Course Solutions And Notes - lab07 09
| csslongresults2006.pdf Path: E. Texas Baptist >> SITES >> 0506 Fall, 2009 Description: 2005-2006 CSS LONGITUDINAL REPORT All Students East Texas Baptist University All Respondents Your Institution CIRP CSS DIFF 72 72 -Oth Relig 4yr Colls CIRP CSS DIFF 4,263 4,263 - (2608) Number of Respondents Academic activities engaged in \"frequent... Date Added: 2009-08-10 20:31:26 |
| csslongresults2006.pdf Path: E. Texas Baptist >> OIRE >> 0506 Fall, 2008 Description: 2005-2006 CSS LONGITUDINAL REPORT All Students East Texas Baptist University All Respondents Your Institution CIRP CSS DIFF 72 72 -Oth Relig 4yr Colls CIRP CSS DIFF 4,263 4,263 - (2608) Number of Respondents Academic activities engaged in \"frequent... Date Added: 2009-08-10 20:31:26 |
| trese103fall06.pdf Path: Bethel VA >> PBIO >> 103 Fall, 2009 Description: Syllabus Plants and People; PBIO 103, 07217 1:10 2:00 MTuWTh Fall Quarter, 2006 Instructor: Dr. Arthur Trese Rm. 414 Porter Phone # 593-0260 Email; Trese@Ohio.edu Home page; https:/blackboard.ohiou.edu/ Username = Oak ID (two letters, 6numbers) Passw... Date Added: 2009-08-10 20:31:54 |
| AngiospermCycle.pdf Path: Whatcom Community College >> BIOLOGY >> 213 Fall, 2009 Description: Angiosperm Life History ... Date Added: 2009-08-10 20:32:47 |
| Part 3 coursework.doc Path: East Los Angeles College >> CD >> 2037 Fall, 2009 Description: Saturn Group Members: Yinka Yesufu - 356647 Stephen O\'neill - 334668 Chris Nwaigwe Hayley Richmond Part 3 Database Vulnerabilities & Countermeasures Part i Database security plays a very important role to keep protected data as safe as possib... Date Added: 2009-08-10 20:33:54 |
| ans_hw5p1_Spr2005.pdf Path: Rose-Hulman >> ES >> 205 Fall, 2009 Description: ... Date Added: 2009-08-10 20:34:31 |
| JCP41_3199.pdf Path: Arizona >> GEOS >> 596 Fall, 2009 Description: Downloaded 05 Feb 2006 to 128.196.236.84. Redistribution subject to AIP license or copyright, see http:/jcp.aip.org/jcp/copyright.jsp Downloaded 05 Feb 2006 to 128.196.236.84. Redistribution subject to AIP license or copyright, see http:/jcp.aip.org... Date Added: 2009-08-10 20:36:26 |
| BUS347D01.TXT Path: Sveriges lantbruksuniversitet >> BUS >> 20012 Fall, 2009 Description: Sheet1 PROFILE OF STUDENTS IN SFU COURSES COURSE: BUS 347-3 D01 LOCATION: SFU TITLE: CONSUMER BEHAVIOR SECTION TYPE: LEC SEMESTER: 2001-2 ENROL: 43 = PROGRAM OF STUDENT (Top 5 programs reported in each category Programs with < 3 students not shown se... Date Added: 2009-08-10 20:37:14 |
| DeepCopyDiagram.pdf Path: NSCC >> CSC >> 143 Fall, 2009 Description: CSC143 Different Types of Copies Alias: Two references bound to one object arrayList a numElems elements b 3 Shallow Copy: Two objects each with their own instance variables. The instance variables that are references are aliases. arrayList a numE... Date Added: 2009-08-10 20:37:58 |
| lab1sub.txt Path: Sonoma >> CS >> 215 Fall, 2008 Description: -rw-r- 1 tiawatts faculty 70 Dec 5 2007 cs215/cs215drop1/L1.out -rw-rw- 1 mcdonald tiawatts 1074 Feb 2 17:36 cs215/cs215drop1/McDonaldL1.cpp -rw-rw- 1 krupp tiawatts 976 Feb 2 16:32 cs215/cs215drop1/RuppL1.cpp -rw-rw- 1 brewere tiawatts 1... Date Added: 2009-08-10 20:38:34 |
| lab15sub.txt Path: Sonoma >> CS >> 215 Fall, 2008 Description: -rw-rw- 1 blacksmi tiawatts 13660 May 15 09:34 cs215/cs215drop15/blacksmithL15.tmp -rw-rw- 1 gruenhag tiawatts 12608 May 14 21:43 cs215/cs215drop15/gruenhagenL15.tmp -rw-rw- 1 sgulland tiawatts 9932 May 15 18:50 cs215/cs215drop15/gullandL15.tmp -rw-... Date Added: 2009-08-10 20:38:36 |
| Lecture1.ps Path: Georgia Tech >> CS >> 2331 Fall, 2009 Description: %!PS-Adobe-3.0 %Title: (Untitled) %Creator: (Microsoft PowerPoint: LaserWriter 8 8.6) %CreationDate: (12:54 PM Thursday, February 10, 2000) %For: (Allison Tew) %Pages: 14 %DocumentFonts: Charcoal Wingdings CourierNewPSMT %DocumentNeededFonts: Charcoa... Date Added: 2009-08-10 20:38:50 |
| chapter10.pdf Path: North Central State College >> PSY >> 160 Fall, 2009 Description: Our Sexuality, 9th Edition, Robert L. Crooks Chapter 10: Sexual Orientations Our Sexuality, 9th Edition, Robert L. Crooks Chapter 10: Sexual Orientations A Continuum of Sexual Orientations Terminology homosexual orientation: primary erotic psycho... Date Added: 2009-08-10 20:38:56 |
| skirt_tube.ps Path: Oakland University >> ME >> 470 Fall, 2009 Description: ... Date Added: 2009-08-10 20:39:17 |
| Executive Summary.pdf Path: Penn State >> TBM >> 131 Fall, 2009 Description: Timothy Mueller Structural Option Ali Memari, Advisor FDA CDRH Laboratory Silver Spring, Maryland Executive Summary The FDA CDRH Laboratory, located in Silver Spring, Maryland, is on the Food and Drug Administration\'s White Oak Consolidation Campus... Date Added: 2009-08-10 20:39:47 |
| exp4cycloalkene.pdf Path: W. Alabama >> CHEM >> 028 Fall, 2009 Description: Exp. 4 Cyclohexene 1 Experiment 4 Dehydration of Cyclohexanol to Cyclohexene Theory: One of the most useful and general methods of preparing alkenes or olefins is based on the dehydration of alcohols with acids. Strong acids such as sulphuric and p... Date Added: 2009-08-10 20:39:49 |
| det1.pdf Path: Arizona >> M >> 223 Fall, 2009 Description: ... Date Added: 2009-08-10 20:42:00 |
| Week13PopulationHealthRevision.ppt Path: Allan Hancock College >> WEEK >> 1022 Fall, 2009 Description: REVISION OF POPULATION HEALTH Michael Abramson PhD, FRACP Department of Epidemiology & Preventive Medicine THEME II OBJECTIVES On the completion of this sub-unit students will be able to: Demonstrate an understanding of the basic concepts and method... Date Added: 2009-08-10 20:42:23 |
| lt_xy_yr4_case4.pdf Path: CSU Channel Islands >> GM >> 0420 Fall, 2009 Description: ... Date Added: 2009-08-10 20:46:17 |
| SSRD_QR_LCO_F04a_T21.xls Path: USC >> CSCI >> 577 Fall, 2009 Description: 096039b96cb0c72d2d41d41e8ec4ee47edfdd67a.xls - Areas of Concern Log Project Name: CSEXP Artifact: SSRD Module: SSRD v1.1 MBASE Phase/level: Activity: Requirements Exit Criteria: Review # SSRD Review Date: 10/9/2004 Review Time: 5:00pm 2 Inception D... Date Added: 2009-08-10 20:46:39 |
| cse494sp09-PresentationSchedule.pdf Path: ASU >> CSE >> 494 Fall, 2008 Description: CSE 494/598 Mobile Health and Social Networking (Sp 2009) Project Presentation Schedule Each group should provide 25 minutes presentation for the term project. This is requirement, so it will be graded as the part of your final term project grade. Ea... Date Added: 2009-08-10 20:48:31 |
| 200.txt Path: USC >> CS >> 551 Fall, 2008 Description: Return-Path: william@bourbon.usc.edu Delivery-Date: Sun Mar 29 18:10:55 2009 X-Spam-Checker-Version: SpamAssassin 3.2.3 (2007-08-08) on merlot.usc.edu X-Spam-Level: X-Spam-Status: No, score=-2.4 required=5.0 tests=AWL,BAYES_00 autolearn=ham version... Date Added: 2009-08-10 20:49:06 |
| lect8.ppt Path: University of Illinois, Urbana Champaign >> FIN >> 341 Fall, 2009 Description: Reinsurance Insurers purchase reinsurance largely for the same reasons that people and organizations purchase insurance \"Insurance for insurers\" Functions of reinsurance Capacity: can write more business and larger policy limits Financial: can a... Date Added: 2009-08-10 20:49:13 |
| notes3.4.pdf Path: UNL >> ASTRO >> 103 Fall, 2009 Description: Lecture 3.4 Spectra Blackbody The spectra of a body which is purely thermal (that is, the quantum nature of the atoms are suppressed or irrelevant) is called a blackbody. No true blackbodies exist in nature but many objects very closely approximate t... Date Added: 2009-08-10 20:50:23 |
| guide_one.pdf Path: Yale >> ASTRO >> 160 Fall, 2009 Description: W h4hr4 Bs4 6cc6cc6A4c5c56IcCcbiCGfrqwbCibicH9vtcc&b9 u d B r B a F@ 7 B 4 h 8 T B r v @ p u j 4 a I 4 B 2 W @ u D @ r a 4 F u D s a 7 4 @ 4 a a 4 p@ a B h r p B a k v s 7 n F r 8 4 s 4 r 7 @ 4 u j B a I F W @ a Bx 7 8 ... Date Added: 2009-08-10 20:50:32 |
| itt.pdf Path: University of Illinois, Urbana Champaign >> M >> 302 Fall, 2009 Description: Math 302 Proofs of ITT and ITB Theorem (Isosceles Triangle Theorem (ITT). Given a trilateral with two of its sides congruent, the two angles opposite those sides also congruent. Theorem (Isosceles Bisector Theorem (ITB). Given a trilateral with two ... Date Added: 2009-08-10 20:51:34 |
| supplement.pdf Path: Carnegie Mellon >> STAT >> 213 Fall, 2009 Description: Supplement to \"Assessing multivariate predictors of financial market movements: A latent factor framework for ordinal data \" Philippe Huber1, Olivier Scaillet2 and Maria-Pia Victoria-Feser3 HEC - University of Geneva and Swiss Finance Institute, CH-1... Date Added: 2009-08-10 20:51:52 |
| bnez.EvaluationofSpike80DFforSandShinneryOakControlpdf.pdf Path: Texas A&M >> SUB >> 320 Fall, 2009 Description: Evaluation of Spike 80DF for Sand Shinnery Oak Control Dr. Darrell N. Ueckert and Joe Petersen Texas Agricultural Experiment Station - San Angelo Steve Estes County Agricultural Extension Agent Fisher County Introduction Sand shinnery oak (also calle... Date Added: 2009-08-10 20:52:14 |
| HW56_08_Answers.pdf Path: Indiana >> STATS >> 471 Fall, 2009 Description: E471 Fall 2008 Homework Five/Six Key The following data are from the Multiple Listing Service for a small midwestern college town. The prices are given in hundreds of dollars for 13 homes listed between $200,000 and $300,000. Rooms, Bedrooms, and Bat... Date Added: 2009-08-10 20:52:40 |
| 0425-small.pdf Path: Trinity U >> CS >> 3294 Fall, 2009 Description: CSCI 3294 April 25, 2005 Administrivia Homeworks 6, 7 due today. Homework 8 (short, easy) on Web. Due next Monday. Solutions for all homeworks to be on Web soon. Grades to be based on: Slide 1 Homework - 180 points total. Attendance/particip... Date Added: 2009-08-10 20:53:29 |
| io-2.72.62.12.doc Path: Wisconsin >> ENGR >> 462 Fall, 2009 Description: ECE462 Medical instrumentation 1 webster@engr.wisc.edu 9/1/99 IO-2.7 Assume thermistor self heating < 0.1C Assume voltage = 5 V Dissipation coefficient = 2.0 mW/C P V 2 R T = = D .C . D .C . V 2 52 R = = = 1 2 5 ,0 0 0 T ( D . C . ) 0 .1 C ( 0... Date Added: 2009-08-10 20:54:02 |
| fpga_pinout_table_pin_sort.doc Path: Stanford >> E >> 158 Fall, 2009 Description: Xilinx VXI Interface FPGA Pinout Table Device = XCS40XL-4 PQ240C Pin # 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 GND I/O, I/O I/O I/O I/O, I/O, I/O I/O I/O I/O I/... Date Added: 2009-08-10 20:54:45 |
| Waterfowl.pdf Path: Texas A&M >> WFSC >> 408 Fall, 2008 Description: Waterfowl Techniques for Sexing Birds: Subcellular, genetic sexing by chromosome analysis of cells from blood (developing) feathers Internal anatomy Behavior bursa of Fabricius: regresses with age Wing feather patterns Aging HY: tail feathers ha... Date Added: 2009-08-10 20:56:01 |
| HourExamIIIreview.pdf Path: University of Illinois, Urbana Champaign >> CHEMISTRY >> 102 Fall, 2009 Description: Announcements 1. Hour Exam III review posted on-line. 2. Check website for your exam location. 3. Bring pencil, eraser, ID. 4. Complete solutions to Professor Hummel\'s past hour exams in red book are on-line on his website. Chapter 13 1. Reaction Qu... Date Added: 2009-08-10 20:56:12 |
| Lecture3.pdf Path: Berkeley >> CEE >> 225 Fall, 2009 Description: University of California at Berkeley Department of Civil and Env. Engineering CEE 225: Dynamics of Structures Fall 2003 Lecture 3: Harmonic Vibration: Undamped SDF System Objectives: 1. Define harmonic vibration. 2. Explain the mathematical backgr... Date Added: 2009-08-10 20:56:52 |
| schedule.doc Path: Delaware >> CHEM >> 119 Fall, 2008 Description: <?xml version=\"1.0\" encoding=\"UTF-8\"?> <Error><Code>NoSuchKey</Code><Message>The specified key does not exist.</Message><Key>095ecc279ebd454ff7ca571efa8d6c383e882c39.doc</Key><RequestId>8 2C1397F0B4671B3</RequestId><HostId>gA0AT351j/KcrCCf+QJWm4asY6Y... Date Added: 2009-08-10 20:57:05 |
| New Exercises - Lab 3 .pdf Path: Reed >> MATH >> 200 Fall, 2009 Description: 1 EXERCISES Mathematica 6 Lab Number 3 Problem 1. TrigExpand the functions tan 2 and cos 6. Then Simplify your results. Problem 2. TrigReduce the functions sin2 and tan2 1 . Then Simplify your 2 results. Problem 3. \"Magic squares\" have fascina... Date Added: 2009-08-10 20:58:19 |
| Rec1_v2.ppt Path: UCSD >> CSE >> 241 Spring, 2001 Description: CSE241 VLSI Digital Circuits Winter 2003 Recitation 1: Verilog Introduction CSE241 R1 Verilog.1 Kahng & Cichy, UCSD 2003 Topic Outline Introduction Verilog Background Signals Connections Modules Procedures Structural Behavioral Testbench... Date Added: 2009-08-10 20:58:25 |
| Rec3_v2.ppt Path: UCSD >> CSE >> 241 Spring, 2001 Description: CSE241A VLSI Digital Circuits Winter 2003 Recitation 3: Synthesis CSE241 Synthesis Overview.1 Kahng & Cichy, UCSD 2003 Logic Synthesis: explained Logic synthesis: q Process of transforming Hardware Description Language (HDL) code into a logi... Date Added: 2009-08-10 20:58:27 |
| 13_creating_datatypes.pdf Path: UVA >> CS >> 101 Fall, 2008 Description: Data Types 3.2 Creating Data Types Data type. Set of values and operations on those values. Basic types. Data Type boolean int String Set of Values true, false -231 to 231 - 1 Some Operations not, and, or, xor add, subtract, multiply concatenate, c... Date Added: 2009-08-10 20:58:55 |
| practice.ps Path: SUNY Stony Brook >> MATH >> 313 Fall, 2009 Description: %!PS-Adobe-2.0 %Creator: dvipsk 5.86 p1.5d Copyright 1996-2001 ASCII Corp.(www-ptex@ascii.co.jp) %based on dvipsk 5.86 Copyright 1999 Radical Eye Software (www.radicaleye.com) %Title: practice.dvi %Pages: 2 %PageOrder: Ascend %BoundingBox: 0 0 596 84... Date Added: 2009-08-10 20:59:08 |
| Colour - speech.doc Path: Allan Hancock College >> MDUN >> 9976 Fall, 2009 Description: Colour Colour plays an important role in the design of the duplex, as they work to highlight different aspects of the interior spaces and give the design an obvious Modern aspect. Primary colours coat elements such as joinery units, structural beams... Date Added: 2009-08-10 20:59:59 |
| 20081215_f01c_Vidmar.pdf Path: Stanford >> ISYS >> 1041 Fall, 2009 Description: UNITED STATES DISTRICT COURT DISTRICT OF MARYLAND (Greenbelt Division) ) No. ANTHONY VIDMAR, Individually and on Behalf ) ) CLASS ACTION of All Others Similarly Situated, ) ) COMPLAINT FOR VIOLATIONS Plaintiff, ) OF THE FEDERAL SECURITIES ) LAWS v. )... Date Added: 2009-08-10 21:00:00 |
| HW1_3501_07.pdf Path: IUPUI >> CSC >> 3501 Fall, 2009 Description: Homework 1 Due: February 6, 2007 F b Problems from the Class Book: 1.47, 1.52, 1.54, 2.2, 2.3, 2.6, 2.13 Louisiana State University Homework 1 - 1 CSC3501 S07 ... Date Added: 2009-08-10 21:00:01 |
| presentation_schedule_5371f05.doc Path: Texas Tech >> ENGLISH >> 5371 Fall, 2009 Description: Textbook recommendation presentations 15 minutes each Brad Kevin Erika Lyle Yingqin Leeanne Todd Jessica Betsy Katherine Nedim Web design Rhetoric of science Grant & proposal writing Document design Report writing Multicultural issues in TC Ethics in... Date Added: 2009-08-10 21:00:39 |
| 3_BFCore1_0Release.ppt Path: Benjamin Franklin Institute of Technology >> ECE >> 3551 Fall, 2009 Description: Blackfin Speedway Presentation Core, Memory, and Peripherals Support Across The Board TM Blackfin as a Convergent Processor Commonly asked questions: What makes Blackfin a \"convergent\" processor? What architectural features enable convergent proce... Date Added: 2009-08-10 21:01:17 |
| Base02av45yamo_CASTNET_Observed_Data.txt Path: UC Riverside >> JUN >> 308 Fall, 2009 Description: Station Col Row Year Jdate HNO3g SO2g P_NH4 P_SO4 P_NO3 Total_NO3 P_mNO3_mSO4 P_NH4_rati... Date Added: 2009-08-10 21:01:26 |
| figure-18.5.ps Path: Purdue >> IXP >> 1200 Fall, 2009 Description: %!PS-Adobe-1.0 %Creator: devps (Pipeline Associates, Inc.) %CreationDate: Sat Dec 14 15:21:09 2002 %Pages: (atend) %DocumentFonts: (atend) /X /exch load def /r /rmoveto load def /m /moveto load def /l /lineto load def /rl /rlineto load def /lc{yc X x... Date Added: 2009-08-10 21:02:04 |
| figure-20.10.pdf Path: Purdue >> IXP >> 1200 Fall, 2009 Description: data from SRAM transfer registers Pull Engine command queues 8-entry (pull) 8-entry (hash) data enters commands arrive TFIFO commands from microengine command bus CSRs Push Engine 8-entry (push) commands arrive data to SRAM transfer registers ... Date Added: 2009-08-10 21:02:06 |
| figure-26.2.ps Path: Purdue >> IXP >> 1200 Fall, 2009 Description: %!PS-Adobe-1.0 %Creator: devps (Pipeline Associates, Inc.) %CreationDate: Sat Dec 14 15:27:43 2002 %Pages: (atend) %DocumentFonts: (atend) /X /exch load def /r /rmoveto load def /m /moveto load def /l /lineto load def /rl /rlineto load def /lc{yc X x... Date Added: 2009-08-10 21:02:16 |
| 02Exam2.pdf Path: Marietta >> MATH >> 126 Fall, 2009 Description: Exam 2 Math 126.02 February 28, 2005 Name: The point values for each problem are given below. YOU MUST SHOW YOUR WORK/JUSTIFY YOUR ANSWER TO RECEIVE FULL CREDIT FOR A PROBLEM. Question 1a-c 1d-f 1g-i 1j-k 2 3 4 Total Points Earned Points Possibl... Date Added: 2009-08-10 21:03:18 |
| prob5a.ps Path: UT Arlington >> EE >> 5347 Fall, 2008 Description: %!PS-Adobe-2.0 %Creator: dvips(k) 5.95a Copyright 2005 Radical Eye Software %Title: prob5a.dvi %Pages: 1 %PageOrder: Ascend %BoundingBox: 0 0 595 842 %DocumentFonts: CMBX12 CMR10 %DocumentPaperSizes: a4 %EndComments %DVIPSWebPage: (www.radicaleye.com... Date Added: 2009-08-10 21:03:27 |
| T0409.t06.w0.5-logo.pdf Path: UCSC >> T >> 0409 Fall, 2009 Description: T0409.t06 w0.5 3 2 1 1 10 20 30 40 H 3 2 1 T H H T T T Z A Z T Z A 51 60 70 80 90 Y T 3 2 1 Z Y Z Y T H T H G T T Z A Z Y T Z Y Z Y Z Y 101 QL P 100 KN G ETIRI TGDGLKAAHRFLSNDPKIG E KR I RP G A LI R V K KT E K G SW ... Date Added: 2009-08-10 21:04:34 |
| add4.pdf Path: Central Washington University >> CHEM >> 345 Fall, 2009 Description: ... Date Added: 2009-08-10 21:04:40 |
| 5.3_1.pdf Path: New Mexico >> ME >> 306 Fall, 2008 Description: ... Date Added: 2009-08-10 21:04:56 |
| instructor_session10.pdf Path: UPenn >> BPUB >> 250 Spring, 2007 Description: ... Date Added: 2009-08-10 21:05:59 |
| n19.pdf Path: Delaware >> HLY >> 0403 Fall, 2009 Description: n19 : Day 208.8 to 208.9 at z=30 m 0.4 m/s 73N -3000 72N 156W 154W 152W 150W 148W 146W ... Date Added: 2009-08-10 21:06:04 |
| lec16.pdf Path: Allan Hancock College >> COMP >> 6442 Fall, 2009 Description: Synchronized Interaction and Local Data Cache: Observer and Proxy Synchronized Interaction and Local Data Cache: Observer and Proxy COMP6442 Software Construction for e-Science 2009 21 May 2009 Henry Gardner, Alexei Khorev Reading Observer Pattern... Date Added: 2009-08-10 21:06:57 |
| hawauw99001_part3.pdf Path: Maryville MO >> HAWAUW >> 99001 Fall, 2009 Description: ... Date Added: 2009-08-10 21:08:07 |
| ch232-phase-diagrams.ppt Path: St. Francis IL >> CHEM >> 232 Fall, 2009 Description: Chemistry 232 Binary Phase Diagrams Raoult\'s Law Variation in the total vapour pressure of a two component liquid mixture according to Raoult\'s Law liquid P B* XA vapour P A* The Variation in Terms of Gas Phase Mole Fractions yA the vapour ... Date Added: 2009-08-10 21:08:19 |
| Molecular-Reaction-Dynamics.ppt Path: St. Francis IL >> CHEM >> 232 Fall, 2009 Description: Molecular Reaction Dynamics Collision Theory of Kinetics With few exceptions, the reaction rate increases with increasing temperature temperature place due to collisions between reactant molecules If we assume that a chemical reaction takes i... Date Added: 2009-08-10 21:08:21 |
| PHIL2532.doc.docx Path: East Los Angeles College >> PHILOSOPHY >> 0910 Fall, 2009 Description: PHIL2532 Philosophy of Religion Likely Teacher: Scott Shalkowski Semester: 2 Credits: 20 Module type: Additional Module Assessment: 1 x 3-hour final examination Prerequisites: PHIL1007 Introduction to Philosophy of Religion The aim of this module is ... Date Added: 2009-08-10 21:08:53 |
| TrackGeometry3D.pdf Path: RIT >> NYJ >> 4905 Fall, 2009 Description: Particle Track Geometry in 3-D Alan Kaminsky ark@cs.rit.edu November 14, 2005 1 Problem Statement Given: Two hits from a silicon pixel particle detector, P1 = (x1 , y1 , z1 ) and P2 = (x2 , y2 , z2 ). P1 is from an inner layer of the detector and ... Date Added: 2009-08-10 21:11:08 |
| 02finb.pdf Path: Drake >> ECON >> 001 Fall, 2009 Description: Principles of Macroeconomics (Econ 001) Drake University, Spring 2002 William M. Boal Signature: Printed name: FINAL EXAMINATION: VERSION B Monday, May 13, 2002 INSTRUCTIONS: This exam is closed-book, closed-notes, but calculators are permitted. Nu... Date Added: 2009-08-10 21:11:33 |
| chap_10b.ps Path: University of Illinois, Urbana Champaign >> CS >> 350 Fall, 2009 Description: %!PS-Adobe-3.0 %Title: Microsoft PowerPoint - chap_10b.ppt %Creator: PSCRIPT.DRV Version 4.0 %CreationDate: 04/18/00 22:09:20 %BoundingBox: 12 13 601 779 %Pages: 12 %PageOrder: Ascending %Requirements: %DocumentNeededFonts: (atend) %DocumentSuppliedF... Date Added: 2009-08-10 21:12:12 |
| taquiz5.pdf Path: Maryville MO >> GAND >> 6080 Fall, 2009 Description: Wo! U U okgm~r7W U} z ! U gkx|W {o ygxW w ! v u nb \' % d @ tsf q s U Wo! b nb % U)b ` W U (%4r$(\"e(D#rC#pgYg#a(cm6#3 \"Dljx$g U We ! h U We! \' % d b b ) U)b ` W U kj9gifgYfVe(cca(6#(#$\"2\"DY$9 U W h \' x v q s U W h b d U)b ` W U 8q(%t... Date Added: 2009-08-10 21:12:34 |
| taquiz7.pdf Path: Maryville MO >> GAND >> 6080 Fall, 2009 Description: l m) tp hp3 C) h ! %p t %p \'p b wt) p qxH6$\"rkebr#q(6eE#ay#\"(#kc`000ka\"r \' %p Vt 7 tp Vt \' %p @ D ) \' %p @ X) tp Vt ! X 5 b) l)t m E#qrx2rk\"(rhED { 9(rB yED { 2e%02rkq(Y%(0\"AqqEv l X X) v % Xt % u X) Vt X )t %p \'p b ` V X V f l #Y3... Date Added: 2009-08-10 21:12:35 |
| fluid_metering.doc Path: Air Force Academy >> ENGR >> 333 Fall, 2009 Description: 3. FLUID METERING Introduction In this experiment you will be pumping water through a system which contains a number of different kinds of flowmeters. They are: 1) Nutating disc meter (domestic water meter) 2) Gear meter 3) Vortex flowmeter 4) Ventu... Date Added: 2009-08-10 21:12:35 |
| READING LIST lectures 3 EKC.doc Path: East Los Angeles College >> UP >> 211 Fall, 2009 Description: EP04 Sustainability and international environmental policy. Lent, 200708 Land Economy department, University of Cambridge. Dr. Unai Pascual. READING LIST: Lecture 3. EKC The Environmental Kuznets Curve Hypothesis. Unai Pascual [*: Core readings.] ... Date Added: 2009-08-10 21:12:55 |
| euroclipold.pdf Path: UCCS >> CS >> 591 Fall, 2009 Description: H b R HC R bCP G 1 # Q VCFaSg8TQqHd8U\'8RU 8P)Ew)@8gDC2QkB)(\"dkA w\' @89g%\'\"8U B 1 G # % # ! 1 % 1 3 2 1 1 % # ! ${67U6`5w24wtjU0)8... Date Added: 2009-08-10 21:13:20 |
| Summer-Acct.pdf Path: UNC Charlotte >> ACCT >> 6150 Fall, 2008 Description: ... Date Added: 2009-08-10 21:14:13 |
| Consolidation, Joint Ventures and Associates.ppt Path: UNC Charlotte >> ACCT >> 6299 Fall, 2008 Description: Consolidation, Joint Ventures and Associates Consolidation Key Concepts IAS 27 Definitions Consolidated financial statements - Financial statements of a group presented as those of a single economic entity Group Parent and all its subsidiaries... Date Added: 2009-08-10 21:14:17 |
| Chapter 10 Slides.ppt Path: UNC Charlotte >> ACCT >> 42205220 Fall, 2009 Description: Chapter 10 Cost Recovery on Property: Depreciation, Depletion, and Amortization Kevin Murphy Mark Higgins 2009 South-Western, a part of Cengage Learning Concept Review y The capital recovery concept allows a taxpayer to recover all invested capita... Date Added: 2009-08-10 21:14:19 |
| CyberPetHandout.doc Path: UNI >> CNS >> 062 Fall, 2009 Description: / / FILE: MobileCyberPet.java / AUTHOR: Eugene Wallingford / DATE: September 21, 2000 / COMMENT: Homework 2 / / MODIFIED: October 4, 2000, by Eugene Wallingford / CHANGE: Added location() accessor for use in subclasses. / Refactored move( int, int ) ... Date Added: 2009-08-10 21:14:46 |
| IHW1.docx Path: Arizona >> MATH >> 115 Fall, 2009 Description: Business Mathematics I Homework 1 Prepared for Stephen Reyes Math 115a, Section University of Arizona By Name of student Submitted on Date I affirm that I completed this assignment in its entirety and that the work contained herein is original. Furt... Date Added: 2009-08-10 21:15:15 |
| testin.txt Path: RIT >> PROJECT >> 5064 Fall, 2009 Description: 10,0,10; 30,10,-10; 60,10,-2; 90,5,-20; 120,0,0; 0,5,20; 30,0,50; 60,-10,30; 90,0,15; 120,7,40; 130,0,10; 150,10,-10; 180,10,-2; 210,5,-20; 240,0,0; 120,5,20; 150,0,50; 180,-10,30; 210,0,15; 240,7,40; ... Date Added: 2009-08-10 21:15:26 |
| review1.pdf Path: Kentucky >> AS >> 100 Fall, 2009 Description: V v piY r eiv Ye V v piY i qY q c v W We j c g d Y pi dv p c wsswpyhs7Xous@wdyvbysgvwigH@hsquvhggfvesXopasp Y l b`ks l b`ksg e Y l `h`Eshg5og~{gEbghsgndXVbXdShYdY 7 bX@hE7swgvfBdhYsgvsW shquivhggfvswi 7 rv v l v dv } VYje W qv V... Date Added: 2009-08-10 21:15:33 |
| final_cover.pdf Path: Olin >> ENGR >> 3340 Fall, 2009 Description: Final Exam Dynamics (Engr 3340, Fall 2006) 14 December 2006 Instructions You have 3 hours to work the exam. Work alone. The exam is closed book and closed note with the exception of. a single page of notes (submit these notes with your exam) t... Date Added: 2009-08-10 21:17:01 |
| quiz8.pdf Path: Dickinson State >> MATH >> 165 Fall, 2008 Description: Mathematics 165, Quiz 8 Thursday, March 13, 2008 (1) Let y = 11 Name: (3x)7 tan(ex ) . Find y . (4 - 2x9 )esin(x) (2) A particle moves along the curve s = f (t) = s is measured in meters. (a) Find the velocity at time t. (b) Find the acceleration ... Date Added: 2009-08-10 21:17:22 |
| David Bonomi.docx Path: Uni. Westminster >> DRB >> 0719 Fall, 2009 Description: David Bonomi Mgmt 305: Principles of Management Exam #1 1. A. ... Date Added: 2009-08-10 21:18:30 |
| Lecture321.ppt Path: Missouri S&T >> CS >> 406 Fall, 2009 Description: CS 406 Software Engineering II Frank Liu COCOMOII Objectives of COCOMO II To develop a software cost and schedule estimation model tuned to modern lifecycle practices To develop software cost database and tool support capabilities for continuous m... Date Added: 2009-08-10 21:18:39 |
| Lecture314.ppt Path: Missouri S&T >> CS >> 406 Fall, 2009 Description: CS 406 Software Engineering II Frank Liu COCOMOII Objectives of COCOMO II To develop a software cost and schedule estimation model tuned to modern lifecycle practices To develop software cost database and tool support capabilities for continuous m... Date Added: 2009-08-10 21:18:39 |
| Ihlanfeldt.pdf Path: Pratt >> PLAN >> 657 Fall, 2009 Description: ... Date Added: 2009-08-10 21:19:13 |
| exc0026.txt Path: UCSD >> SPRAY >> 026 Fall, 2009 Description: SN 0026 Exception Log 0 Pump recovery required. 1 Drop Weight activated. 2 P>20 when at the surface. 3 Catastrophic P value: too deep. 4 Used the altimeter to turn-around. NOT REPORTED HERE. ... Date Added: 2009-08-10 21:19:33 |
| chap7.pdf Path: UPenn >> CIS >> 510 Fall, 2008 Description: Chapter 7 Gentzen\'s Sharpened Hauptsatz; Herbrand\'s Theorem 7.1 Introduction We have mentioned in Chapter 6 that the cut elimination theorem shows the existence of normal forms for proofs, namely the fact that every LK-proof can be transformed to a... Date Added: 2009-08-10 21:19:53 |
| chap6.ppt Path: Virginia Tech >> CS >> 2704 Summer, 2002 Description: Chapter 6 Generalization: Inheritance & Polymorphism Section 6.1: Progression of Roles Generalization versus Abstraction Frequently confused, but distinct Abstraction Generalization Simplify the description of something Find common propertie... Date Added: 2009-08-10 21:20:57 |
| Official WC44 Rankings.xls Path: Georgia Tech >> GTH >> 681 Fall, 2009 Description: Sheet1 Last Last Last Last Rank completed completed completed completed WC WCQ CoH BoF 43 43 35 31 Points WC43 Finals 61.90 46.85 41.46 39.38 38.87 37.57 36.07 35.60 34.94 34.82 34.67 34.40 34.02 33.83 32.00 31.75 30.99 30.80 28.92 28.20 25.65 25.40 ... Date Added: 2009-08-10 21:22:35 |
| TRUNK-DavServlet-PATCH.txt Path: Berkeley >> SECURE >> 11561 Fall, 2009 Description: * DavServlet.java Fri Jan 27 18:10:55 2006 - DavServlet.java.new Fri Jan 27 18:17:35 2006 * * 1996,2001 * - 1996,2003 - return; } + / send a \"201 Created\" not \"200 OK\" + resp.setStatus(HttpServletResponse.SC_CREATED); / Removing an... Date Added: 2009-08-10 21:22:56 |
| Lecture04.ppt Path: CSU Fullerton >> CPSC >> 485 Fall, 2008 Description: Greedy Algorithms And Genome Rearrangements Outline Genome Rearrangements Sorting By Reversals Greedy Algorithm for Sorting by Reversals Approximation Algorithms Breakpoints: a Different Face of Greed Breakpoint Graphs History of Chromos... Date Added: 2009-08-10 21:23:51 |
| class17.ppt Path: Georgia Tech >> CS >> 4001 Fall, 2008 Description: Class 17 Midterm exam discussion Gathering Assign WA Ch 7-10/23 Midterm exam-10/25 Term paper approach-11/1 CS 4001 Mary Jean Harrold 1 Using Evidence Effectively CS 4001 Mary Jean Harrold 2 Quick Quiz Name 1. The STAR criteria can be used ... Date Added: 2009-08-10 21:25:41 |
| week2.ppt Path: Southern Illinois University, Carbondale >> HED >> 326 Fall, 2008 Description: Reliability & Validity Week 2 Spring 2006 Independent Variables Those variables that are manipulated by the researcher Active-under control of researcher and are manipulated Attribute non-manipulative variables such as race and sex. This is... Date Added: 2009-08-10 21:27:48 |
| exam2ans.txt Path: SMU - Cox School of Business >> P >> 1303 Fall, 2009 Description: MbJV7\'1E:.f ev r|~jxc_mIQPU!$[_I.p8/),x)j_w0(EZ^zR?}BII`6Hk#,RMx)FNNQO 2+|z... Date Added: 2009-08-10 21:27:52 |
| DigiKey-BindingPosts.pdf Path: N.C. State >> ECE >> 200 Fall, 2008 Description: Plugs and Jacks Fig. 1 Fig. 2 Fig. 3 Fig. 4 Fig. 5 Fig. 6 Fig. 7 Fig. 8 A MINI SIZE Fig. 9 Fig. 10 Fig. 11 Fig. 12 Fig. 13 Fig. 14 Fig. 15 Fig. 16 Fig. 17 Fig. 18 Fig. 19 Fig. 20 Fig. 21 Fig. 22 Fig. Color Digi-Key Part No. 1 10 100 Pr... Date Added: 2009-08-10 21:28:24 |
| 05062401.pdf Path: Wisconsin >> SH >> 050624 Fall, 2009 Description: ... Date Added: 2009-08-10 21:28:37 |
| Ex4_GSC334W09.pdf Path: Cal Poly Pomona >> GSC >> 334 Fall, 2009 Description: Exercise 4 GSC334 100 pts maximum, due before the start of the Lab February 25th 2009 Delay Time Method, x2-t2 and Dix\'s Equation Introduction These exercises involve the interpretation of the results of a refraction experiment in terms of a irregul... Date Added: 2009-08-10 21:28:53 |
| Optical fiber sensors.ppt Path: UT Arlington >> MAE >> 5301 Fall, 2009 Description: Fundamental of Fiber Optics Optical Fiber Total Internal Reflection V-Number and Fiber Modes 2.405 V = 2a( NA) / a : radius of core : wavelength of ligth Cut-off Wavelength Definition: the wavelength below which multiple modes of light can be... Date Added: 2009-08-10 21:28:55 |
| info.ps Path: Cal Poly >> CS >> 624 Fall, 2008 Description: %!PS-Adobe-2.0 %Creator: dvips(k) 5.86 Copyright 1999 Radical Eye Software %Title: info.dvi %Pages: 1 %PageOrder: Ascend %BoundingBox: 0 0 612 792 %EndComments %DVIPSWebPage: (www.radicaleye.com) %DVIPSCommandLine: dvips info %DVIPSParameters: dpi=60... Date Added: 2009-08-10 21:28:59 |
| 25878.txt Path: UNC >> DOCS >> 25878 Fall, 2009 Description: The Project Gutenberg EBook of Commentary Upon the Maya-Tzental Perez Codex, by William E. Gates This eBook is for the use of anyone anywhere at no cost and with almost no restrictions whatsoever. You may copy it, give it away or re-use it under th... Date Added: 2009-08-10 21:29:31 |
| exam01.pdf Path: Los Angeles Southwest College >> MATH >> 241 Fall, 2009 Description: Math 241 Section 001 Exam 1 Wednesday, February 11, 2009 Name: Show all your work! No work means no credit. There are 5 problems which total 100 points (which is the maximum score) plus a bonus problem, which is worth 15 points. Formula sheets or ... Date Added: 2009-08-10 21:30:21 |
| oun00z.txt Path: University of Illinois, Urbana Champaign >> ATMOS >> 20081129 Fall, 2009 Description: UPPER AIR CALCULATIONS AND PLOTTING (Ver 5.48.1-LINUX-X11) Current filename: /mnt/noaaport/nwstg/convert/08112912_upa.wxp Date: 1200Z 29 NOV 08 Searching for KOUN. Searching the city database file for: KOUN . Date:1200Z 29 NOV 08 Station: KOUN... Date Added: 2009-08-10 21:31:17 |
| Output.txt Path: Allan Hancock College >> JACK >> 8456 Fall, 2009 Description: Caching Off Speed = 100 = _228_jack Starting = Run 0 start. Total memory=75497472 free memory=65368064 Jack Version 0.1: Parser 0 has been generated successfully. Jack Version 0.1: Parser 1 has been generated successfully. Jack Version 0.1: Parser... Date Added: 2009-08-10 21:32:50 |
| 6115_final_diagrams.pdf Path: MIT >> DAVID >> 733 Fall, 2009 Description: ... Date Added: 2009-08-10 21:33:13 |
| CompSci4Java4.ppt Path: Duke >> CPS >> 081202 Fall, 2009 Description: CompSci 4 Java 4 Dec 2, 2008 Prof. Susan Rodger Announcements Assignment 7 due tonight Quiz on Java Thursday Practice writing Java classworks on paper Understand processing a string, processing an array Final project presentations Sat Dec 13 ... Date Added: 2009-08-10 21:34:28 |
| ch06.ppt Path: BYU Hawaii >> BUSM >> 327 Fall, 2009 Description: SELECTION BUSM 327, Ch 6 1 Chapter Objectives Explain the significance of employee selection. Identify environmental factors that affect the selection process. Describe the general selection process. Explain the importance of the preliminary... Date Added: 2009-08-10 21:34:41 |
| DeRidder-MAP.pdf Path: University of Louisiana at Lafayette >> JCW >> 8087 Fall, 2009 Description: ... Date Added: 2009-08-10 21:35:29 |
| ParkingSign.YouthIntalianCooking.pdf Path: University of Louisiana at Lafayette >> JCW >> 8087 Fall, 2009 Description: ... Date Added: 2009-08-10 21:35:31 |
| group1_attw.ps Path: New Mexico >> CS >> 599 Fall, 2008 Description: %!PS-Adobe-2.0 %Creator: dvips(k) 5.86 Copyright 1999 Radical Eye Software %Title: attw.dvi %Pages: 2 %PageOrder: Ascend %BoundingBox: 0 0 612 792 %EndComments %DVIPSWebPage: (www.radicaleye.com) %DVIPSCommandLine: dvips attw.dvi %DVIPSParameters: dp... Date Added: 2009-08-10 21:36:16 |
| anriquez_trade_and_environment.pdf Path: Midwestern State University >> ECONS >> 581 Fall, 2009 Description: Trade and the Environment: An Economic Literature Survey by Gustavo Anrquez WP 02-16 Department of Agricultural and Resource Economics The University of Maryland, College Park Draft, September 20, 2002 Trade and the Environment: An Economic Litera... Date Added: 2009-08-10 21:36:22 |
| finsamp.doc Path: N.C. State >> MBA >> 505 Spring, 2008 Description: MBA505 Sample Questions 1. Suppose the market for roses is perfectly competitive. If there is an increase in supply, can you be sure whether or not the total dollar spending on roses increases? Why or why not? If there is an increase in demand, can ... Date Added: 2009-08-10 21:36:35 |
| workshop1_NT-NWonMEMS_2006.doc Path: Colorado >> MCEN >> 5166 Fall, 2008 Description: MCEN 5166-001/4288-003 Electrical Packaging and Manufacturing Name: _ WORKSHOP 1 Nanotube/Nanowire on Micro-Scaled Platforms Fall 2006 Figure below shows a nanotube or nanowire bonded on a micro-scale platform. Due to thermal mismatch, the assembly... Date Added: 2009-08-10 21:37:45 |
| grb00z.txt Path: University of Illinois, Urbana Champaign >> ATMOS >> 20090129 Fall, 2009 Description: UPPER AIR CALCULATIONS AND PLOTTING (Ver 5.48.1-LINUX-X11) Current filename: /mnt/noaaport/nwstg/convert/09012912_upa.wxp Date: 1200Z 29 JAN 09 Searching for KGRB. Searching the city database file for: KGRB . Date:1200Z 29 JAN 09 Station: KGRB... Date Added: 2009-08-10 21:37:48 |
| HDFRIChapter3Solutions13e Path: Univ. of Massachusetts Med. School >> ACCT >> 612 Spring, 2009 Description: CHAPTER 3 COST-VOLUME-PROFIT ANALYSIS NOTATION USED IN CHAPTER 3 SOLUTIONS SP: VCU: CMU: FC: TOI: Selling price Variable cost per unit Contribution margin per unit Fixed costs Target operating income 3-1 Cost-volume-profit (CVP) analysis examines th... Date Added: 2009-08-11 04:06:12 |
| ways to make gallon.xls Path: Millersville >> EDFN >> 333 Fall, 2009 Description: # cups % of gallon # pints 0.00% 0.00% 16 100.00% 8 50.00% 4 25.00% 0.00% 0.00% 0.00% 0.00% 0.00% 0.00% 0.00% 0.00% 0.00% 0.00% 0.00% 0.00% 0.00% 0.00% 0.00% 0.00% 0.00% 0.00% 0.00% 0.00% 0.00% 0.00% 0.00% 0.00% % of gallon # quarts % of gallon # g... Date Added: 2009-08-11 04:24:49 |
| Anatomy_and_Beauty_.ppt Path: Brookdale >> ANATOMY >> 5217 Fall, 2009 Description: Anatomy of Beauty Anatomy 5217 Richard Wassersug Fall, 2007 Symmetry The Concept of Fluctuating Asymmetry a measure of developmental stability examples, breast asymmetry, pelvis, leg length, dancing styles Scoliosis, back pain Voice quality and... Date Added: 2009-08-11 04:25:04 |
| Homework_03.pdf Path: Berkeley >> ME >> 234 Fall, 2008 Description: ME 234 Issued: February 03, 2005 Assignment # 3 Due: February 11, 2005 Most of these problems are from the quiz. I want you to do these again, just in case you didn\'t get them in the quiz, or you ran out of time. The last two problems are new. 1 In... Date Added: 2009-08-11 04:25:07 |
| 08-cache-handouts.pdf Path: Maine >> COS >> 335 Spring, 2008 Description: COS 335: Computer Architecture Memory Spring 2007 Review Memory Hierarchy Review . Caching. . . . . . . . . . . . . . . Efficacy of Caching . . . . . . . Cache Memory . . . . . . . . . . Overview of Read Operation. Size of Cache . . . . . . . . . .... Date Added: 2009-08-11 04:25:22 |
| 2292exam2.pdf Path: Youngstown >> MATH >> 3743 Fall, 2009 Description: MATH 3743 Code 2292 Name: Probability and Statistics: Exam 2 Score: Fall 2002 /105 Please use a pencil and show all work. You may find the following formulas useful: n ar k=1 k-1 a(1 - rn ) = , and thus for |r| < 1, 1-r ark-1 = k=1 a , 1-r... Date Added: 2009-08-11 04:26:48 |
| lab01.ps Path: Moravian >> CS >> 191 Fall, 2009 Description: %!PS-Adobe-2.0 %Creator: dvips(k) 5.95a Copyright 2005 Radical Eye Software %Title: lab01.dvi %Pages: 1 %PageOrder: Ascend %BoundingBox: 0 0 612 792 %DocumentFonts: NewCenturySchlbk-Roman NewCenturySchlbk-Bold Courier %+ LCIRCLE10 Courier-Oblique New... Date Added: 2009-08-11 04:27:10 |
| set3.pdf Path: Cal Poly Pomona >> PHY >> 133 Fall, 2009 Description: ... Date Added: 2009-08-11 04:28:12 |
| Sp 09 MBA 610G patents.ppt Path: N.C. State >> MBA >> 610 Fall, 2009 Description: Intangible and Intellectual Property Intangible property that is not intellectual property includes Stock certificates, bankbooks, credit cards Has no real physical existence Gives its owners rights to exclude duplication, sale, or distribution... Date Added: 2009-08-11 04:29:39 |
| CreditsScreen.java.txt Path: East Los Angeles College >> SC >> 105 Fall, 2009 Description: import java.awt.*; import java.awt.geom.*; /* * Scrolls some credits up the screen. * @author Clayton Peters */ public class CreditsScreen extends RenderMonkey { /* Font should not be bold or italic */ private static final int NONE = Font.PLAIN... Date Added: 2009-08-11 04:31:00 |
| Fall07.pdf Path: Southern Illinois University, Carbondale >> ISAT >> 224 Fall, 2008 Description: Syllabus for ISAT 224 - Fall 2007 Instructor: Ralph Tate Office/Hours: ASA 120 Telephone: (618) 453-8878 Classroom/Time: ASA 204B Textbook: 10:00 12:00 Monday, Wednesday, and Friday Email/Website: rtate@siu.edu www.siu.edu/~rtate 2:00 3:50PM Tuesd... Date Added: 2009-08-11 04:32:00 |
| Rubric-HW2.pdf Path: Bethel VA >> CHE >> 400 Fall, 2009 Description: ChE 400 Homework Problem # 2- Grading Rubric Name: Asses P1 P2 P3 P4 P5 P6 Letter 1e1 1e1,1b1,1e5,1e4 1e8 2b3,1f1 1e7 2b2 1a2 1a2 1a2 1a2 Objective express as math expression Correct assumptions and Equations Analyze answers to parts c, d, and e G... Date Added: 2009-08-11 04:35:00 |
| assign4.pdf Path: New Mexico >> SHS >> 330 Fall, 2008 Description: SHS 330 Fall, 2007 Assignment #4 Name: _ 1. Label the following items on the drawing above: (1 point each) a. All nodes c. Soft boundary b. All antinodes d. Hard boundary Which mode of vibration is shown in the tube? _ ( 2 points) Which harmonic i... Date Added: 2009-08-11 04:35:08 |
| Progsumm.ppt Path: UCCS >> INFS >> 305 Spring, 2008 Description: Programming With Handson VBA How does a programmer develop a computer program? Begins with a problem statement to help clearly define purpose of the program Specifies any assumptions Clearly specifies the known information Help to defi... Date Added: 2009-08-11 04:35:16 |
| Slides_16.ppt Path: Cascadia Community College >> BIT >> 116 Winter, 2009 Description: BIT 116:JavaScript Instructor: Mike Panitz (mpanitz@cascadia.ctc.edu) Today More DOM stuff Basic Cookies BIT 116: Scripting 2 Next lecture More cookies Form Validation Regular Expressions Maybe some AJAX BIT 116: Scripting 3 Homework A4... Date Added: 2009-08-11 04:35:34 |
| Math history Rebecca.doc Path: University of Illinois, Urbana Champaign >> CI >> 399 Fall, 2009 Description: Math History \"Rebecca\" \"Rebecca\" (female) is an 8th grader in a small suburban middle school in an affluent suburb of Chicago. Students who attend the school range from those on free lunches to quite well off. The school district annually receive... Date Added: 2009-08-11 04:35:56 |
| BP-usedcar-AD-Meyer.pdf Path: Berkeley >> I >> 243 Spring, 2009 Description: Rich Meyer IS243 Collaboration 1 Assess Needs and Requirements Buyer Submits Request for CDL To DMV DMV Approves CDL? Yes Buyer Assesses Needs And Constraints Do I have a CDL? Buyer Satisfies Requirements List No Terminate Process No Yes Yes Colla... Date Added: 2009-08-11 04:36:26 |
| summary25.2.pdf Path: Stanford >> FILES >> 5603 Fall, 2009 Description: Next Steps and Conference Summary EMF 25 Second Working Group Meeting Energy Demand and Efficiency Stanford University, Stanford, CA April 22-23, 2009 Next Steps The next meeting of EMF 25 will be held in November or December 2009, subject to final c... Date Added: 2009-08-11 04:37:49 |
| E26engrlab.txt Path: Minnesota >> CS >> 3620 Fall, 2009 Description: From jsheppar@d.umn.edu Wed May 13 13:27:00 1998 Date: Sun, 10 May 1998 19:23:12 -0500 (CDT) From: Josh Sheppard <jsheppar@d.umn.edu> To: CS3620 Lab Team 4 - kristy vanhornweder <kvanhorn@d.umn.edu>, matthew kirsling <mkirslin@d.umn.edu>, robert... Date Added: 2009-08-11 04:38:06 |
| Lecture-10.doc Path: Michigan State University >> EPI >> 826 Fall, 2008 Description: Alka Indurkhya EPI 826 10/4/99 Lecture 10: Interactions and Confounders Kleinbaum (Chapter 6) The above strategy involves backward elimination according to a well defined criteria. There are others such as forward selection. Kleinbaum\'s recommende... Date Added: 2009-08-11 04:38:13 |
| mpx00z.txt Path: University of Illinois, Urbana Champaign >> ATMOS >> 20090307 Fall, 2009 Description: UPPER AIR CALCULATIONS AND PLOTTING (Ver 5.48.1-LINUX-X11) Current filename: /mnt/noaaport/nwstg/convert/09030712_upa.wxp Date: 1200Z 7 MAR 09 Searching for KMPX. Searching the city database file for: KMPX . Date:1200Z 7 MAR 09 Station: KMPX... Date Added: 2009-08-11 04:40:19 |
| 3.16.09 Bar Chart - Progress Schedule.pdf Path: Penn State >> NLB >> 5002 Fall, 2009 Description: Bar Chart/Progress Schedule Monday, March 16, 2009 Natalie Bryner Construction Management Option Faculty Consultant: Dr. Anumba Constitution Center 400 7th Street SE, Washington, DC 20024 Natalie Bryner Construction Management Option Faculty Consul... Date Added: 2009-08-11 04:40:40 |
| gauss_posterior.txt Path: Berkeley >> ASTRO >> 00116116 Fall, 2009 Description: Posterior Peaks at Ep=90.48 (64.26 446.39) keV Posterior Peaks at Eiso=1.10e-05 (9.05e-06 2.27e-05) erg ... Date Added: 2009-08-11 04:41:01 |
| AC339.058.pdf Path: Princeton >> AC >> 339 Fall, 2009 Description: ... Date Added: 2009-08-11 04:41:20 |
| AC339.085.pdf Path: Princeton >> AC >> 339 Fall, 2009 Description: ... Date Added: 2009-08-11 04:41:24 |
| ttest150handout.pdf Path: UCLA >> STAT >> 150 Fall, 2009 Description: t-test (see Chapter 2 handout) Basic application: testing differences in means for 2 independent samples OR one sample of matched pairs Textbook examples 1. Bumpus looking for evidence to prove natural selection, collected sparrows after a storm. So... Date Added: 2009-08-11 04:43:09 |
| SRA111_Syllabus_Fall07.doc Path: Penn State >> SRA >> 111 Spring, 2008 Description: SRA 111 Introduction to Security and Risk Analysis Fall 2007 Syllabus Course Information Location: 202 Butler Teaching and Learning Resource Center Section 1: T, R, 09:20 am 10:35 am Section 2: T, R, 10:40 am 11:55 am Instructor Information Dr. Er... Date Added: 2009-08-11 04:45:00 |
| asg6.ps Path: Case Western >> TMB >> 338 Fall, 2009 Description: %!PS %Version: 3.15 %DocumentFonts: (atend) %Pages: (atend) %EndComments %ident \"@(#)lp:filter/postscript/postscript/dpost.ps % % Version 3.16 prologue for troff files. % /#copies 1 store /aspectratio 1 def /formsperpage 1 def /landscape false def /l... Date Added: 2009-08-11 04:45:32 |
| ECE474S09_Lecture41.ppt Path: Michigan State University >> ECE >> 474 Spring, 2008 Description: ECE 474: Principles of Electronic Devices Prof. Virginia Ayres Electrical & Computer Engineering Michigan State University ayresv@msu.edu Lecture 41: Chp. 08 = Chp. 04 + Chp.05: Semiconductor Solar Cells Info from Chp. 05 Info from Chp. 04 Chp.... Date Added: 2009-08-11 04:46:30 |
| index.txt Path: Berkeley >> ASTRO >> 00261880 Fall, 2009 Description: 2.3400002 17.160000 6.7051338 -0.29061214 713.72929 17.160000 234.50000 11.173490 -1.8306697 248.99890 234.50000 274.61700 58.096946 -10.301325 6.9285890 ... Date Added: 2009-08-11 04:46:42 |
| swb_timeinfo_1s.txt Path: Berkeley >> ASTRO >> 00261880 Fall, 2009 Description: #file=swb15-350lc.txt dt=1.0 tstart=-14.965 tstop=11.765 #t90 dt90 t50 dt50 rt90 drt90 rt50 drt50 rt45 drt45 tav dtav tmax dtmax trise dtrise tfall dtfall cts cts_err pk_rate dpk_rate band 25.000 1.388 12.000 1.418 18.000 ... Date Added: 2009-08-11 04:46:47 |
| 1979spechtd.pdf Path: Wisc Stout >> LIB >> 1979 Fall, 2009 Description: THE EFFECT OF JUNIOR ACHIEVEMENT ON STUDENTS\' ATTITUDES TOWARDS BUSINESS AND INDUSTRY by Donald K. Specht A Research Paper Submitted to Complete the Plan B Requirements in 190 - 735 Problems in Industrial Education Investigation Advisor The Gradu... Date Added: 2009-08-11 04:47:15 |
| ch01.ppt Path: ASU >> CSE >> 430 Fall, 2008 Description: vti_encoding:SR|utf8-nl vti_timelastmodified:TR|25 Aug 2008 18:20:28 -0000 vti_extenderversion:SR|6.0.2.8161 vti_backlinkinfo:VX|OS\\ Concepts\\ slides.htm ... Date Added: 2009-08-11 04:47:37 |
| ch02.ppt Path: ASU >> CSE >> 430 Fall, 2008 Description: vti_encoding:SR|utf8-nl vti_timelastmodified:TR|25 Aug 2008 18:20:28 -0000 vti_extenderversion:SR|6.0.2.8161 vti_backlinkinfo:VX|OS\\ Concepts\\ slides.htm ... Date Added: 2009-08-11 04:47:37 |
| tut7.pdf Path: Allan Hancock College >> MATH >> 130 Fall, 2009 Description: MATH130 DE1 2006 Tutorial Exercises Week 7 1. Solve each of the following equations: (a) 272-x = 9x-2 (b) 1 x 9 = 3 81-x 2. Find the precise value of each of the following expressions: (a) log3 1 27 (b) log5 125 3. Solve each of the followin... Date Added: 2009-08-11 04:48:46 |
| lec_13.ps Path: Georgia Tech >> CS >> 3411 Fall, 2009 Description: %!PS-Adobe-2.0 %Creator: dvipsk 5.526a Copyright 1986, 1993 Radical Eye Software %Title: lec_13.dvi %Pages: 4 %PageOrder: Ascend %BoundingBox: 0 0 612 792 %EndComments %DVIPSCommandLine: dvips -f lec_13 %DVIPSParameters: dpi=300, comments removed %DV... Date Added: 2009-08-11 04:48:53 |
| Reconstruction.doc Path: Penn State >> AAAS >> 210 Fall, 2009 Description: AAAS/HIST 210 De Jure Emancipation did not mean De Facto Freedom * Presidential Reconstruction Lincoln\'s Plan Johnson\'s Plan * Congressional Reconstruction * Freedmen and women during Reconstruction * The End of Reconstruction ... Date Added: 2009-08-11 04:52:34 |
| crn.pdf Path: UNC Asheville >> ATMS >> 320 Fall, 2009 Description: U.S. Climate Reference Network C. Bruce Baker, Michael R. Helfert NOAA/NCDC NOAA\'s Benchmark USA Climate Observing Network Designed to answer questions about National Temperature & Precipitation changes with the highest confidence Siting: 114 CONUS... Date Added: 2009-08-11 04:53:18 |
| Vectors.ppt Path: Clark U >> MATH >> 122 Fall, 2009 Description: Vectors: San Francisco Bay 12:00 PM, June 11, 2002 4:00 PM, June 30, 2002 Ocean current off the coast of Nova Scotia Airflow past an inclined airfoil Vectors: Vectors Tertiary structure of HIV-1 gp120 protein Cartesian Plane Coordinates Ca... Date Added: 2009-08-11 04:54:06 |
| Differences in amino acid positions in insulin.docx Path: Indiana State >> CARBON >> 330 Fall, 2009 Description: Differences in amino acid positions in insulin Species cow sheep horse human pig chicken duck whale A8 ala ala thr thr thr his glu thr A9 ser gly gly ser ser asn asn ser A10 val val ile ile ile thr pro ile B30 ala ala ala thr ala ala thr identical a... Date Added: 2009-08-11 04:55:10 |
| siteplan3-excavation.pdf Path: Penn State >> SRC >> 169 Fall, 2009 Description: ... Date Added: 2009-08-11 04:55:45 |
| Student Progress Worksheet-CH100.doc Path: El Paso CC >> CH >> 100 Fall, 2009 Description: CH100: Fundamentals for Chemistry Student Progress & Grading Worksheet: 6/24/2009 This worksheet has been developed to assist you in assessing your class progress. Directions (for Exams): 1) For each Exam taken, divide your exam score by the tota... Date Added: 2009-08-11 04:57:10 |
| ph213_overhead_ch23.ppt Path: El Paso CC >> PH >> 213 Fall, 2009 Description: Phy 213: General Physics III Chapter 23: Gauss\' Law Lecture Notes 1. Consider a electric field passing through a region in space. The electric flux , E, is the scalar product of the average electric field vector and the normal area vector for the r ... Date Added: 2009-08-11 04:57:18 |
| MaureenObituary.pdf Path: Minnesota >> SUMME >> 057 Fall, 2009 Description: \'san rlJno lle peq)r;ua luol \'aur6eur ue) noA spamAlanau lsarddeq aqr 1o oml Moqs dr.rl.rraql ulor] sernl>rd aq1\'o)sr)upJJ ueS ur pauoot-ulauoq Iaql\'elpusspl) looq)s q6rq pue ztoq uanoleuroq Jaqloue \'ra1>o1s Luol q1M e^ol ul lle,t aq5 \'pauad -deq 6ur... Date Added: 2009-08-11 04:59:33 |
| MKT230R(WEBAssignment2).doc Path: N. Michigan >> MKT >> 230 Fall, 2008 Description: Assignment 2 (WEB) MKT 230R Introduction to Marketing Recitation Dr. Brunswick Due Date: Point Value: Description: 31 January 2007(9:00 a.m.; email to gbrunswi@nmu.edu) 40 Points An important topic in MKT 230 Introduction to Marketing is new pro... Date Added: 2009-08-11 04:59:47 |
| ICEW20080215.pdf Path: DePaul >> INTSTUDS >> 20080214 Fall, 2009 Description: February 15, 2008 International Career Employment Weekly The only comprehensive source of information on international career positionsr 2008 Carlyle Corporation All Rights Reserved. INTERNATIONAL DEVELOPMENT & ASSISTANCE SENIOR PROGRAM ASSOCIATE C... Date Added: 2009-08-11 05:01:11 |
| review.pdf Path: Minnesota >> SHIXX >> 055 Spring, 2009 Description: 1. Find the quotient and remainder of x4 - x3 - 8x2 + 2x + 12 divided by x2 - 4x + 3. 2. Find the quotient and remainder of 2x3 - x2 - 5x + 4 divided by x - 2. [If you had difficulty answering these questions, review section A.4 in the textbook.] 3. ... Date Added: 2009-08-11 05:03:00 |
| lec15.pdf Path: Carnegie Mellon >> STAT >> 202 Fall, 2009 Description: One-Way ANOVA (ANalysis Of VAriance) Goal: Examining the relationship between X and Y = Comparing the population means 1 , 2 , 3 , . . . , k . Notations: Sample 1: y11, y12, y13 . . . y1n1 = Y1, s1 Sample 2: y21, y22, y23 . . . y2n2 = Y2, s2 Samp... Date Added: 2009-08-11 05:03:13 |
| Chapter20.doc Path: Old Dominion >> CS >> 772 Fall, 2008 Description: Chapter 20. Electronic Mail Security Issues: Distribution lists: Remote exploder and local exploder methods Store and forward (MTA-Message transfer agent; UA - User agent) Security services for E-mail o Privacy o Authentication o Integrity o Non-r... Date Added: 2009-08-11 05:03:26 |
| SocialConstructExpertRiskAssess.pdf Path: Texas A&M >> GEOL >> 420 Fall, 2008 Description: Zwanenberg, Millstone Expert Risk Assessments Science, Technology, & /Human Values Beyond Skeptical Relativism: Evaluating the Social Constructions of Expert Risk Assessments Patrick van Zwanenberg Erik Millstone University of Sussex Constructivist... Date Added: 2009-08-11 05:03:57 |
| final.pdf Path: Oregon >> CIS >> 415 Fall, 2008 Description: CIS 415 Operating Systems Final exam: Spring 2009 Name: DUE: 12:00 noon, Thursday, June 11th, 2009. INSTRUCTIONS: Read the questions carefully and take your time. The benefit of a take home exam is that you can work at a relaxed pace and perform we... Date Added: 2009-08-11 05:05:26 |
| Herbsleb-Integrating.pdf Path: Oregon >> CIS >> 422 Fall, 2008 Description: Conway\'s Observation Conway\'s Law: The Structure of Products, Processes, and Organizations Reading: Herbsleb Conway\'s Law Revisited\" In any project large enough to require a complex organization, the structure of the project reflects the... Date Added: 2009-08-11 05:05:59 |
| week9.pdf Path: Wilfrid Laurier >> MATH >> 253 Fall, 2009 Description: Some Examples from Week Nine Volumes of Revolution Example. Find the volume obtained by rotating the region enclosed by y = x2 and y = 2 - x about the axis y = -1. We first draw a picture, 5 4 3 y=x2 2 1 0 x y=-1 y=2-x -1 -2 -3 -2 -1 0 ... Date Added: 2009-08-11 05:08:07 |
| 09_vrfy.pdf Path: SMU - Cox School of Business >> ENGR >> 7301 Fall, 2009 Description: Agenda for verify activity r 1. Objective r 2. Verification Vs validation r 3. Verification methods r 4. Test documentation r 5. Test execution r 6. Test results r 7. Reviews r 8. Special tests 9. Verify and sell-off 1 1. Objective r Verify activi... Date Added: 2009-08-11 05:09:30 |
| 10_appl.ppt Path: SMU - Cox School of Business >> ENGR >> 7301 Fall, 2009 Description: Applications Agenda (1 of 2) 1. Introduction 2. Example 3. Simple products 4. Classical development 5. Incremental builds 6. Spiral development 7. Prototypes 10. Applications 1 Applications Agenda (2 of 2) 8. Enterprise boundary 9.... Date Added: 2009-08-11 05:09:35 |
| 0302_Dostie_Dekker_2006.pdf Path: Harvard >> BIOPHYSICS >> 205 Fall, 2009 Description: Methods Chromosome Conformation Capture Carbon Copy (5C): A massively parallel solution for mapping interactions between genomic elements Jose Dostie,1 Todd A. Richmond,2 Ramy A. Arnaout,3,4,5 Rebecca R. Selzer,2 William L. Lee,3 Tracey A. Honan,3 E... Date Added: 2009-08-11 05:10:10 |
| Anonymous14.doc Path: East Los Angeles College >> LT >> 305 Fall, 2009 Description: Anonymous .. 2 Anonymous ... Date Added: 2009-08-11 05:11:07 |
| checklist.doc Path: ASU >> ENG >> 102 Fall, 2008 Description: Checklist for Researching Articles in Scholarly Journals Author Article Title Journal Title Volume Number Date Page Numbers Articles in Newspapers Author Article Title Newspaper Title Date Page Numbers Articles in Popular Magazines Author Article Ti... Date Added: 2009-08-11 05:12:13 |
| core3_a old core5g.rtf Path: UNLV >> FACULTY >> 210 Fall, 2009 Description: Psy 210 Core Lab 3 SPSS Graphs 4 Marks Due: Thurs Sept 14 Open the Research Data file from Dr. Barchard\'s website. Purpose The purpose of this assignment is to learn how to create graphs in SPSS. QUESTION 1: HISTOGRAM Create a histogram of the var... Date Added: 2009-08-11 05:15:32 |
| fall2006syllabus5.rtf Path: UNLV >> FACULTY >> 210 Fall, 2009 Description: Psychology 210 Introduction to Statistical Methods Class: Section 4: Section 6: Section 9: TR 10:00 - 11:15am CBC C138 TR 1:00 - 2:15pm CBC C122 TR 4:00 - 5:15pm CBC C122 Fall 2006 Prerequisites: PSY 101 and MAT 096, 124, or 126 Instructor: Dr. Kim... Date Added: 2009-08-11 05:15:35 |
| bna00z.txt Path: University of Illinois, Urbana Champaign >> ATMOS >> 20081122 Fall, 2009 Description: UPPER AIR CALCULATIONS AND PLOTTING (Ver 5.48.1-LINUX-X11) Current filename: /mnt/noaaport/nwstg/convert/08112212_upa.wxp Date: 1200Z 22 NOV 08 Searching for KBNA. Searching the city database file for: KBNA . Date:1200Z 22 NOV 08 Station: KBNA... Date Added: 2009-08-11 05:17:02 |
| HumanFactorsandUsabilityEngineering-0001.doc Path: Colorado >> L >> 20071010 Fall, 2009 Description: Human Factors and Usability Engineering Bentley seeks a tenure-track faculty member starting in August of 2008 to teach and conduct research in our rapidly expanding graduate program in human factors and usability engineering. Like all faculty in the... Date Added: 2009-08-11 05:18:11 |
| HumanFactorsandUsabilityEngineering.doc Path: Colorado >> L >> 20071010 Fall, 2009 Description: Human Factors and Usability Engineering Bentley seeks a tenure-track faculty member starting in August of 2008 to teach and conduct research in our rapidly expanding graduate program in human factors and usability engineering. Like all faculty in the... Date Added: 2009-08-11 05:18:13 |
| mid_1040424020.pdf Path: Maryville MO >> D >> 104042 Fall, 2009 Description: Cycle 4 Advance Questionnaire - Mid Level Students (6-8) Frequency Distribution Report GALENA-ABESVILLE ELEM., GALENA R-II School District Please select your Grade Level mid_grade Frequency Percent 6 33 100.00 1 What is your sex? mid1 Frequency Per... Date Added: 2009-08-11 05:18:43 |
| Arrays.doc Path: UCF >> COP >> 3502 Fall, 2009 Description: Arrays An array is a sequence of data items that are of the same type that can be indexed and that are stored contiguously. Arrays are a data type that is used to represent a large number of homogenous values. The elements of an array are accessed... Date Added: 2009-08-11 05:22:05 |
| Boxes.rtf Path: Eastern Washington University >> CSCD >> 325 Fall, 2009 Description: Array of struct Example /* Simple struct example: Author: Timothy Rolfe sBox OpenInput (Inp); ReadData (Inp, Inventory, Nrecords); TableOut (cout, Inventory, Nrecords); cout < \"\ Press Enter to continue: \"; cin.ignore(255, \'\ \'); / Allocate space for... Date Added: 2009-08-11 05:25:35 |
| Fall03MidtermSolved.pdf Path: Washington >> CS >> 505 Fall, 2009 Description: Name: CSE 505, Fall 2003, Midquarter Examination 4 November 2003 Please do not turn the page until everyone is ready. Rules: The exam is open-book, open-note, closed electronics. Please stop promptly at 11:50. You can rip apart the pages, but p... Date Added: 2009-08-11 05:27:44 |
| lect09.pdf Path: Washington >> CS >> 527 Fall, 2009 Description: Lecture 9 Sequence Analysis II January 30, 1996 Lecturer: Larry Ruzzo Notes: Dan Fasulo The general goal of sequence analysis is to take sequenced DNA and identify its function in the cell. In this lecture, we are particularly interested in identify... Date Added: 2009-08-11 05:28:23 |
| exercises.pdf Path: Washington >> CS >> 341 Fall, 2009 Description: CSE 341 - Java Generics Discussion Questions 1. Consider the following Java code fragments. (The first 3 lines are the same for all of them; it\'s just the last line that is different.) In each case, does the code compile correctly? If so, does it exe... Date Added: 2009-08-11 05:29:07 |
| practice3.ps Path: U. Houston >> MA >> 121 Fall, 2009 Description: %!PS-Adobe-2.0 %Creator: dvips(k) 5.86 Copyright 1999 Radical Eye Software %Title: practice3.dvi %Pages: 1 %PageOrder: Ascend %BoundingBox: 0 0 612 792 %EndComments %DVIPSWebPage: (www.radicaleye.com) %DVIPSCommandLine: dvips practice3 %DVIPSParamete... Date Added: 2009-08-11 05:29:38 |
| lazySVM.ps Path: Washington >> MINI >> 573 Fall, 2009 Description: %!PS-Adobe-2.0 %Creator: dvips(k) 5.92b Copyright 2002 Radical Eye Software %Title: lazySVM.dvi %Pages: 9 %PageOrder: Ascend %BoundingBox: 0 0 612 792 %DocumentFonts: Times-Bold Times-Roman Times-Italic CMSY9 CMR10 CMMI7 %+ CMSY10 CMMI10 CMR7 CMMI5 C... Date Added: 2009-08-11 05:33:33 |
| ps1.pdf Path: Washington >> CS >> 461 Fall, 2009 Description: ! \"# $ % % ( /- # \' # \" # 1 # # \' \" % $ # % % ) # ! # \" # # 0 # # ) ) ) # # % /- # % # \" \" ) % # % # \' 0 % \" % # \" \" , \' \" .\" # % % \" %) # \" % # - # , \'- # % % #% # \' % # % \' 2 % # & # # # #... Date Added: 2009-08-11 05:35:02 |
| lecture22.ps Path: Washington >> CS >> 461 Fall, 2009 Description: %!PS-Adobe-3.0 %BoundingBox: (atend) %Pages: (atend) %PageOrder: (atend) %DocumentFonts: (atend) %Creator: Frame 4.0 %DocumentData: Clean7Bit %EndComments %BeginProlog % % Frame ps_prolog 4.0, for use with Frame 4.0 products % This ps_prolog file is ... Date Added: 2009-08-11 05:35:18 |
| hw5_soln.ps Path: UMBC >> CS >> 461 Fall, 2009 Description: %!PS-Adobe-2.0 %Creator: dvips 5.47 Copyright 1986-91 Radical Eye Software %Title: hw5_soln.dvi %Pages: 3 1 %BoundingBox: 0 0 612 792 %EndComments %BeginProcSet: tex.pro /TeXDict 200 dict def TeXDict begin /N /def load def /B{bind def}N /S /exch load... Date Added: 2009-08-11 05:38:59 |
| Lec12a.ppt Path: Washington University in St. Louis >> ENVE >> 424 Fall, 2009 Description: vti_encoding:SR|utf8-nl vti_timelastmodified:TR|13 Mar 2003 21:56:55 -0000 vti_extenderversion:SR|5.0.2.6790 vti_author:SR|CAPITA\\Administrator vti_modifiedby:SR|CAPITA\\Administrator vti_timecreated:TR|13 Mar 2003 21:56:55 -0000 vti_title:SR|Slide 1 ... Date Added: 2009-08-11 05:39:21 |
| bottom-up.pdf Path: Washington >> CS >> 401 Fall, 2009 Description: ... Date Added: 2009-08-11 05:40:37 |
| a8sol.pdf Path: UWO >> SS >> 260 Fall, 2009 Description: ... Date Added: 2009-08-11 05:41:21 |
| Lect14.pdf Path: Washington >> CS >> 373 Fall, 2009 Description: CSE 373 Lecture 14: Midterm Review Today\'s Topics: Wrap-up of hashing Review of topics for midterm exam Midterm details: Chapters 1-6 in the textbook Closed book, closed notes Format: 5 questions, 100 points total Time: Monday, class time 11:... Date Added: 2009-08-11 05:41:37 |
| lecture21.ppt Path: Washington >> CS >> 373 Fall, 2009 Description: Minimum Spanning Trees CSE 373 Data Structures Lecture 21 Recall Spanning Tree Given (connected) G(V,E) a spanning tree T(V\',E\'): > Spans the graph (V\' = V) > Forms a tree (no cycle); E\' has |V| -1 edges 3/10/03 Min. Spanning tree - Lecture 20 2... Date Added: 2009-08-11 05:42:44 |
| hw3.pdf Path: Washington >> CS >> 373 Fall, 2009 Description: CSE 373 Winter 2003 Data Structures and Algorithms Assignment #3 Due: Friday February 7 1. (5 points) Weiss Problem 4.4 (\"Show\" means \"Prove by induction\"). 2. (15 points) Weiss Problem 4.9. In part (a) show the tree after each insertion. After per... Date Added: 2009-08-11 05:43:12 |
| fig3.9.txt Path: Washington >> CS >> 373 Fall, 2009 Description: * fig3.9 * int is_last( position p, LIST L ) /* p is assumed not NULL */ { return( p->next = NULL ); } ... Date Added: 2009-08-11 05:43:29 |
| audience.pdf Path: Cal Poly >> ENGL >> 149 Fall, 2009 Description: PART ONE Getting Ready Chapter 2 Audience and Persuasion Chapter 3 Collaboration Chapter 4 Planning 33 53 79 Chapter 5 Gathering Information Chapter 6 Organizing and Managing Information 171 110 2 Audience and Persuasion Audience and Technica... Date Added: 2009-08-11 05:46:15 |
| YehTeMing_Characters_CognitivePsychology_YehTehming.doc Path: S.F. State >> ONLINE >> 825 Fall, 2008 Description: ... Date Added: 2009-08-11 05:46:24 |
| 8WeeklyEmployeeCollection.doc Path: Arizona >> CS >> 127 Fall, 2008 Description: vti_encoding:SR|utf8-nl vti_timelastmodified:TR|13 Nov 2008 00:02:38 -0000 vti_title:SR| vti_assignedto:SR| vti_author:SR|mercer vti_syncwith_localhost\\w\\:/w\\:TR|13 Nov 2008 00:02:38 -0000 vti_syncwith_localhost\\s\\:/s\\:TR|13 Nov 2008 00:02:38 -0000 v... Date Added: 2009-08-11 05:47:44 |
| hptmbom.txt Path: Grand Valley State >> EGR >> 486 Fall, 2008 Description: BOM = 3\" C-beam, 142\" total length 1.5\" L-beam, 16\" (1) 2\" casters (4) Spacers for casters, 2\"x2.5\"x3/8\", aluminum (4) Mounting plate, 15\"x6.5\"x1/4\", steel (1) Mounting plate handle, 24\"x1\"x1/4\", steel (1) Wiring cabinet, 14\"x18\"x8\" (1) Controls mou... Date Added: 2009-08-11 05:50:08 |
| YKR042W.t2k.dssp-ebghstl-logo.pdf Path: UCSC >> YKR >> 042 Fall, 2009 Description: YKR042W.t2k EBGHSTL 3 2 1 C X 1 10 20 30 40 E 3 2 1 H T S E H H T E H HHHHHHHHHH X X X 51 60 70 80 90 T E 3 2 1 T C H C C H T T H C E TTCTCTCC C C C C S C T C S T S C S HHCC T H H SESSCC H G H S S H S H XXXXXXXX X X X X S H T... Date Added: 2009-08-11 05:53:07 |
| ep4.pdf Path: CSU San Marcos >> MATH >> 210 Fall, 2009 Description: ... Date Added: 2009-08-11 05:55:08 |
| Aquarium.txt Path: Washington >> CS >> 341 Fall, 2009 Description: module Aquarium where octopus = 8 squid n = 2*n ... Date Added: 2009-08-11 05:57:12 |
| Ethics.ppt Path: Washington >> CS >> 341 Fall, 2009 Description: Social and Ethical Issues in Programming Language Design Safety: Can harm be done by designers of programming languages? Support for system safety in P.L. Security policies. Literacy: Who gets to program? Should languages be easy to learn or ... Date Added: 2009-08-11 05:57:29 |
| ps5_soln.pdf Path: Colorado >> PHYS >> 3220 Fall, 2008 Description: ... Date Added: 2009-08-11 05:58:31 |
| ln17.pdf Path: Colorado >> PHYS >> 3220 Fall, 2008 Description: ... Date Added: 2009-08-11 05:58:36 |
| tra-n28.pdf Path: Delaware >> HLY >> 0303 Fall, 2009 Description: n28 8 6 4 2 0 0 8 6 4 2 0 0 -100 -200 -300 -400 E -30 -20 -10 0 0 10 20 30 0 -100 -200 -300 -400 0 4 8 12162024283236404448 0 4 8 12162024283236404448 -30 -20 -10 0 N 10 20 30 Vs (m/s) Depth (m) -100 -200 -300 -400 Depth (m) -100 -200 -300 -400 ... Date Added: 2009-08-11 06:05:59 |
| final.ps Path: UF >> PHZ >> 7427 Spring, 2008 Description: %!PS-Adobe-2.0 %Creator: dvips(k) 5.78 Copyright 1998 Radical Eye Software (www.radicaleye.com) %Title: final.dvi %Pages: 2 %PageOrder: Ascend %BoundingBox: 0 0 612 792 %DocumentFonts: CMBX12 CMR12 CMMI12 CMBX8 CMR8 CMSY10 CMEX10 CMMI8 %+ CMSY6 CMSY8... Date Added: 2009-08-11 06:10:27 |
| lecture02.ppt Path: Washington >> CS >> 544 Fall, 2009 Description: Lecture 2: E/R Diagrams and the Relational Model Thursday, January 4, 2001 Outline E/R Diagrams: 2.4 (except 2.4.2, 2.4.5), 2.5 (except 2.5.4) The Relational Model: 3.1, 3.2, 3.3 E/R to Relational: 3.5 Entity / Relationship Diagrams in Summary E... Date Added: 2009-08-11 06:11:13 |
| li.txt Path: Washington >> CS >> 544 Fall, 2009 Description: DBmacs: editor for SQL dummies Li Yan 0150254 CSE 544 Motivation: Database is an excellent tool in organizing and query large volumes of data. SQL is the stardard query language for database, but it is not necessarily the favorite of every user. ... Date Added: 2009-08-11 06:11:24 |
| paragraphexercise1.doc Path: Humboldt State University >> ENGLISH >> 100 Fall, 2009 Description: Answer, in writing, the following questions for each paragraph of the following excerpt: 1. What appears to be the focus of the paragraph? To what extent does the paragraph stick to that focus? How clear is the focus to the reader? How can it be made... Date Added: 2009-08-11 06:15:23 |
| midterm.ps Path: Washington >> CS >> 431 Fall, 2009 Description: %!PS-Adobe-2.0 %Creator: dvipsk 5.58f Copyright 1986, 1994 Radical Eye Software %Title: midterm.dvi %Pages: 5 %PageOrder: Ascend %BoundingBox: 0 0 612 792 %EndComments %DVIPSCommandLine: dvips midterm.dvi -o %DVIPSParameters: dpi=600, comments remove... Date Added: 2009-08-11 06:29:18 |
| lists.pdf Path: Washington >> CS >> 326 Fall, 2009 Description: Pointers and Lists CSE 326 Data Structures Unit 2 Reading: Section 3.2 The List ADT Basic Types and Arrays Basic Types > integer, real (floating point), boolean (0,1), character Arrays > A[0.99] : integer array 0 1 2 3 4 5 6 7 99 A A[5] . 2 R... Date Added: 2009-08-11 06:30:35 |
| lecture09b.ppt Path: Washington >> CS >> 326 Fall, 2009 Description: CSE 326: Data Structures Priority Queues (Heaps) Lecture 9: Monday, Jan 27, 2003 1 Not Quite Queues Consider applications ordering CPU jobs searching for the exit in a maze emergency room admission processing Problems? short jobs should go f... Date Added: 2009-08-11 06:30:55 |
| lecture2-complexityI.ppt Path: Washington >> LECTURE >> 326 Winter, 2009 Description: CSE 326: Data Structures Lecture #2 Analysis of Algorithms I (And A Little More About Linked Lists) Henry Kautz Winter 2002 Assignment #1 Goals of this assignment: Introduce the ADTs (abstract data types) for lists and sparse vectors, motivated by... Date Added: 2009-08-11 06:31:20 |
| lecture13-heaps1.pdf Path: Washington >> LECTURE >> 326 Winter, 2009 Description: Not Quite Queues CSE 326: Data Structures Lecture #13 Priority Queues and Binary Heaps Nick Deibel Winter Quarter 2002 Consider applications ordering CPU jobs searching for the exit in a maze emergency room admission processing Problems? short... Date Added: 2009-08-11 06:31:23 |
| lecture08.ps Path: Washington >> CS >> 326 Fall, 2009 Description: %!PS-Adobe-3.0 %BoundingBox: (atend) %Pages: (atend) %PageOrder: (atend) %DocumentFonts: (atend) %Creator: Frame 4.0 %DocumentData: Clean7Bit %EndComments %BeginProlog % % Frame ps_prolog 4.0, for use with Frame 4.0 products % This ps_prolog file is ... Date Added: 2009-08-11 06:31:31 |
| mt.ps Path: Washington >> CS >> 521 Fall, 2009 Description: %!PS-Adobe-2.0 %Creator: dvipsk 5.58f Copyright 1986, 1994 Radical Eye Software %Title: mt.dvi %Pages: 5 %PageOrder: Ascend %BoundingBox: 0 0 612 792 %EndComments %DVIPSCommandLine: dvips -o mt.ps mt.dvi %DVIPSParameters: dpi=600, comments removed %D... Date Added: 2009-08-11 06:34:21 |
| bohratom.pdf Path: UF >> PHY >> 1033 Fall, 2009 Description: PHY1033CFall 2002 Peter J Hirschfeld Notes Lecture on Intro to Quantum Mechanics Quantum Mechanics Viewed Episodes 49-51 of Mechanical Universe Film Series on Quantum Mechanics, Atoms and Elementary Particles If you have trouble following the deriv... Date Added: 2009-08-11 06:34:49 |
| Handbooks.doc Path: Valdosta >> MLIS >> 7100 Fall, 2008 Description: Angela Henderson MLIS 7100 Dr. Green 6/10/2009 Source Evaluations - Handbooks Title: Occupational Outlook Handbook, 2000-20001 Ed. Format (print/microform/electronic, physical makeup, illustrations): Print, 554 pages. Oversize (11 inches by 8.5 inche... Date Added: 2009-08-11 06:47:55 |
| topic10.pdf Path: SMU - Cox School of Business >> ENGR >> 8361 Fall, 2009 Description: Helgason EMIS 8361 Spring 2006[Topic 10] 1 Helgason EMIS 8361 Spring 2006[Topic 10] 2 Incorporating Inflation Constant Dollar Computations Many commodities go up in price with the passage of time. The observed effect is called inflation. An equ... Date Added: 2009-08-11 06:55:09 |
| lll12.ps Path: Duke >> X >> 100 Fall, 2009 Description: %!PS-Adobe-3.0 %Title: (Microsoft PowerPoint - l12.ppt) %Version: 1 1 %CreationDate: 09:54:06 AM 10/13/2005 %For: (Administrator) %DocumentData: Clean7Bit %LanguageLevel: 2 %BoundingBox: 0 0 792 612 %HiResBoundingBox: 0.0 0.0 792.0 612.0 %Pages: 12 %... Date Added: 2009-08-11 07:08:06 |
| HW_8_sol_corrected.pdf Path: Lake County >> ECE >> 476 Fall, 2009 Description: ... Date Added: 2009-08-11 07:22:15 |
| Ex7.ps Path: University of Toronto >> MATH >> 0102 Fall, 2009 Description: %!PS-Adobe-2.0 %Creator: dvips(k) 5.86 Copyright 1999 Radical Eye Software %Title: Ex7.dvi %Pages: 2 %PageOrder: Ascend %BoundingBox: 0 0 596 842 %EndComments %DVIPSWebPage: (www.radicaleye.com) %DVIPSCommandLine: dvips Ex7.dvi -o Ex7.ps %DVIPSParame... Date Added: 2009-08-11 07:35:34 |
| clase3.ppt Path: UPR Mayagüez >> ICOM >> 4015 Fall, 2009 Description: vti_encoding:SR|utf8-nl vti_timelastmodified:TR|06 Feb 2001 19:29:54 -0000 vti_extenderversion:SR|4.0.2.4426 vti_backlinkinfo:VX|courses/spring2001/icom4015/icom4015.htm vti_cacheddtm:TX|06 Feb 2001 19:29:54 -0000 vti_filesize:IR|58368 vti_cachedlink... Date Added: 2009-08-11 07:37:37 |
| AngiospermCycle.pdf Path: Bellevue College >> BIOLOGY >> 213 Fall, 2009 Description: Angiosperm Life History ... Date Added: 2009-08-11 07:44:24 |
| 45.pdf Path: SUNY Stony Brook >> MATH >> 112 Fall, 2009 Description: Calculus Solutions: Chapter 4.5 Aaron Peterson, Stephen Taylor November 10, 2006 2. Repeat example 72 for a square sheet of cardboard s inches on a side. Solution: We have V = (s - 2x)2 x = xs2 - 4x2 s + 4x3 So V = s2 - 8sx + 12x2 = 0 x = So s 6 s ... Date Added: 2009-08-11 08:07:06 |
| jdb_1418.pdf Path: UNC Charlotte >> CE >> 1202 Fall, 2009 Description: ENGR 1202 Introduction to Civil Engineering Fall 2007 Quiz 2 September 26, 2007 Quiz Format and Instructions 2 problems on 2 pages, 100 points total open book and notes you must show all work to receive any partial credit for incorrect answers ... Date Added: 2009-08-11 08:12:45 |
| p828ps7sol.pdf Path: National Taiwan University >> P >> 828 Fall, 2009 Description: ... Date Added: 2009-08-11 08:15:01 |
| Base02av44final_CASTNET_Statistics.txt Path: UC Riverside >> MAR >> 308 Fall, 2009 Description: AllSite_AllDay HNO3g SO2g P_NH4 P_SO4 P_NO3 Total_NO3 P_mNO3_mSO4 P_NH4_ratio P_NO3_ratio Fraction_Bias(%) 17.29503 29.486... Date Added: 2009-08-11 08:31:26 |
| catinfo.txt Path: Washington University in St. Louis >> MEXMRS >> 0008 Fall, 2009 Description: PDS_VERSION_ID = PDS3 RECORD_TYPE = STREAM OBJECT = TEXT PUBLICATION_DATE = 2006-02-16 NOTE ... Date Added: 2009-08-11 08:36:30 |
| 14-Hatem-Anvik-icse06.pdf Path: W. Alabama >> PLG >> 846 Fall, 2009 Description: Who Should Fix This Bug? Authors Anvik, Hiew, Murphy Presented By Hatem A. Mahmoud Agenda Problem Definition Objective Background Bug Assignment as a ML Problem Design Decisions Performance Evaluation Applicability Extensions & Alternatives... Date Added: 2009-08-11 08:50:26 |
| Lecture17Notes.pdf Path: Rochester >> LECTURE >> 102 Fall, 2009 Description: Astronomy 102. November 3, 2005. NGC 2442 Frank L. H. Wolfs Department of Physics and Astronomy, University of Rochester Distinctive features that can indicate the presence of a black hole. Observe two or more of these features to nd a black hole:... Date Added: 2009-08-11 09:04:16 |
| ex0354.txt Path: Hudson VCC >> STAT >> 141 Fall, 2009 Description: \'Number\' 25 16 9 47 42 18 35 29 14 70 16 20 0 13 43 6 27 20 29 0 26 17 30 11 30 11 30 12 18 17 29 10 45 10 35 7 16 26 27 40 5 28 21 5 61 15 13 30 18 18 12 26 18 67 17 37 11 31 21 17 35 12 0 35 11 8 46 48 ... Date Added: 2009-08-11 09:12:51 |
| 137Apracticefinalsolutions.pdf Path: Berkeley >> P >> 137 Fall, 2009 Description: ... Date Added: 2009-08-11 09:21:53 |
| ch4_8_6.pdf Path: Colorado >> AMATH >> 4560 Fall, 2008 Description: ... Date Added: 2009-08-11 09:44:14 |
| catinfo.txt Path: Washington University in St. Louis >> MEXMRS >> 0009 Fall, 2009 Description: PDS_VERSION_ID = PDS3 RECORD_TYPE = STREAM OBJECT = TEXT PUBLICATION_DATE = 2006-02-16 NOTE ... Date Added: 2009-08-11 09:48:55 |
| rt-lan5.ppt Path: Iowa State >> CPRE >> 558 Fall, 2009 Description: CprE 458/558: Real-Time Systems Switched LAN (SLAN) CprE 458/558: Real-Time Systems (G. Manimaran) 1 Switched LAN topology Swi tch L AN 1 L AN 2 Nodes L AN \"k\" CprE 458/558: Real-Time Systems (G. Manimaran) 2 Message transmission in SLAN ... Date Added: 2009-08-11 09:51:29 |
| rts-ft2.ppt Path: Iowa State >> CPRE >> 558 Fall, 2009 Description: CprE 458/558: RealTime Systems Lecture 17 Faulttolerant design techniques CprE 458/558 G. Manimaran (ISU) Fault Tolerant Strategies Fault tolerance in computer system is achieved through redundancy in hardware, software, information, and/or ... Date Added: 2009-08-11 09:51:31 |
| 118pracmt2asolns.pdf Path: Agnes Scott >> MAT >> 118 Fall, 2009 Description: 1. 2. 3. 4. 5. Math 118 Practice 2nd Midterm Solutions What are the maximum and minimum values of the function f (x) = x3 - 3x + 1 on the interval [0, 3], and where do they occur? Check endpoints and critical points. f (x) = 3x2 - 3, which exist... Date Added: 2009-08-11 09:51:49 |
| SonicWALL Manual.pdf Path: U. Houston >> ISAM >> 5439 Fall, 2009 Description: SONICWALL Internet Security Appliances CONTENTS Organization of This Guide . 5 1 INTRODUCTION . 7 SonicWALL Internet Security Appliance Features .. 9 SONICWALL INSTALLATION . 12 Connecting the SonicWALL to the Network . 13 Performing the Initial Co... Date Added: 2009-08-11 10:11:00 |
| inclass3.pdf Path: Duke >> X >> 102 Fall, 2009 Description: CompSci 102 Discrete Mathematics for CS Spring 2005 Forbes In-class Questions 3 These questions will also serve as warmup for recitation 5 1. For the following sequence: 1, 3, 7, 13, 21, 31, 43 (a) What is the next value? (b) What is the recursion ... Date Added: 2009-08-11 10:14:18 |
| inclass7.pdf Path: Duke >> X >> 102 Fall, 2009 Description: CompSci 102 Discrete Mathematics for CS Spring 2005 Forbes In-class Questions 7 1. 5-card Poker questions: What are the probabilities of? (a) A hand with at least one ace (b) A straight (e.g {4, 5, 6, 7, 8}, mixed suits) (c) One pair (d) Full house... Date Added: 2009-08-11 10:14:19 |
| IS213_SIMSCorpus_Assignment2_InterviewTemplate.doc Path: Berkeley >> IS >> 213 Spring, 1999 Description: SIMS CORPUS IS213 ASSIGMENT #2 Due Date: Tuesday, February 17 I. INTERVIEW TEMPLATE INFORMATION USE 1) What aspects of the Academic section of the SIMS website do you use if any? a) 2) Are there other academic resources you use? a) 3) When do you us... Date Added: 2009-08-11 10:20:09 |
| Scope.pdf Path: Toledo >> CSC >> 148 Fall, 2009 Description: free variable namespace binding name scope name resolution bound variable Whats the output? shoe_size = 13 def print_instructor(first_name): print first_name, shoe_size def setup_instructor(): shoe_size = 8.5 print_instructor(\"Paul\") setup_instruct... Date Added: 2009-08-11 10:26:08 |
| figureSO_33.html.doc Path: Ill. Chicago >> CHEM >> 524 Fall, 2008 Description: ... Date Added: 2009-08-11 10:29:35 |
| CS855-Models.ps Path: UWO >> CS >> 855 Fall, 2009 Description: %!PS-Adobe-2.0 %Creator: dvips(k) 5.95a Copyright 2005 Radical Eye Software %Title: CS855-Models.dvi %Pages: 22 %PageOrder: Ascend %Orientation: Landscape %BoundingBox: 0 0 612 792 %DocumentFonts: CMBX12 CMBX10 CMR7 CMR10 CMSY10 CMTI9 CMR9 CMSY9 CMTT... Date Added: 2009-08-11 10:45:02 |
| robock_2008.pdf Path: Colorado State >> EV >> 128 Fall, 2009 Description: Vol. 64, No. 2, p. 14-18, 59 DOI: 10.2968/064002006 20 reasons why geoengineering may be a bad idea Carbon dioxide emissions are rising so fast that some scientists are seriously considering putting Earth on life support as a last resort. But is thi... Date Added: 2009-08-11 10:50:12 |
| word26.txt Path: CSU Fullerton >> BTP >> 200 Fall, 2009 Description: 26. Given the following class: class person { char name[41]; char relation[41]; public: person() { name[0] = relation[0] = \'\\'; } person(const char s1[], const char s2[]) { strcpy(name, s1); strcpy(relation, s2); }... Date Added: 2009-08-11 10:52:13 |
| lab02.desc.pdf Path: Purdue >> MA >> 366 Fall, 2008 Description: LAB #2 Escape Velocity Goal: Determine the initial velocity an object is shot upward from the surface of the earth so as to never return; illustrate scaling variables to simplify differential equations. Required tools: dfield and pplane ; second orde... Date Added: 2009-08-11 10:58:06 |
| rpd_h h2.pdf Path: NYU >> P >> 150 Fall, 2009 Description: Reactant-product decoupling method for state-to-state reactive scattering: A case study for 3D H H2 exchange reaction ( J 0) Wei Zhu, Tong Peng, and John Z. H. Zhang Department of Chemistry, New York University, New York, New York 10003 Received 30 ... Date Added: 2009-08-11 11:01:10 |
| hacking.ppt Path: Santa Clara >> COEN >> 252 Fall, 2009 Description: COEN252 SecurityThreats NetworkBasedExploits PhasesofanAttack Reconnaissance Scanning GainingAccess ExpandingAccess CoveringTracks Reconnaissance SocialEngineering Icannotaccessmyemail.WhatdoIdo? DumpsterDiving(especiallyusefulwhe... Date Added: 2009-08-11 11:25:53 |
| 07.pdf Path: Sanford-Brown Institute >> CSCI >> 2500 Fall, 2009 Description: Algorithms for Planar Graphs Lecture 7: Dynamic-tree data structure Philip N. Klein February 12, 2009 1 1.1 Dynamic trees Review Recall: to choose a representation of a rooted tree, we designate some edges as solid and some as dashed, with the pro... Date Added: 2009-08-11 11:28:22 |
| loglog_3x2.pdf Path: Virginia Tech >> PHYS >> 3504 Fall, 2008 Description: 1 9 8 7 6 5 4 3 2 1 9 8 7 6 5 4 3 2 1 9 8 7 6 5 4 3 2 1 1 2 3 4 5 6 7 891 2 3 4 5 6 7 891 ... Date Added: 2009-08-11 11:33:26 |
| hwk8soln.pdf Path: SMU - Cox School of Business >> ENGR >> 8371 Fall, 2009 Description: EXERCISE 2-3-2 who Your variables are: A A A = 0 4 1 1 3 6 3 2 6 T = totbl(A); x1 x2 x3 -y1 = | 0.0000 1.0000 3.0000 y2 = | 4.0000 3.0000 2.0000 y3 = | 1.0000 6.0000 6.0000 T = ljx(T,3,1); y3 x2 x3 --y1 = | 0.0000 1.0000 3.0000 y2 = | 4.0000 -21.000... Date Added: 2009-08-11 11:36:05 |
| hwk4soln.pdf Path: SMU - Cox School of Business >> ENGR >> 8371 Fall, 2009 Description: EXERCISE 2-3-2 who Your variables are: A A A = 0 4 1 1 3 6 3 2 6 T = totbl(A); x1 x2 x3 -y1 = | 0.0000 1.0000 3.0000 y2 = | 4.0000 3.0000 2.0000 y3 = | 1.0000 6.0000 6.0000 T = ljx(T,3,1); y3 x2 x3 --y1 = | 0.0000 1.0000 3.0000 y2 = | 4.0000 -21.000... Date Added: 2009-08-11 11:36:05 |
| HP_AppA.pdf Path: Virginia Tech >> CS >> 2504 Spring, 2006 Description: A A P P E N D I X Assemblers, Linkers, and the SPIM Simulator James R. Larus Microsoft Research Microsoft Fear of serious injury cannot alone justify suppression of free speech and assembly. Louis Brandeis Whitney v. California, 1927 A.1 A.2 A.3 A... Date Added: 2009-08-11 11:37:42 |
| XML05_II.ppt Path: North Texas >> CS >> 4350 Fall, 2009 Description: XMLII XSchema XQuery Oracle XSU XML Schema XML Schema is a more sophisticated schema language which addresses the drawbacks of DTDs. Supports Typing of values E.g. integer, string, etc Also, constraints on min/max values Userdefined... Date Added: 2009-08-11 11:41:34 |
| AS11_Directives.txt Path: UF >> EEL >> 3701 Fall, 2009 Description: AS11 Assembler Directives * Assembly Control ORG Origin program counter Symbol Definition EQU Assign permanent value Data Definition/Storage Allocation BSZ Block storage of zero; single bytes FCB Form constant byte FCC Form constant chara... Date Added: 2009-08-11 11:46:21 |
| l28.ppt Path: Duke >> X >> 100 Fall, 2009 Description: Other N log N Sorts Binary Tree Sort Basic Recipe o Insert into binary search tree (BST) o Do Inorder Traversal Complexity o Create: O(N log N) o Traversal O(N) Not usually used for sorting unless you need BST for other reasons CompSci 100E... Date Added: 2009-08-11 11:51:03 |
| testseq1c.txt Path: UConn >> MCB >> 396 Spring, 2008 Description: > Sulfolobus acidocaldarius gi|152927|gp|J03218|SSOATPMA_1 MVSEGRVVRVNGPLVIADGMREAQMFEVVYVSDLKLVGEITRIE GDRAFIQVYESTDGVKPGDKVYRSGAPLSVELGPGLIGKIYDGLQRPLDSIAKVSNSP FVARGVSIPALDRQTKWHFVPKVKSGDKVGPGDIIGVVQETDLIEHRILIPPNVHGTL KELAREGDYTVEDVVAVVDMNGDEIPV... Date Added: 2009-08-11 11:55:38 |
| grades.pdf Path: UNI >> CNS >> 062 Fall, 2009 Description: A 7 V 3 2 3 C! # ) U GP T A C\" \" # ! A A \' B 4 H C\" # C( $ # ! ( C( # ! ! C\" # # # # # # ! ) ! \" # # C\" C) # \" # ( C\" # # $ ! ! C $ ( # C( # ( C) # ) # $ # C) C) # # # C) C) # # \" ! $ $ ) ) ! ! C\" C\" C\" C\" C\"... Date Added: 2009-08-11 12:00:49 |
| s25.ppt Path: UNI >> CNS >> 051 Fall, 2009 Description: Splicing together sounds Bill Richardson \"Well obviously Sandy\'s admitted to a mistake in that process, but I\'ve known him for 20 years. The guy is honorable. He\'s a dedicated public servant. I\'m sure it was a careless, sloppy moment. An investigati... Date Added: 2009-08-11 12:01:07 |
| 161InvFnctsW01.pdf Path: N. Michigan >> MA >> 161 Fall, 2008 Description: Inverse Functions Two functions are inverses of one-another iff each undoes what the other does. Example 1. f(x) = x/3 and g(x) = 3x. We have, for example, f(12) = 4 and g(4) = 12. Also we have g(7) = 21 and f(21) = 7. In general, f(r) = r/3 and g(r/... Date Added: 2009-08-11 12:05:54 |
| rfc3682.txt Path: Allan Hancock College >> RFC >> 3500 Fall, 2009 Description: Network Working Group V. Gill Request for Comments: 3682 J. Heasley Category: Experimental D. Meyer ... Date Added: 2009-08-11 12:07:55 |
| rfc3697.txt Path: Allan Hancock College >> RFC >> 3500 Fall, 2009 Description: Network Working Group J. Rajahalme Request for Comments: 3697 Nokia Category: Standards Track A. Conta ... Date Added: 2009-08-11 12:07:57 |
| rfc843.txt Path: Allan Hancock College >> RFC >> 0500 Fall, 2009 Description: Network Working Group D. Smallberg Request for Comments: 843 February 1983 Who Talks TCP? - Survey of 8 February 1983 The list of hosts was taken from the NIC hostname table of 3-... Date Added: 2009-08-11 12:08:56 |
| rfc3021.txt Path: Allan Hancock College >> RFC >> 3000 Fall, 2009 Description: Network Working Group A. Retana Request for Comments: 3021 R. White Category: Standards Track Cisco Systems ... Date Added: 2009-08-11 12:09:22 |
| rfc3204.txt Path: Allan Hancock College >> RFC >> 3000 Fall, 2009 Description: Network Working Group E. Zimmerer Request for Comments: 3204 Rankom, Inc. Category: Standards Track J. Peterson ... Date Added: 2009-08-11 12:09:35 |
| rfc1093.txt Path: Allan Hancock College >> RFC >> 1000 Fall, 2009 Description: Network Working Group H.W. Braun Request for Comments: 1093 Merit February 1989 The... Date Added: 2009-08-11 12:11:33 |
| rfc1278.txt Path: Allan Hancock College >> RFC >> 1000 Fall, 2009 Description: Network Working Group S.E. Hardcastle-Kille Requests for Comments 1278 University College London November 1991 A string... Date Added: 2009-08-11 12:12:03 |
| rfc2528.txt Path: Allan Hancock College >> RFC >> 2500 Fall, 2009 Description: Network Working Group R. Housley Request for Comments: 2528 SPYRUS Category: Informational W. Polk ... Date Added: 2009-08-11 12:12:31 |
| rfc2799.txt Path: Allan Hancock College >> RFC >> 2500 Fall, 2009 Description: Network Working Group S. Ginoza Request for Comments: 2799 ISI Category: Informational September 2000 R... Date Added: 2009-08-11 12:13:08 |
| rfc2828.txt Path: Allan Hancock College >> RFC >> 2500 Fall, 2009 Description: Network Working Group R. Shirey Request for Comments: 2828 GTE / BBN Technologies FYI: 36 May 2000 Category: Informational ... Date Added: 2009-08-11 12:13:13 |
| rfc1792.txt Path: Allan Hancock College >> RFC >> 1500 Fall, 2009 Description: Network Working Group T. Sung Request for Comments: 1792 Novell, Inc. Category: Experimental April 1995 TCP/I... Date Added: 2009-08-11 12:14:44 |
| rfc1955.txt Path: Allan Hancock College >> RFC >> 1500 Fall, 2009 Description: Network Working Group R. Hinden Request for Comments: 1955 Ipsilon Networks, Inc. Category: Informational June 1996 New Scheme for Inte... Date Added: 2009-08-11 12:15:11 |
| inforum99.ppt Path: University of Louisiana at Lafayette >> CS >> 561 Fall, 2009 Description: Enhancing Internet Search Engines to Achieve Conceptbased Retrieval F. Lu, T. Johnsten, V. Raghavan, and D. Traylor InForum `99 May 5 -6, 1999 Agenda Information on the Internet. Boolean Retrieval Model and the Internet. Concept-Based Retrieval... Date Added: 2009-08-11 12:21:37 |
| page083.pdf Path: ECCD >> FTP >> 315 Fall, 2009 Description: 97.315 Course Notes Page 83 Winter 2001 4.10 The Biot-Savart Law When the current is contained by thin wires, we can use the vector potential to derive an integral from which the B field can be found directly from the wire locations and currents.... Date Added: 2009-08-11 12:27:54 |
| Horizon_Review.pdf Path: Oakland University >> CSE >> 498 Fall, 2009 Description: Folding@Home and Genome@Home: Using distributed computing to tackle previously intractable problems in computational biology Stefan M. Larson1,2, Christopher D. Snow1,2, Michael Shirts1, and Vijay S. Pande1,2,* 1 Chemistry Department and 2Biophysi... Date Added: 2009-08-11 12:34:48 |
| exercises.pdf Path: Washington >> CSE >> 341 Fall, 2008 Description: CSE 341 - Java Generics Discussion Questions 1. Consider the following Java code fragments. (The first 3 lines are the same for all of them; it\'s just the last line that is different.) In each case, does the code compile correctly? If so, does it exe... Date Added: 2009-08-11 13:07:06 |
| Ethics.ppt Path: Washington >> CSE >> 341 Fall, 2008 Description: Social and Ethical Issues in Programming Language Design Safety: Can harm be done by designers of programming languages? Support for system safety in P.L. Security policies. Literacy: Who gets to program? Should languages be easy to learn or ... Date Added: 2009-08-11 13:10:06 |
| Aquarium.txt Path: Washington >> CSE >> 341 Fall, 2008 Description: module Aquarium where octopus = 8 squid n = 2*n ... Date Added: 2009-08-11 13:10:25 |
| assignment03.pdf Path: Toledo >> ASSIGNMENT >> 1301 Fall, 2009 Description: AER1301: KINETIC THEORY OF GASES Assignment #3 1. (Problem 5.1 of Textbook) Show that the Boltzmann equation is invariant for all Galilean transformations.1 2. (Modified versions of Problems 5.4, 6.1, and 6.2 of Textbook) (a) Consider a stationary i... Date Added: 2009-08-11 13:22:49 |
| helpsession.ppt Path: Sanford-Brown Institute >> CS >> 169 Fall, 2009 Description: CS167: TermIO Lab TermIO Help Session Synchronization Primitives TermIO Layer for handling terminal I/O Get raw mode input from the system and write functions to handle such input and present output Initially all the input you get is raw, ... Date Added: 2009-08-11 13:28:45 |
| b10759.pdf Path: USC >> CSCI >> 585 Fall, 2008 Description: Oracle Database SQL Reference 10g Release 1 (10.1) Part No. B10759-01 December 2003 Oracle Database SQL Reference 10g Release 1 (10.1) Part No. B10759-01 Copyright 1996, 2003 Oracle Corporation. All rights reserved. Primary Authors: Diana Lorentz,... Date Added: 2009-08-11 13:29:45 |
| SoP_registration_small.pdf Path: Pittsburgh >> RX >> 20051019 Fall, 2009 Description: SP O f r tairclimb hilanthropy 2005 Thank-you for participating! The suggested donation of $3.00 to $5.00 will be forwarded to the Red Cross for the Flood Victims both locally and nationally. Your entry also entitles you to: A healthier lifestyle... Date Added: 2009-08-11 13:59:53 |
| blackhole_accretion.ps Path: UNLV >> ASTRO >> 025 Fall, 2009 Description: %!PS-Adobe-2.0 %Title: blackhole_accretion.ps %Creator: fig2dev Version 3.2 Patchlevel 3d %CreationDate: Sat Jan 22 14:37:32 2005 %For: zzdjeffe@occ (jeffery david) %Orientation: Portrait %Pages: 1 %BoundingBox: 0 0 612 792 %BeginSetup %IncludeFeatur... Date Added: 2009-08-11 14:09:03 |
| main6.txt Path: UMBC >> CMSC >> 202 Spring, 1999 Description: everest% CC main6.C bstring2.C main6.C: bstring2.C: everest% everest% a.out Tiny Tim age=6 Jane Doe age=27 John Smith age=30 Bugs Bunny age=36 Groucho Marx age=40 Student: Tiny Tim age=6 year=0 gpa=3 Student: Jane Doe age=27 year=2 gpa=3.4 Student... Date Added: 2009-08-11 14:19:05 |
| main3.txt Path: UMBC >> CMSC >> 202 Spring, 1999 Description: everest% CC main3.C bstring2.C main3.C: \"main3.C\", line 22: error(1515): a value of type \"Student *\" cannot be assigned to an entity of type \"Person *\" ptrptr = ^ \"main3.C\", line 23: error(1515): a value of type \"F... Date Added: 2009-08-11 14:19:07 |
| lin.pdf Path: Colgate >> MATH >> 102 Fall, 2009 Description: Jon Lin In order to succeed academically in college, it is believed that the student who has the best time management comes out on top. This means that if a student can budget his time in various areas then he will achieve his academic goal. Time man... Date Added: 2009-08-11 14:23:18 |
| concepts.txt Path: W. Alabama >> ECE >> 327 Fall, 2009 Description: +- | Lec-10 +- +- | Outline - handouts today - Lec-10 - announcements - Terrible Tuesday Technical Turmoils continued, we\'re trying to schedule a time in MC-1085 - Midterm review next wed in class -... Date Added: 2009-08-11 14:25:45 |
| view1.ps Path: Bowdoin >> CS >> 340 Spring, 2009 Description: %!PS-Adobe-3.0 %BoundingBox: 24 24 588 768 %Title: Enscript Output %For: Laura Toma %Creator: GNU enscript 1.6.1 %CreationDate: Wed Feb 16 14:12:38 2005 %Orientation: Landscape %Pages: (atend) %DocumentMedia: Letter 612 792 0 () () %DocumentNeededRes... Date Added: 2009-08-11 14:29:30 |
| syllabusS03.pdf Path: Ill. Chicago >> IPD >> 0304 Fall, 2009 Description: UIC Interdisciplinary Product Development (IPD) Stephen Melamed/Albert L. Page/Michael J. Scott Course Syllabus - Spring AD420/ME396/MKTG594 2002-03 The second semester of the Interdisciplinary Product Development course the student teams work to d... Date Added: 2009-08-11 14:32:51 |
| 277.txt Path: Fanshawe >> FILES >> 277 Fall, 2009 Description: Project Gutenberg\'s Trinity [Atomic Test] Site, by The National Atomic Museum This eBook is for the use of anyone anywhere at no cost and with almost no restrictions whatsoever. You may copy it, give it away or re-use it under the terms of the Proj... Date Added: 2009-08-11 17:53:29 |
| sample2455sol1.1.pdf Path: Old Dominion >> CS >> 455 Fall, 2008 Description: CS 455: Computer Networks and Data Communication Spring 2005 Midterm Examination- Part 1/2 Points: 75 March 1, 2005 (3:00-4:15 PM) Time allowed: 75 minutes CLOSED BOOK, CLOSED NOTES, OPEN MIND Answer All Questions Solution Question 1 (i) (ii) (iii) (... Date Added: 2009-08-11 17:54:27 |
| S02Exam2.pdf Path: Lake County >> ECE >> 567 Fall, 2009 Description: ECE 467 COMMUNICATION NETWORK ANALYSIS Exam 2 NAME: SPRING 2002 Wednesday, April 10 You have 70 minutes to complete the exam. You may use two sheets of notes (two-sided). No other books or notes are allowed. Show your work for full credit. There ar... Date Added: 2009-08-11 17:58:02 |
| ps145_Thompson_sp02.pdf Path: National Taiwan University >> PS >> 145 Fall, 2009 Description: Course Syllabus Political Science 145 The Politics of Global Problems Spring 2002 Tuesdays/Thursdays, 1:30 3:18 Professor Alexander Thompson Department of Political Science 2139 Derby Hall Email: thompson.1191@osu.edu Office hours: Wednesday 9-12 Co... Date Added: 2009-08-11 17:58:43 |
| a2.pdf Path: University of Toronto >> DGP >> 104 Fall, 2009 Description: CSC 104 Assignment 2, Fall 2007 Due by the end of Friday November 2, 2007; no late assignments without written explanation. Part 1: A little thinking about Graphical User Interfaces 1. Examine the names of some of the items in the menus one finds at... Date Added: 2009-08-11 18:03:16 |
| 10520ds Path: Universidade de Brasília >> IQ >> 343242 Spring, 2009 Description: DRC-10520 Make sure the next Card you purchase has. HIGH POWER 16-BIT DIGITAL-TORESOLVER (D/R) CONVERTERS FEATURES 2 VA Drive Capacity 8-Bit/2-Byte Double Buffered Transparent Latch Resolution: 16 Bits Accuracy: to 1 Minute Power Amplifier U... Date Added: 2009-08-12 01:01:10 |
| The Electric Field inside a Conductor Path: New Mexico Junior College >> PHY >> 122 Fall, 2008 Description: ... Date Added: 2009-08-12 16:14:39 |
| BI13_Ch5 Text Notes Path: College of the Desert >> BI >> 13 Spring, 2009 Description: ... Date Added: 2009-08-12 23:40:15 |
| syllabus2006s.pdf Path: CSU Chico >> CSCI >> 659 Fall, 2009 Description: CSCI 550: Theory of Computing Abbreviated Syllabus for Spring Semester 2006 Visit http:/www.ecst.csuchico.edu/~juliano/csci550 for additional detail. Prerequisites MATH 317, Discrete Mathematical Structures Junior-level standing recommended Descr... Date Added: 2009-08-14 00:11:20 |
| ProbSet5Fall2001.pdf Path: Whittier >> ORGANIC >> 0405 Fall, 2009 Description: Organic Chemistry - CHEM 231A Problem Set #5 Due December 10, 2001 @ 6:00pm 1. The cyano group (CN) can be hydrolyzed to a carboxylic acid group (CO2H). During this complex process, the steric size increases relative to that of the original cyano gro... Date Added: 2009-08-14 00:14:18 |
| L1.pdf Path: orst.edu >> ECE >> 575 Fall, 2009 Description: DATA SECURITY rTrust Technologies 1 Announcements Cryptographic algorithms implemented in Mathematica, Maple and Matlab are available at www.prenhall.com/washington Textbook W. Trappe & L... Date Added: 2009-08-14 00:14:29 |
| lecture_phillips_gravity.pdf Path: Washington University in St. Louis >> SHIRO >> 454 Fall, 2009 Description: 2. Potential Fields and Gravity 2.1 The potential field You recall that work, or energy, equals force times distance: 1 U (1) = F dl P (2.1) where P is a reference point. A potential field is a force field in which the properties of the field de... Date Added: 2009-08-14 00:14:48 |
| csslongresults2006.pdf Path: E. Texas Baptist >> HANDLE >> 404 Fall, 2009 Description: 2005-2006 CSS LONGITUDINAL REPORT All Students East Texas Baptist University All Respondents Your Institution CIRP CSS DIFF 72 72 -Oth Relig 4yr Colls CIRP CSS DIFF 4,263 4,263 - (2608) Number of Respondents Academic activities engaged in \"frequent... Date Added: 2009-08-14 00:27:06 |
| brenner_pearson.pdf Path: UCSF >> BMI >> 206 Fall, 2009 Description: Protein sequence comparison and Protein evolution Tutorial - ISMB2000 William R. Pearson Department of Biochemistry and Molecular Genetics, Jordan Hall, Box 800733 University of Virginia, Charlottesville, VA 22908, USA October, 2001 Contents 1 Intro... Date Added: 2009-08-14 00:28:15 |
| compiler_lect.pdf Path: Lake County >> ECE >> 512 Fall, 2009 Description: 1 2 Compiler Technology Wen-mei Hwu ECE University of Illinois, Urbana-Champaign UIUC ECE 411 and NTU CA 718-Q: Computer Microarchitecture: Hardware and Software 1999, Wen-mei W. Hwu, All Rights Reserved. Basic Compiler Techniques Inline expansi... Date Added: 2009-08-14 00:33:54 |
| book.pdf Path: Washington University in St. Louis >> CS >> 573 Fall, 2009 Description: Probability Theory: The Logic of Science by E. T. Jaynes Wayman Crow Professor of Physics Washington University St. Louis, MO 63130, U. S. A. Dedicated to the Memory of Sir Harold Jeffreys, who saw the truth and preserved it. Copyright c 1995 by E... Date Added: 2009-08-14 00:37:01 |
| 6:bag-boost-4up.pdf Path: UNL >> CSCE >> 478 Fall, 2008 Description: CSCE 478/878 Lecture 6: Combining Classifiers: Weighted Majority, Boosting, and Bagging Outline Combining classifiers to improve performance Combining arbitrary classifiers: Weighted Majority algorithm Stephen D. Scott (Adapted from Tom Mitchell... Date Added: 2009-08-14 00:42:16 |
| week3b.ps Path: University of Toronto >> CSC >> 310 Fall, 2009 Description: %!PS-Adobe-2.0 %Creator: dvipsk 5.58f Copyright 1986, 1994 Radical Eye Software %Title: slides.dvi %Pages: 2 0 %PageOrder: Ascend %BoundingBox: 0 0 612 792 %EndComments %BeginProcSet: PStoPS 1 13 userdict begin [/showpage/erasepage/copypage]{dup wher... Date Added: 2009-08-14 00:56:54 |
| Intro2.pdf Path: Bucknell >> CSCI >> 305 Fall, 2009 Description: CSCI 305 Spring 2007 Slide Set 2: Introduction Part 2 01/23/07 CSCI 305 Introduction to Database 1 Database Management System Overview Data Definition Query Processing Storage and Buffer Management Transaction Processing Query Processor ... Date Added: 2009-08-14 01:06:26 |
| lec10 Path: CHIC >> BUS >> 35100 Winter, 2007 Description: ... Date Added: 2009-08-14 09:17:14 |
| moneysupply Path: UCLA >> ECON >> 102 Spring, 2009 Description: ... Date Added: 2009-08-19 03:04:10 |
| management_4_20 Path: Central Pennsylvania >> BUS >> BUS220 Spring, 2009 Description: ... Date Added: 2009-08-19 17:36:01 |
| Lecture 2 Path: Berkeley >> CHEM >> chem3a Spring, 2007 Description: ... Date Added: 2009-08-19 18:17:54 |
| Exam 1 Fall 2005 Path: UGA >> VPHY >> 3100 Spring, 2009 Description: ... Date Added: 2009-08-19 23:30:28 |
| Chapter06 Path: Mesa CC >> ACCT >> 45397 Summer, 2009 Description: ... Date Added: 2009-08-20 12:33:06 |
| lab_02_slide Path: NCTU >> IEE >> 5016 Spring, 2005 Description: ... Date Added: 2009-08-23 11:36:37 |
| lab_04_note Path: NCTU >> IEE >> 5016 Spring, 2005 Description: ... Date Added: 2009-08-23 11:37:00 |
| chap8_3 Path: UMBC >> CMSC >> 711 Fall, 2004 Description: ... Date Added: 2009-08-23 12:14:12 |
| PartIIISec2_5 Path: UCLA >> MATH 131A >> 262447221 Spring, 2009 Description: ... Date Added: 2009-08-24 00:04:19 |
| 220Final Path: N.C. State >> ECE >> 220 Summer, 2009 Description: ... Date Added: 2009-08-24 05:17:18 |
| Hw02_Sol_Su09 Path: N.C. State >> ECE >> 220 Summer, 2009 Description: ... Date Added: 2009-08-24 05:18:17 |
| Don Giovanni Response Journal II Path: Simons Rock >> FYS >> 101 Fall, 2008 Description: ... Date Added: 2009-08-24 13:17:18 |
| BIO 349 sample exam fall 97 Path: Texas >> BIO >> BIO 349 Fall, 2007 Description: ... Date Added: 2009-08-24 15:26:16 |
| 06 URCHIN CHICK DEV 2009 Path: Texas >> BIO 206L >> 49125 Spring, 2009 Description: ... Date Added: 2009-08-24 19:06:00 |
| Econ 333 Question 1 Path: Penn State >> ECON >> 333 Fall, 2009 Description: ... Date Added: 2009-08-25 00:50:29 |
| HW_5 Solutions Path: Cal Poly >> ME >> 212 Fall, 2008 Description: ... Date Added: 2009-08-27 16:35:37 |
| 11A Globalization and the Rise of commodity Production Path: Texas >> ANT 302 >> 302 Spring, 2009 Description: ... Date Added: 2009-08-28 17:39:14 |
| Topic Five Path: École Normale Supérieure >> BUSINESS >> ACCT3104 Spring, 2009 Description: ... Date Added: 2009-08-30 07:47:38 |
| Note-1 Path: ASU >> CSE >> 494 Spring, 2009 Description: ... Date Added: 2009-08-30 13:33:53 |
| Soln02047 Path: Valencia >> EGS >> 2310 Spring, 2009 Description: ... Date Added: 2009-08-30 14:36:12 |
| Soln02089 Path: Valencia >> EGS >> 2310 Spring, 2009 Description: ... Date Added: 2009-08-30 14:37:41 |
| Soln04083 Path: Valencia >> EGS >> 2310 Spring, 2009 Description: ... Date Added: 2009-08-30 14:51:55 |
| Soln11066 Path: Valencia >> EGS >> 2321 Spring, 2009 Description: ... Date Added: 2009-08-30 14:56:41 |
| Soln11160 Path: Valencia >> EGS >> 2321 Spring, 2009 Description: ... Date Added: 2009-08-30 15:08:38 |
| 6_L_ Path: Yaşar Üniversitesi >> MATHEMATIC >> m801 Spring, 2009 Description: ... Date Added: 2009-08-30 17:30:39 |
| problem01_49 Path: Butte College >> PHYS >> PHYS31 Spring, 2009 Description: ... Date Added: 2009-08-31 20:31:22 |
| problem01_83 Path: Butte College >> PHYS >> PHYS31 Spring, 2009 Description: ... Date Added: 2009-08-31 20:31:46 |
| 1.12 Path: Texas >> PHY >> 303L Fall, 2009 Description: ... Date Added: 2009-08-31 23:05:19 |
| Erin Brockovich Path: Texas A&M >> PSYC >> 300 Spring, 2008 Description: ... Date Added: 2009-09-01 08:00:41 |
| Test #15 Path: CUNY Hunter >> POLSC >> 110 Spring, 2009 Description: ... Date Added: 2009-09-01 21:28:31 |
| ch14 Path: Texas >> PHY 102M >> M Spring, 2009 Description: ... Date Added: 2009-09-01 22:15:00 |
| hw2solutions Path: Texas >> PHY 102M >> M Spring, 2009 Description: ... Date Added: 2009-09-01 22:15:11 |
| lecture11 Path: MIT >> BIOL >> 7.03 Fall, 2004 Description: ... Date Added: 2009-09-03 16:57:14 |
| lecture19 Path: MIT >> BIOL >> 7.03 Fall, 2004 Description: ... Date Added: 2009-09-03 17:01:42 |
| lecture19 - Copy Path: MIT >> BIOL >> 7.03 Fall, 2004 Description: ... Date Added: 2009-09-03 17:01:55 |
| Section__10A_Solutions Path: Cornell >> AEM >> 3240 Spring, 2009 Description: ... Date Added: 2009-09-03 23:51:14 |
| 09.Fall.ARLT101.class2.Isherwood.Villaraigosa Path: USC >> ARLT >> 101g Fall, 2009 Description: ... Date Added: 2009-09-05 00:49:23 |
| NTR321 - Malnutrition Path: Texas >> NTR 321 >> Nutrition Spring, 2009 Description: ... Date Added: 2009-09-05 23:45:06 |
| 2 Path: Texas >> BIO >> 212 Spring, 2005 Description: ... Date Added: 2009-09-06 11:13:40 |
| COPD Tx Path: FIU >> NUR >> 4355 Spring, 2009 Description: ... Date Added: 2009-09-06 18:30:41 |
| Fall 2009 ME 304-2 Syllabus Path: Clemson >> ME >> ME 304 Fall, 2009 Description: ... Date Added: 2009-09-07 05:43:12 |
| 385lec24 Path: Simon Fraser >> PHYS >> 385 Spring, 2009 Description: ... Date Added: 2009-09-07 20:03:23 |
| qauntitative chem notes chpt 10__099 Path: Texas >> CHEM >> 2335 Spring, 2009 Description: ... Date Added: 2009-09-08 01:47:43 |
| IRWIN 9e 1_5 Path: North Texas >> EENG >> circuit an Spring, 2009 Description: ... Date Added: 2009-09-08 22:33:03 |
| 15_16_17_Somatosensation_SpinCtrlMvt_BrainCtrlMvt Path: Washington >> SPHSC >> 444 Summer, 2009 Description: ... Date Added: 2009-09-09 02:51:58 |
| quiz5solutions Path: Maryland >> MATH >> 241 Spring, 2009 Description: ... Date Added: 2009-09-09 14:46:33 |
| Chapter 12 -- Texas Natural Resources Path: Texas >> GEO >> 301 Spring, 2009 Description: ... Date Added: 2009-09-09 23:06:03 |
| C14 The Dynamic GenomeF08 Path: Texas >> BIO 325 >> 73678 Spring, 2009 Description: ... Date Added: 2009-09-10 01:58:54 |
| Chapter 8 Path: Strayer >> SOC >> 300 Spring, 2009 Description: ... Date Added: 2009-09-11 19:45:46 |
| HW10--page24 Path: UC Irvine >> MATH >> 45240 Spring, 2009 Description: ... Date Added: 2009-09-12 15:57:55 |
| Chapter 12 - Instrumental variables regression Path: Simon Fraser >> ECONOMICS >> ECON 435 Spring, 2007 Description: ... Date Added: 2009-09-13 03:00:26 |
| Carbon Taxes for beginners Path: Simon Fraser >> ECONOMICS >> econ 104 Spring, 2009 Description: ... Date Added: 2009-09-13 08:29:56 |
| Week 16 Handout #2 Path: USC >> SWMS >> 210GM Spring, 2009 Description: ... Date Added: 2009-09-13 19:29:20 |
| Lab5Week6Q1 Path: Queen's University >> CISC >> 101 Spring, 2009 Description: ... Date Added: 2009-09-14 00:00:26 |
| Summary09 Path: Texas >> ECO >> 304l Fall, 2005 Description: ... Date Added: 2009-09-14 11:45:54 |
| Lecture_12_(Student_Handoutl) Path: Purdue >> ENGR >> ENGR126 Fall, 2009 Description: ... Date Added: 2009-09-14 19:43:54 |
| section question week 1 answer key Path: UCSD >> ECON >> 1 Winter, 2009 Description: ... Date Added: 2009-09-14 23:23:04 |
| 234-assadi-07fafin Path: Wisconsin >> MATH >> 234 Spring, 2007 Description: ... Date Added: 2009-09-15 11:38:20 |
| E304exam2_essay_A_key Path: Penn State >> ECON304 >> ECON304 Fall, 2008 Description: ... Date Added: 2009-09-15 18:42:40 |
| 4.3 DERIVATIVES AND THE SHAPE OF GRAPHS Path: Washington State >> MATH >> 171.06 Fall, 2009 Description: ... Date Added: 2009-09-16 14:54:45 |
| Spring09_Test__1_study_guide Path: Michigan State University >> MGT >> 325 Spring, 2009 Description: ... Date Added: 2009-09-16 17:39:32 |
| Chapter_15_Conflict Path: Michigan State University >> MGT >> 325 Spring, 2009 Description: ... Date Added: 2009-09-16 17:41:49 |
| hw06 Path: UIllinois >> AE >> ae352 Spring, 2009 Description: ... Date Added: 2009-09-16 21:31:11 |
| 63868-Ch09 Path: ADFA >> INDUSTRIAL >> 0906547 Spring, 2009 Description: ... Date Added: 2009-09-16 21:48:39 |
| cognativemodel Path: Advancing Technology >> IT >> it771 Fall, 2009 Description: ... Date Added: 2009-09-17 05:45:56 |
| 1introduction Path: Advancing Technology >> IT >> it771 Fall, 2009 Description: ... Date Added: 2009-09-17 05:48:30 |
| CmpE+273-Fall2009 Path: San Jose State >> CMPE >> 273 Fall, 2009 Description: ... Date Added: 2009-09-17 13:09:38 |
| midterm2_key Path: USC >> BISC >> 320L Fall, 2007 Description: ... Date Added: 2009-09-17 20:31:21 |
| TermTestAnswersS03(2) Path: Windsor >> ME >> 416 Spring, 2009 Description: ... Date Added: 2009-09-19 13:45:57 |
| e211test3 Path: Nevada >> CEE >> 372 Spring, 2009 Description: ... Date Added: 2009-09-19 18:27:41 |
| EE 220 Rules to Follow Path: Nevada >> EE >> 220 Spring, 2009 Description: ... Date Added: 2009-09-19 18:29:52 |
| 27_contexts_of_dev_2 Path: Cornell >> PSYCH >> 2090 Spring, 2009 Description: ... Date Added: 2009-09-19 19:18:17 |
| assign_3_parent_kit Path: Cornell >> PSYCH >> 2090 Spring, 2009 Description: ... Date Added: 2009-09-19 19:20:56 |
| 4-26new Path: NJIT >> CE >> MECH 235 Spring, 2009 Description: ... Date Added: 2009-09-20 10:34:32 |
| n1328880002_30642502_16297 Path: Wisconsin >> MUSIC >> 273 Spring, 2009 Description: ... Date Added: 2009-09-20 12:29:55 |
| Church_of_England_and_calvinism Path: LSU >> HIST >> 1003 Spring, 2008 Description: ... Date Added: 2009-09-20 21:46:45 |
| mat33hw5 Path: Lehigh >> MAT >> MAT033 Spring, 2009 Description: ... Date Added: 2009-09-21 09:40:29 |
| lecture-05-recap Path: U. Bío-Bío >> CS >> cs Spring, 2009 Description: ... Date Added: 2009-09-21 16:16:01 |
| SUBJECT KEY CRIM PRO Path: University of the West >> LAW >> All Fall, 2009 Description: ... Date Added: 2009-09-21 20:42:23 |
| fr2_soln Path: Berkeley >> EWMBA >> 201A Fall, 2007 Description: ... Date Added: 2009-09-21 23:41:00 |
| Drexel CMGT 101-2008 - week 7 management tools Path: Drexel >> CM >> 101 Spring, 2009 Description: ... Date Added: 2009-09-22 02:34:23 |
| KING FAHD UNIVERSITY CHEMICAL ENGINEERING COURSE NOTES (Fluid Mechanics)-Ch8-solved problems Path: King Fahd University of Petroleum & Minerals >> CHEMICAL E >> CHE 204 Spring, 2009 Description: ... Date Added: 2009-09-22 08:02:44 |
| The Age of Imperialism Path: LSU >> HIST >> 1007 Fall, 2008 Description: ... Date Added: 2009-09-22 12:31:45 |
| Chapter 13 incomplete Path: LSU >> BIOL >> 2160 Spring, 2009 Description: ... Date Added: 2009-09-22 12:37:12 |
| Lecture 20, Ch. 45 Path: Pacific >> BIOL >> BIOL 51 Spring, 2009 Description: ... Date Added: 2009-09-22 20:07:00 |
| MoralityandReligion Path: Florida State College >> HUM >> 282927 Fall, 2008 Description: ... Date Added: 2009-09-22 21:39:45 |
| Astro 20.1 Path: Cornell >> ASTRO >> 101 Fall, 2008 Description: ... Date Added: 2009-09-23 00:23:36 |
| Untitled2_11 Path: Acton School of Business >> BUSI >> 101 Spring, 2009 Description: ... Date Added: 2009-09-23 00:27:35 |
| Questions_for_cse331-sp08_Midtermexam-1 Path: Penn State >> CMPEN >> 331 Fall, 2008 Description: ... Date Added: 2009-09-23 00:35:04 |
| L25 Path: Penn State >> CMPEN >> 362 Spring, 2009 Description: ... Date Added: 2009-09-23 00:54:35 |
| Lecture 9_24 Path: Purdue >> POL >> 101 Spring, 2009 Description: ... Date Added: 2009-09-23 15:32:23 |
| IE383_Assignment3_Sol Path: Purdue >> IE >> 383 Spring, 2009 Description: ... Date Added: 2009-09-23 18:02:01 |
| Chem3BFall06PracticeExam5 Path: Berkeley >> CHEM 3B >> 3B Fall, 2006 Description: ... Date Added: 2009-09-24 02:17:08 |
| Week7_sum Path: UCSD >> CAT >> CAT 3 Spring, 2009 Description: ... Date Added: 2009-09-25 03:05:49 |
| BIOL 200 - Syllabus Path: Golden West >> BIOL 200 >> BIOL 200 Summer, 2009 Description: ... Date Added: 2009-09-26 01:58:39 |
| ECON 205 Lecture (4.30.2008) Path: USC >> ECON >> 205 Spring, 2008 Description: ... Date Added: 2009-09-26 20:09:20 |
| Case07_mmMartinMackenzie_2 Path: SUNY Albany >> BITM >> 110 Spring, 2009 Description: ... Date Added: 2009-09-27 00:15:06 |
| Section19_1 Path: University of Toronto >> ACT >> ACT348 Fall, 2008 Description: ... Date Added: 2009-09-27 02:34:45 |
| Chapter 14 and 15 (up to Quiz 2) Path: UPenn >> ECON >> 101 Spring, 2009 Description: ... Date Added: 2009-09-27 14:33:41 |
| Soln02047 Path: University of Alabama - Huntsville >> MAE >> 271 Spring, 2009 Description: ... Date Added: 2009-09-27 17:43:23 |
| Soln02089 Path: University of Alabama - Huntsville >> MAE >> 271 Spring, 2009 Description: ... Date Added: 2009-09-27 17:44:35 |
| Lecture-03 Path: ASU >> EEE >> 352/333 Fall, 2009 Description: ... Date Added: 2009-09-28 01:01:25 |
| Exam3Review Path: Texas >> CH >> 369 Spring, 2009 Description: ... Date Added: 2009-09-28 02:31:48 |
| Sega - Exam discussion Path: UMKC >> MATH >> 402 Spring, 2009 Description: ... Date Added: 2009-09-28 03:11:59 |
| Syllabus Path: Berkeley >> GEOGRAPHY >> 130 Summer, 2007 Description: ... Date Added: 2009-09-28 14:36:53 |
| 2-9-09 Path: SUNY Stony Brook >> WRT >> 102 Spring, 2009 Description: ... Date Added: 2009-09-28 16:44:06 |
| TA essay Path: SUNY Stony Brook >> WRT >> 102 Spring, 2009 Description: ... Date Added: 2009-09-28 16:44:25 |
| L04addition Path: Harvard >> CHEM >> 3A Spring, 2008 Description: ... Date Added: 2009-09-28 19:20:00 |
| ID4 Path: USC >> EASC >> 150g Fall, 2008 Description: ... Date Added: 2009-09-29 13:17:58 |
| stem-and-leaf.xls Path: UNL >> STAT >> 351 Fall, 2009 Description: ... Date Added: 2009-09-29 14:48:01 |
| Mugs_Fall03.ppt Path: Penn State >> CHE >> 438 Fall, 2009 Description: ... Date Added: 2009-09-29 14:48:59 |
| samplemidtermII.pdf Path: Bergen CC >> EE >> 105 Fall, 2009 Description: ... Date Added: 2009-09-29 14:49:32 |
| Hmwk3.pdf Path: Dartmouth >> ENGS >> 250 Fall, 2009 Description: ... Date Added: 2009-09-29 14:49:46 |
| ee242_lect6_twoports.pdf Path: Berkeley >> EE >> 242 Fall, 2009 Description: ... Date Added: 2009-09-29 14:49:56 |
| hw1.pdf Path: Duke >> CPS >> 130 Fall, 2009 Description: ... Date Added: 2009-09-29 14:51:19 |
| L12.ps Path: Duke >> CPS >> 130 Fall, 2009 Description: ... Date Added: 2009-09-29 14:52:19 |
| L09.pdf Path: Duke >> CPS >> 130 Fall, 2009 Description: ... Date Added: 2009-09-29 14:52:23 |
| Slides-15.pdf Path: Arizona >> CS >> 372 Fall, 2009 Description: ... Date Added: 2009-09-29 14:53:39 |
| Ass6.pdf Path: Arizona >> CS >> 372 Fall, 2009 Description: ... Date Added: 2009-09-29 14:56:47 |
| Web Page Design.doc Path: Trinity U >> CS >> 1300 Fall, 2009 Description: ... Date Added: 2009-09-29 14:57:56 |
| Phys132 - Spring 2007 - HW18.pdf Path: Delaware State >> PHYS >> 132 Fall, 2009 Description: ... Date Added: 2009-09-29 15:05:31 |
| OptionCalculatorAMD.pdf Path: University of Toronto >> ACT >> 370 Fall, 2009 Description: ... Date Added: 2009-09-29 15:06:39 |
| fxsol0205.pdf Path: SUNY Albany >> MAT >> 214 Fall, 2009 Description: ... Date Added: 2009-09-29 15:06:45 |
| chapt1.pdf Path: Duke >> CPS >> 006 Fall, 2009 Description: ... Date Added: 2009-09-29 15:09:50 |
| Quiz11.pdf Path: Georgia Tech >> MATH >> 142 Fall, 2009 Description: ... Date Added: 2009-09-29 15:15:27 |
| 27149.txt Path: UNC >> DOCS >> 27149 Fall, 2009 Description: ... Date Added: 2009-09-29 15:18:57 |
| OverviewC.ppt Path: North Texas >> CS >> 3110 Fall, 2009 Description: ... Date Added: 2009-09-29 15:22:44 |
| 4l09.ps Path: Duke >> X >> 100 Fall, 2009 Description: ... Date Added: 2009-09-29 15:25:37 |
| graphaldescriptivelab_153s05.pdf Path: Macalester >> MATH >> 153 Fall, 2009 Description: ... Date Added: 2009-09-29 15:31:13 |
| 06-sql-notes.pdf Path: Duke >> CPS >> 196 Fall, 2009 Description: ... Date Added: 2009-09-29 15:33:54 |
| 4l25.ps Path: Duke >> X >> 100 Fall, 2009 Description: ... Date Added: 2009-09-29 15:37:39 |
| 23699.txt Path: UNC >> DOCS >> 23699 Fall, 2009 Description: ... Date Added: 2009-09-29 15:39:04 |
| 23974-readme.txt Path: UNC >> DOCS >> 23974 Fall, 2009 Description: ... Date Added: 2009-09-29 15:41:11 |
| hwork4_sol.pdf Path: UVA >> ASTR >> 4993 Fall, 2009 Description: ... Date Added: 2009-09-29 15:42:02 |
| eq3.ps Path: Sveriges lantbruksuniversitet >> CS >> 361 Fall, 2009 Description: ... Date Added: 2009-09-29 15:44:53 |
| StrongPCMP4e-ch19.ppt Path: Christian Brothers >> FINANCE >> 440 Fall, 2009 Description: ... Date Added: 2009-09-29 15:47:08 |
| deriv-antideriv.pdf Path: Wilfrid Laurier >> MATH >> 249 Fall, 2009 Description: ... Date Added: 2009-09-29 15:55:05 |
| pset 2.pdf Path: Bergen CC >> EE >> 230 Spring, 2009 Description: ... Date Added: 2009-09-29 16:10:12 |
| Free electron gas Handout.pdf Path: Bergen CC >> EE >> 230 Spring, 2009 Description: ... Date Added: 2009-09-29 16:10:14 |
| CONGEN5.ppt Path: Lake County >> IB >> 451 Fall, 2009 Description: ... Date Added: 2009-09-29 16:15:33 |
| keyrecoveryencryption98.pdf Path: Duke >> CPS >> 182 Fall, 2009 Description: ... Date Added: 2009-09-29 16:17:33 |
| expandco.doc Path: Cal Poly Pomona >> CE >> 122 Fall, 2009 Description: ... Date Added: 2009-09-29 16:17:50 |
| homewrok 14 calc II.pdf Path: SUNY Albany >> AS >> 7202 Fall, 2009 Description: ... Date Added: 2009-09-29 16:23:25 |
| botvinick-plaut.pdf Path: UCSD >> USERS >> 258 Fall, 2009 Description: ... Date Added: 2009-09-29 16:27:18 |
| AngiospermCycle.pdf Path: Whatcom Community College >> BIOLOGY >> 213 Fall, 2009 Description: ... Date Added: 2009-09-29 16:39:09 |
| helpsession.ppt Path: Sanford-Brown Institute >> CS >> 169 Fall, 2009 Description: ... Date Added: 2009-09-29 16:43:01 |
| homework13_sol_f04.pdf Path: Bergen CC >> EE >> 105 Fall, 2009 Description: ... Date Added: 2009-09-29 16:44:29 |
| Lecture2.handouts.pdf Path: Bergen CC >> EE >> 105 Fall, 2009 Description: ... Date Added: 2009-09-29 16:45:17 |
| lecture35bn.pdf Path: Bergen CC >> EE >> 105 Fall, 2009 Description: ... Date Added: 2009-09-29 16:45:28 |
| Lecture4.pdf Path: Bergen CC >> EE >> 105 Fall, 2009 Description: ... Date Added: 2009-09-29 16:46:19 |
| 5Anatomy.pdf Path: Auburn >> AG >> 370 Fall, 2009 Description: ... Date Added: 2009-09-29 16:58:16 |
| HW1.doc Path: Lake County >> ECE >> 430 Fall, 2009 Description: ... Date Added: 2009-09-29 16:59:42 |
| Lecture13.ppt Path: Rochester >> LECTURE >> 102 Fall, 2009 Description: ... Date Added: 2009-09-29 17:03:25 |
| slides.pdf Path: Allan Hancock College >> COMP >> 830 Fall, 2009 Description: ... Date Added: 2009-09-29 17:05:58 |
| P120-Ch26-solutions.pdf Path: UMass (Amherst) >> PHYS >> 120 Fall, 2009 Description: ... Date Added: 2009-09-29 17:06:00 |
| userprog.ps Path: Concordia Chicago >> CS >> 230 Fall, 2009 Description: ... Date Added: 2009-09-29 17:06:09 |
| mocFSM-CFSM.pdf Path: Berkeley >> EE >> 249 Fall, 2009 Description: ... Date Added: 2009-09-29 17:09:24 |
| WeekbCumPark.PDF Path: SUNY Buffalo >> PARK >> 450 Fall, 2009 Description: ... Date Added: 2009-09-29 17:13:33 |
| qA19_147_1.pdf Path: Boise State >> PDF >> 147 Fall, 2009 Description: ... Date Added: 2009-09-29 17:20:47 |
| Lab02.doc Path: Wilfrid Laurier >> GEOG >> 305 Fall, 2009 Description: ... Date Added: 2009-09-29 17:21:24 |
| CompSci4Chap07Sec1PS.ppt Path: Duke >> CPS >> 004 Fall, 2009 Description: ... Date Added: 2009-09-29 17:27:45 |
| rlist14.txt Path: Utah >> SPIN >> 152 Fall, 2009 Description: ... Date Added: 2009-09-29 17:30:32 |
| kllist14.txt Path: Utah >> SPIN >> 152 Fall, 2009 Description: ... Date Added: 2009-09-29 17:30:38 |
| exam3topics.pdf Path: UAB >> CS >> 505 Fall, 2009 Description: ... Date Added: 2009-09-29 17:49:07 |
| handley.pdf Path: Allan Hancock College >> AGSM >> 0306 Fall, 2009 Description: ... Date Added: 2009-09-29 17:50:25 |
| ex2soln.pdf Path: Purdue >> EE >> 202 Fall, 2009 Description: ... Date Added: 2009-09-29 17:56:56 |
| T0500.t04.bys-logo.pdf Path: UCSC >> T >> 0500 Fall, 2009 Description: ... Date Added: 2009-09-29 17:59:37 |
| bing.pdf Path: UCSC >> CMPE >> 123 Fall, 2009 Description: ... Date Added: 2009-09-29 18:11:36 |
| E-2891Chap4.pdf Path: Michigan State University >> WEB >> 2891 Fall, 2009 Description: ... Date Added: 2009-09-29 18:13:05 |
| Lect 01 Emergence of Nano.pdf Path: Sanford-Brown Institute >> CS >> 257 Fall, 2009 Description: ... Date Added: 2009-09-29 18:14:07 |
| cosmics-25762-original.ps Path: Stanford >> MTG >> 030424 Fall, 2009 Description: ... Date Added: 2009-09-29 18:21:46 |
| Midterm_Wortman_Spring06.pdf Path: UMBC >> CMSC >> 202 Spring, 1999 Description: ... Date Added: 2009-09-29 18:31:25 |
| COMPSCI.pdf Path: WPUNJ >> STATPACKS >> 9903 Fall, 2009 Description: ... Date Added: 2009-09-29 18:31:44 |
| e1extra.pdf Path: University of Dayton >> ACADEMIC >> 412 Fall, 2009 Description: ... Date Added: 2009-09-29 18:32:16 |
| cals.pdf Path: Penn State >> AR >> 9900 Fall, 2009 Description: ... Date Added: 2009-09-29 18:33:03 |
| XWINPLOT-Adv.pdf Path: University of Iowa >> DRX >> 400 Fall, 2009 Description: ... Date Added: 2009-09-29 18:33:43 |
| srp.ppt Path: UCSC >> CHEM >> 200 Fall, 2009 Description: ... Date Added: 2009-09-29 18:34:43 |
| Chapter02.doc Path: San Jose State >> BUS >> 170 Fall, 2009 Description: ... Date Added: 2009-09-29 18:36:26 |
| memo-467.pdf Path: MIT >> MEMO >> 467 Fall, 2009 Description: ... Date Added: 2009-09-29 18:37:02 |
| ch4a.pdf Path: Western Washington >> BIOL >> 321 Fall, 2008 Description: ... Date Added: 2009-09-29 18:38:00 |
| word26.txt Path: CSU Fullerton >> BTP >> 200 Fall, 2009 Description: ... Date Added: 2009-09-29 18:39:05 |
| preliminaries.txt Path: UCF >> COMS >> 342 Fall, 2009 Description: ... Date Added: 2009-09-29 18:40:39 |
| ExamQuestions.swaps.pdf Path: University of Illinois, Urbana Champaign >> FIN >> 513 Fall, 2008 Description: ... Date Added: 2009-09-29 18:45:13 |
| 0800-cls-classstruggle.pdf Path: Virginia Tech >> USA >> 1934 Fall, 2009 Description: ... Date Added: 2009-09-29 18:46:09 |
| 2108147.pdf Path: Michigan State University >> LIB >> 1921 Fall, 2009 Description: ... Date Added: 2009-09-29 18:46:54 |
| Request.doc Path: Penn State >> TXK >> 228 Fall, 2009 Description: ... Date Added: 2009-09-29 18:49:02 |
| PREPEX2.DOC Path: Texas A&M >> EX >> 411 Fall, 2009 Description: ... Date Added: 2009-09-29 18:50:56 |
| linear.ppt Path: Virgin Islands >> SENG >> 474 Fall, 2009 Description: ... Date Added: 2009-09-29 18:52:39 |
| Syllabus_Organic Food and Ag.doc Path: Cornell >> HASH >> 0159 Fall, 2009 Description: ... Date Added: 2009-09-29 18:52:46 |
| Unit 14 - Slides.doc Path: Rosalind Franklin University of Medicine & Science >> COMP >> 313 Fall, 2009 Description: ... Date Added: 2009-09-29 18:53:43 |
| ph501lecture10.pdf Path: Princeton >> PH >> 501 Fall, 2009 Description: ... Date Added: 2009-09-29 18:56:55 |
|
|
Get Started With Course Hero Today!
Get study guides, join study groups, and more!
Sign up in seconds with your Facebook account!
Course Hero is a Facebook Application Partner.
Click below to sign-up for FREE.
Our Social Learning Network was built to provide students and key learning partners like professors a platform to share, meet and collaborate while accelerating their comprehension of course-related theories and concepts. We are committed to providing you immediate access to a growing wealth of study materials and an unparalleled academic network of students, professors and other key partners. Why do you care? Because you want the best grade possible and at times need a 24/7 resource that’s responsive to your needs. |
|
What People Are Saying About Course Hero
|
|||
|
|||
|
Explore the benefits of joining Course Hero's social learning network.
|
|||
 |
Get millions of study materials now!Need lecture notes for a missed class or want insightful explanation of the theories and concepts you learn in class? Look no further, Course Hero’s Study Materials empowers you to find a broad and deep set of materials that can help you right now!
Click below to sign-up for FREE.
|
||
 |
Get over 200,000 textbook solutions now!Having difficulty with your homework and need documents that are relevant for your Textbook? Don't be frustrated. Course Hero's Textbook Help presents you study materials from many college courses.
Click below to sign-up for FREE.
|
||
 |
Meet over 300,000 students and your fellow classmates now!Want to meet your current classmates or those that took the class last year? Don’t worry or have anxiety. Course Hero’s Study Groups gives you the seamless opportunity to develop both anonymous or direct relationships with those classmates whom you want to meet and get help from right now!
Click below to sign-up for FREE.
|
||
