holdings.xls Path: St. Johns >> BKOTL >> 045 Fall, 2009 Description: Desc GICS NC S&P 500 TR Net TR Energy 10 Materials 15 Industrials 20 Consumer Discretionary 25 Consumer Staples 30 Health Care 35 Financials 40 Information Technology 45 Telecommunications Services 50 Utilities 55 MKTCAP Level Daily MTD QTD YTD 500 ... Date Added: 2009-08-10 20:16:51 |
| Lab11Memory.pdf Path: Case Western Reserve University >> P >> 203 Fall, 2009 Description: Lab.#11: One Shot and Memory No formal report is required for this lab. Turn in your laboratory notebooks only. Monostable/ Oscillator Install a 74123 Monostable on your Ralboard, clocking it with the on-board clock. Start with a 10 k resistor and 0.... Date Added: 2009-08-10 20:17:58 |
| Ghahramani_94.pdf Path: Stanford >> PSYCH >> 224 Fall, 2009 Description: \' f fe W P 3 ( 2 X\" I 0 2 w% c \"R 6 56 d{ 8 D \" 8 \" 6 u 6 7g { 67{ 6D\" {\" \"S e 6D \"7 0 {\"8{ \" 6 \" 6 S 7 S{ 6 { \"66Q5 6 {\"6Q... Date Added: 2009-08-10 20:18:18 |
| ipc.pdf Path: W. Alabama >> CS >> 350 Fall, 2009 Description: Interprocess Communication 1 Interprocess Communication Mechanisms shared storage These mechanisms have already been covered. examples: shared virtual memory shared files processes must agree on a name (e.g., a file name, or a shared virtual ... Date Added: 2009-08-10 20:18:26 |
| midterm.histo.pdf Path: Washington >> CS >> 451 Fall, 2009 Description: CSE 451, Operating Systems Spring Quarter 2005 Midterm Test Histogram 94 93 92 91 90 89 88 87 86 85 84 83 82 81 80 79 78 77 76 75 74 73 72 71 70 69 68 67 66 65 64 63 62 61 60 59 58 57 56 55 54 53 52 . 47 X X X X X X X X Mean: Median: 74.4 74-75 X X ... Date Added: 2009-08-10 20:19:08 |
| midterm.histo.pdf Path: Washington >> CS >> 451 Fall, 2009 Description: CSE 451, Introduction to Operating Systems Winter 2007 Midterm Test 99 98 97 96 95 94 93 92 91 90 89 88 87 86 85 84 83 82 81 80 79 78 77 76 75 74 73 72 71 70 69 68 67 66 65 64 63 62 61 60 59 58 57 56 55 54 53 52 51 50 49 48 47 46 45 44 43 42 41 40 39... Date Added: 2009-08-10 20:19:31 |
| sol4.ps Path: Washington >> SOL >> 451 Winter, 2009 Description: %!PS-Adobe-2.0 %Creator: dvips 5.47 Copyright 1986-91 Radical Eye Software %Title: sol4.dvi %Pages: 6 1 %BoundingBox: 0 0 612 792 %EndComments %BeginProcSet: tex.pro /TeXDict 200 dict def TeXDict begin /N /def load def /B{bind def}N /S /exch load def... Date Added: 2009-08-10 20:19:34 |
| 5-threads.pdf Path: Washington >> CS >> 451 Fall, 2009 Description: What\'s in a process? CSE 451: Operating Systems Winter 2005 Lecture 5 Threads Steve Gribble A process consists of (at least): an address space the code for the running program the data for the running program an execution stack and stack pointe... Date Added: 2009-08-10 20:19:42 |
| 4-procmanagement.ppt Path: Washington >> CS >> 451 Fall, 2009 Description: es and Process Manage ment Brian Bersha d Processes are about virtualizing resources q q There are only a limited number of CPUs. You may want to run more than one program at a time. why? q q We need an abstraction that decouples the physic... Date Added: 2009-08-10 20:20:45 |
| 000396_1.pdf Path: Pittsburgh >> AEI >> 3285 Fall, 2009 Description: COUNCIL OF THE EUROPEAN UNION PRESS RELEASES PRESIDENCY: GERMANY JULY-DECEMBER 1994 Meetings and press releases October 1994 Meeting number 1790th 1791st 1792nd Special meeting 1793rd 1794th 1795th 1796th Subject General Affairs Environment Economi... Date Added: 2009-08-10 20:21:06 |
| chapt2.pdf Path: Allan Hancock College >> PHYS >> 2801 Fall, 2009 Description: ... Date Added: 2009-08-10 20:21:32 |
| balance.xls Path: Penn State >> RLM >> 5096 Fall, 2009 Description: Balance Due Xiong, James Vaughn, Noah Ramirez, Alberto Paoli, Pam Column G Mc Cartan, John Hernndez, Abraham Costa, Dan $0.00 $100.00 $200.00 $300.00 $400.00 $500.00 $600.00 $700.00 $800.00 $900.00 Costa, Dan $0.00 $100.00 $200.... Date Added: 2009-08-10 20:21:42 |
| baudelaire.pdf Path: Minnesota >> STOU >> 0046 Fall, 2009 Description: La ~()(tise, l\'erreur, Ie peche, la lesine, Occupent nos esprits et travaillent nos corps, Et nous alimentons nos aimables remords, Comme les mendiants nourrissent leur vermine. Nos peches sont tetus, nos repentirs sont laches; Nous no us faisons pay... Date Added: 2009-08-10 20:22:32 |
| descartes2.pdf Path: Minnesota >> STOU >> 0046 Fall, 2009 Description: the affectation of perpetual indecision; for, on the contrary, my entire plan tended simply to give me assurance and to reject shifting ground and sand so as to find rock or clay. In this I was quite successful, it seems to me, inasmuch as, trying to... Date Added: 2009-08-10 20:22:33 |
| FIS 318 midterm outline W05.doc Path: Oakland University >> FIS >> 318 Fall, 2009 Description: FIS 318/618 Midterm Review Outline Winter 2005 Callaghan I. Introduction to FIS a. b. c. d. e. f. MOTE IPSO Framework for modeling systems Criticisms of Traditional AIS Management (PEACE) Business Process Types REA II. Access a. b. Relational Dat... Date Added: 2009-08-10 20:23:19 |
| tradestudyprop.pdf Path: Oakland University >> ME >> 463 Fall, 2009 Description: University of Notre Dame Department of Aerospace and Mechanical Engineering AME 40463: Senior Design Project, Spring 2008 Date: 12 February 2008 To: Dr. Batill and Dr. Stanisic From: Group B3 Michael Wicks Project: Product Packaging Machine Subject: ... Date Added: 2009-08-10 20:23:38 |
| chapter05.pdf Path: Radford >> ITEC >> 110 Fall, 2009 Description: Objectives Learn what an operating system is Become familiar with the different types of operating systems Identify the major functions of an operating system Understand how operating systems manage processes Connecting with Computer Science 2 ... Date Added: 2009-08-10 20:25:06 |
| lab07.pdf Path: Canada College >> PHYSICS >> 210 Fall, 2009 Description: 210 EXPERIMENT 7 BALLISTIC PENDULUM I. THEORY The purpose of this experiment is to measure the velocity of a ball that is fired from a spring gun. 7-1 For many years, police laboratories used ballistic pendulums to measure the muzzle velocities of ... Date Added: 2009-08-10 20:26:00 |
| Phys361_S09_HW2.pdf Path: Montana >> PHYSICS >> 361 Fall, 2009 Description: Laboratory Electronics II Homework 2 Spring 2009 PHYS 361 The cutoff frequency for a LR filter is fcutoff =R/(2L) L Vin R=5.0kohm 1. For the above RL filter Vout a. Derive and show the expression for the complex transfer function (V_out(f)/V_in... Date Added: 2009-08-10 20:26:04 |
| FinalsSampleQuestions.pdf Path: UCLA >> POLISCI >> 142 Fall, 2002 Description: Sample Questions #3: Party in Government What is the leadership structure of House parties? Of Senate parties? Who are the leaders of the four Congressional parties? For the House, know the Speaker and majority leader. What factors do members conside... Date Added: 2009-08-10 20:26:25 |
| CyberPetHandout.doc Path: UNI >> CS >> 062 Fall, 2009 Description: / / FILE: MobileCyberPet.java / AUTHOR: Eugene Wallingford / DATE: September 21, 2000 / COMMENT: Homework 2 / / MODIFIED: October 4, 2000, by Eugene Wallingford / CHANGE: Added location() accessor for use in subclasses. / Refactored move( int, int ) ... Date Added: 2009-08-10 20:27:54 |
| Hw7.pdf Path: George Mason >> MATH >> 351 Fall, 2008 Description: ... Date Added: 2009-08-10 20:28:06 |
| Borda_Gabriel_bromemo.doc Path: NJIT >> ENG >> 352 Fall, 2009 Description: Gabriel Borda 303 North 6th Street Prospect Park, NJ 07508 973.800.5732 gb33@njit.edu Professor Lipuma ENG 352-003 New Jersey Institute of Technology Newark, NJ Re: Brochure Memo To Professor Lipuma: I am writing to you today to explain what my broch... Date Added: 2009-08-10 20:28:28 |
| FSP_HV_SHORT.pdf Path: Wisc Stevens Point >> UNIT >> 679 Fall, 2009 Description: Forest Stewardship Plan \"Hacienda Verde\" FSP \"Hacienda Verde\" Watershed approach FSP \"Hacienda Verde\" Data Survey: Forests FSP \"Hacienda Verde\" Data Survey: Forests FSP \"Hacienda Verde\" Data Survey: Forests Importance Value of trees in Finca \"Hac... Date Added: 2009-08-10 20:29:54 |
|
|
Get Started With Course Hero Today!
Get study guides, join study groups, and more!
Sign up in seconds with your Facebook account!
Course Hero is a Facebook Application Partner.
Click below to sign-up for FREE.
Our Social Learning Network was built to provide students and key learning partners like professors a platform to share, meet and collaborate while accelerating their comprehension of course-related theories and concepts. We are committed to providing you immediate access to a growing wealth of study materials and an unparalleled academic network of students, professors and other key partners. Why do you care? Because you want the best grade possible and at times need a 24/7 resource that’s responsive to your needs. |
|
What People Are Saying About Course Hero
|
|||
|
|||
|
Explore the benefits of joining Course Hero's social learning network.
|
|||
![]() |
Get millions of study materials now!Need lecture notes for a missed class or want insightful explanation of the theories and concepts you learn in class? Look no further, Course Hero’s Study Materials empowers you to find a broad and deep set of materials that can help you right now!
Click below to sign-up for FREE.
|
||
![]() |
Get over 200,000 textbook solutions now!Having difficulty with your homework and need documents that are relevant for your Textbook? Don't be frustrated. Course Hero's Textbook Help presents you study materials from many college courses.
Click below to sign-up for FREE.
|
||
![]() |
Meet over 300,000 students and your fellow classmates now!Want to meet your current classmates or those that took the class last year? Don’t worry or have anxiety. Course Hero’s Study Groups gives you the seamless opportunity to develop both anonymous or direct relationships with those classmates whom you want to meet and get help from right now!
Click below to sign-up for FREE.
|
||


