Course Solutions And Notes - 00000008 0c
| 00000077.pdf Path: Carnegie Mellon >> DISK >> 31004199 Fall, 2009 Description: ... Date Added: 2009-06-05 00:14:48 |
| 00000132.pdf Path: Carnegie Mellon >> DISK >> 31004199 Fall, 2009 Description: ... Date Added: 2009-06-05 00:14:58 |
| 00000027.pdf Path: Carnegie Mellon >> TERA >> 31004999 Fall, 2009 Description: ... Date Added: 2009-06-05 00:15:10 |
| 00000027.pdf Path: Carnegie Mellon >> DISK >> 31004999 Fall, 2009 Description: ... Date Added: 2009-06-05 00:15:10 |
| 00000122.pdf Path: Carnegie Mellon >> TERA >> 31004999 Fall, 2009 Description: ... Date Added: 2009-06-05 00:15:38 |
| 00000122.pdf Path: Carnegie Mellon >> DISK >> 31004999 Fall, 2009 Description: ... Date Added: 2009-06-05 00:15:38 |
| 00000050.pdf Path: Carnegie Mellon >> DISK >> 31003905 Fall, 2009 Description: ... Date Added: 2009-06-05 00:16:00 |
| 00000111.pdf Path: Carnegie Mellon >> DISK >> 31003905 Fall, 2009 Description: ... Date Added: 2009-06-05 00:16:12 |
| 00000118.pdf Path: Carnegie Mellon >> DISK >> 31003905 Fall, 2009 Description: ... Date Added: 2009-06-05 00:16:13 |
| 00000121.pdf Path: Carnegie Mellon >> DISK >> 31003875 Fall, 2009 Description: ... Date Added: 2009-06-05 00:17:58 |
| 00000037.pdf Path: Carnegie Mellon >> DISK >> 31004779 Fall, 2009 Description: ... Date Added: 2009-06-05 00:19:58 |
| 00000061.pdf Path: Carnegie Mellon >> DISK >> 31004779 Fall, 2009 Description: ... Date Added: 2009-06-05 00:20:03 |
| 00000166.pdf Path: Carnegie Mellon >> DISK >> 31004924 Fall, 2009 Description: ... Date Added: 2009-06-05 00:22:35 |
| 00000270.pdf Path: Carnegie Mellon >> DISK >> 31003327 Fall, 2009 Description: ... Date Added: 2009-06-05 00:25:26 |
| 00000037.pdf Path: Carnegie Mellon >> DISK >> 31003504 Fall, 2009 Description: ... Date Added: 2009-06-05 00:26:11 |
| 00000325.pdf Path: Carnegie Mellon >> DISK >> 31003504 Fall, 2009 Description: ... Date Added: 2009-06-05 00:27:06 |
| 00000105.pdf Path: Carnegie Mellon >> TERA >> 31004123 Fall, 2009 Description: ... Date Added: 2009-06-05 00:28:00 |
| 00000105.pdf Path: Carnegie Mellon >> DISK >> 31004123 Fall, 2009 Description: ... Date Added: 2009-06-05 00:28:00 |
| 00000304.pdf Path: Carnegie Mellon >> TERA >> 31004123 Fall, 2009 Description: ... Date Added: 2009-06-05 00:29:00 |
| 00000304.pdf Path: Carnegie Mellon >> DISK >> 31004123 Fall, 2009 Description: ... Date Added: 2009-06-05 00:29:00 |
| 00000001.pdf Path: Carnegie Mellon >> TERA >> 31003900 Fall, 2009 Description: ... Date Added: 2009-06-05 00:29:23 |
| 00000001.pdf Path: Carnegie Mellon >> DISK >> 31003900 Fall, 2009 Description: ... Date Added: 2009-06-05 00:29:23 |
| 00000053.pdf Path: Carnegie Mellon >> DISK >> 31004027 Fall, 2009 Description: ... Date Added: 2009-06-05 00:30:36 |
| 00000187.pdf Path: Carnegie Mellon >> DISK >> 31003359 Fall, 2009 Description: ... Date Added: 2009-06-05 00:36:31 |
| 00000245.pdf Path: Carnegie Mellon >> DISK >> 31003359 Fall, 2009 Description: ... Date Added: 2009-06-05 00:36:42 |
| 00000162.pdf Path: Carnegie Mellon >> DISK >> 31005518 Fall, 2009 Description: ... Date Added: 2009-06-05 00:37:30 |
| 00000321.pdf Path: Carnegie Mellon >> DISK >> 31005518 Fall, 2009 Description: ... Date Added: 2009-06-05 13:41:00 |
| 00000082.pdf Path: Carnegie Mellon >> DISK >> 31006020 Fall, 2009 Description: ... Date Added: 2009-06-05 13:41:48 |
| 00000149.pdf Path: Carnegie Mellon >> DISK >> 31003509 Fall, 2009 Description: ... Date Added: 2009-06-05 13:43:02 |
| 00000018.pdf Path: Carnegie Mellon >> DISK >> 05100709 Fall, 2009 Description: ... Date Added: 2009-06-05 13:45:59 |
| 00000118.pdf Path: Carnegie Mellon >> DISK >> 05101134 Fall, 2009 Description: ... Date Added: 2009-06-05 13:46:23 |
| 00000141.pdf Path: Carnegie Mellon >> DISK >> 05100694 Fall, 2009 Description: ... Date Added: 2009-06-05 13:46:51 |
| 00000165.pdf Path: Carnegie Mellon >> DISK >> 05100799 Fall, 2009 Description: ... Date Added: 2009-06-05 13:48:05 |
| 00000054.pdf Path: Carnegie Mellon >> TERA >> 05100788 Fall, 2009 Description: ... Date Added: 2009-06-05 13:49:44 |
| 00000054.pdf Path: Carnegie Mellon >> DISK >> 05100788 Fall, 2009 Description: ... Date Added: 2009-06-05 13:49:44 |
| 00000061.pdf Path: Carnegie Mellon >> TERA >> 05100975 Fall, 2009 Description: ... Date Added: 2009-06-05 13:50:24 |
| 00000061.pdf Path: Carnegie Mellon >> DISK >> 05100975 Fall, 2009 Description: ... Date Added: 2009-06-05 13:50:24 |
| 00000078.pdf Path: Carnegie Mellon >> TERA >> 05100975 Fall, 2009 Description: ... Date Added: 2009-06-05 13:50:29 |
| 00000078.pdf Path: Carnegie Mellon >> DISK >> 05100975 Fall, 2009 Description: ... Date Added: 2009-06-05 13:50:29 |
| 00000002.pdf Path: Carnegie Mellon >> DISK >> 05101309 Fall, 2009 Description: ... Date Added: 2009-06-05 13:51:15 |
| 00000017.pdf Path: Carnegie Mellon >> DISK >> 05101198 Fall, 2009 Description: ... Date Added: 2009-06-05 13:51:35 |
| 00000243.pdf Path: Carnegie Mellon >> DISK >> 05101198 Fall, 2009 Description: ... Date Added: 2009-06-05 13:52:15 |
| 00000132.pdf Path: Carnegie Mellon >> DISK >> 05101351 Fall, 2009 Description: ... Date Added: 2009-06-05 13:54:18 |
| 00000111.pdf Path: Carnegie Mellon >> DISK >> 05100903 Fall, 2009 Description: ... Date Added: 2009-06-05 13:54:48 |
| 00000146.pdf Path: Carnegie Mellon >> DISK >> 05100903 Fall, 2009 Description: ... Date Added: 2009-06-05 13:54:54 |
| 00000178.pdf Path: Carnegie Mellon >> DISK >> 05100903 Fall, 2009 Description: ... Date Added: 2009-06-05 13:55:00 |
| 00000092.pdf Path: Carnegie Mellon >> DISK >> 05101101 Fall, 2009 Description: ... Date Added: 2009-06-05 13:55:41 |
| 00000164.pdf Path: Carnegie Mellon >> TERA >> 05100896 Fall, 2009 Description: ... Date Added: 2009-06-05 13:57:26 |
| 00000164.pdf Path: Carnegie Mellon >> DISK >> 05100896 Fall, 2009 Description: ... Date Added: 2009-06-05 13:57:26 |
| 00000098.pdf Path: Carnegie Mellon >> TERA >> 05101307 Fall, 2009 Description: ... Date Added: 2009-06-05 14:00:44 |
| 00000098.pdf Path: Carnegie Mellon >> DISK >> 05101307 Fall, 2009 Description: ... Date Added: 2009-06-05 14:00:44 |
| Grignard lab NB.ppt Path: UNC Wilmington >> CHML >> 212 Fall, 2009 Description: LABORATORY NOTEBOOK (Pre-lab) TITLE AND DATE OBJECTIVES CHEMICAL EQUATION/MECHANISM Include the balanced chemical equation from p.165. The mechanism can be found in the PowerPoint. TABLE OF PHYSICAL DATA PRE-LAB CALCULATION Include theoretica... Date Added: 2009-06-05 14:02:28 |
| conversions for specialization relationship types.doc Path: Delaware State >> CIS >> 371 Fall, 2009 Description: SPECIALIZATION HIERARCHY AND ITS CONVERSION INTO TABLES OF A RELATIONAL DATABASE D. Pokrajac, 3/16/2004 p0 p1 . p m0 P C1 c1,1 . C2 c1, m1 c 2 ,1 . . Cn c n ,1 . c 2 , m2 c n , mn Note: Each child in addition to parent\'s attributes has it ... Date Added: 2009-06-05 14:03:27 |
| Tsurutani_ReplyAkasofuComment_2005JA011121.pdf Path: UCLA >> WEEK >> 293 Fall, 2009 Description: JOURNAL OF GEOPHYSICAL RESEARCH, VOL. 110, A09227, doi:10.1029/2005JA011121, 2005 Reply to comment by S.-I. Akasofu and Y. Kamide on `The extreme magnetic storm of 12 September 1859\' Bruce T. Tsurutani Jet Propulsion Laboratory, California Institute... Date Added: 2009-06-05 14:04:34 |
| ExcelAssign12Math110S08KEY.xls Path: Allegheny >> MATH >> 110 Fall, 2009 Description: Population, Gross Domestic Product (GDP), and Oil Consumption for 192 Nations of the World Source: CIA World Factbook, 2003 Country Afghanistan Albania Algeria Andorra Angola Antigua and Barbuda Argentina Armenia Australia Austria Azerbaijan Bahamas... Date Added: 2009-06-05 14:05:25 |
| CSCD330-Lecture5-2009.ppt Path: Eastern Washington University >> CSCD >> 330 Fall, 2008 Description: CSCD 330 Network Programming Spring 2009 Lecture 5 Application Layer Reading: Chapter 2 Still Some Material in these slides from J.F Kurose and K.W. Ross All material copyright 1996-2007 1 More Network Applications Looked at HTTP Web applicatio... Date Added: 2009-06-05 14:06:04 |
| LnParallel.rtf Path: Eastern Washington University >> CSCD >> 543 Spring, 2008 Description: Monte Carlo Integration: Parallelized by Unix Forks /* World\'s WORST logarithm calculation function: Monte Carlo integration of dt/t from 1 to x. Author: Timothy Rolfe while ( shots- > 0 ) { double xpos = nextDouble() * range + front, ypos = nextDoub... Date Added: 2009-06-05 14:07:08 |
| error.txt Path: Washington >> JOBS >> 40500 Fall, 2009 Description: Starting test Glast-Gaudi job with job options file joboptions.txt Current time: Tue Feb 12 00:45:47 2008 ( 0 s elapsed) Area not found in title: assuming 60000 cm^2 Current time: Tue Feb 12 01:50:17 2008 ( 3870 s elapsed) ... Date Added: 2009-06-05 14:07:55 |
| error.txt Path: Washington >> JOBS >> 40683 Fall, 2009 Description: Starting test Glast-Gaudi job with job options file joboptions.txt Current time: Mon Feb 11 22:19:41 2008 ( 0 s elapsed) Area not found in title: assuming 60000 cm^2 Current time: Mon Feb 11 23:29:31 2008 ( 4190 s elapsed) ... Date Added: 2009-06-05 14:08:32 |
| submit.txt Path: Washington >> JOBS >> 40875 Fall, 2009 Description: executable = pass6_40875.bat universe = vanilla error = error.txt output = output.txt log = log.txt # set by submitting script Requirements= (OpSys = \"WINNT51\" ) initialdir = F:\\condor\\allgamma\\pass6\\jobs40500-40999/40875... Date Added: 2009-06-05 14:08:58 |
| output.txt Path: Washington >> JOBS >> 40578 Fall, 2009 Description: = running on = COMPUTERNAME=PHYSLAB-8T51PB1 - local directory - Volume in drive C has no label. Volume Serial Number is 9843-D647 Directory of C:\\condor\\execute\\dir_2864 02/11/2008 10:07 PM <DIR> . 02/11/2008 10:07 ... Date Added: 2009-06-05 14:09:18 |
| error.txt Path: Washington >> JOBS >> 40500 Fall, 2009 Description: Starting test Glast-Gaudi job with job options file joboptions.txt Current time: Mon Feb 11 23:40:26 2008 ( 0 s elapsed) Area not found in title: assuming 60000 cm^2 Current time: Tue Feb 12 00:52:15 2008 ( 4309 s elapsed) ... Date Added: 2009-06-05 14:09:29 |
| log.txt Path: Washington >> JOBS >> 40717 Fall, 2009 Description: 000 (58282.000.000) 02/11 20:56:45 Job submitted from host: <128.95.94.28:1092> . 001 (58282.000.000) 02/11 22:22:41 Job executing on host: <172.25.101.90:1058> . 006 (58282.000.000) 02/11 22:42:49 Image size of job updated: 473808 . 006 (58282.000.0... Date Added: 2009-06-05 14:09:42 |
| error.txt Path: Washington >> JOBS >> 40575 Fall, 2009 Description: Starting test Glast-Gaudi job with job options file joboptions.txt Current time: Mon Feb 11 21:05:07 2008 ( 0 s elapsed) Area not found in title: assuming 60000 cm^2 Current time: Mon Feb 11 22:13:57 2008 ( 4130 s elapsed) ... Date Added: 2009-06-05 14:12:02 |
| log.txt Path: Washington >> JOBS >> 40598 Fall, 2009 Description: 000 (58163.000.000) 02/11 20:56:13 Job submitted from host: <128.95.94.28:1092> . 001 (58163.000.000) 02/11 20:59:23 Job executing on host: <172.25.101.184:1067> . 006 (58163.000.000) 02/11 21:19:30 Image size of job updated: 30292 . 006 (58163.000.0... Date Added: 2009-06-05 14:13:16 |
| error.txt Path: Washington >> JOBS >> 40500 Fall, 2009 Description: Starting test Glast-Gaudi job with job options file joboptions.txt Current time: Mon Feb 11 23:40:20 2008 ( 0 s elapsed) Area not found in title: assuming 60000 cm^2 Current time: Tue Feb 12 00:54:46 2008 ( 4466 s elapsed) ... Date Added: 2009-06-05 14:13:36 |
| log.txt Path: Washington >> JOBS >> 40544 Fall, 2009 Description: 000 (58109.000.000) 02/11 20:56:03 Job submitted from host: <128.95.94.28:1092> . 001 (58109.000.000) 02/11 20:56:53 Job executing on host: <172.25.101.71:1066> . 006 (58109.000.000) 02/11 21:17:01 Image size of job updated: 462580 . 005 (58109.000.0... Date Added: 2009-06-05 14:13:41 |
| output.txt Path: Washington >> JOBS >> 40500 Fall, 2009 Description: = running on = COMPUTERNAME=PHYSLAB-205QNB1 - local directory - Volume in drive C has no label. Volume Serial Number is 9843-D647 Directory of C:\\condor\\execute\\dir_3528 02/11/2008 08:56 PM <DIR> . 02/11/2008 08:56 ... Date Added: 2009-06-05 14:14:06 |
| Feminist Economics.pdf Path: UMKC >> ECON >> 688 Winter, 2008 Description: ... Date Added: 2009-06-05 14:14:28 |
| Error_analysis.pdf Path: Cal Poly >> CHEM >> 354 Spring, 2008 Description: The Determination of Random Uncertainties In the laboratory, every reading of an instrument has an inherent uncertainty associated with it. For instance, when we measure the temperature of a bath of water, the thermometer may read 25.67C, but should ... Date Added: 2009-06-05 14:15:14 |
| Molecular model Lab.pdf Path: Olivet Nazarene >> CHEM >> 100 Fall, 2009 Description: ... Date Added: 2009-06-05 14:16:28 |
| 2673quiz7.pdf Path: Youngstown >> MATH >> 2673 Fall, 2008 Description: MATH 2673 Code 2244 Calculus III: Quiz 7 Fall 2007 Name : Please use a pencil and show all work. Give exact answers. 1. Let r(t) =< 2 sin t, 5t, 2 cos t > . (a) Find the unit tangent vector. Score : /10 (b) Find the unit normal vector. (c) Fin... Date Added: 2009-06-05 14:16:38 |
| 2673quiz9.pdf Path: Youngstown >> MATH >> 2673 Fall, 2008 Description: MATH 2673 Code 2244 Calculus III: Quiz 9 Fall 2007 Name : Please use a pencil and show all work. Give exact answers. 1. Find first partial derivatives: (a) z = x ln y Score : /10 (b) z = esin(x/y) 2. Find second partial derivatives of z = y ta... Date Added: 2009-06-05 14:16:39 |
| 106_2_20_09.pdf Path: Haverford >> PHYS >> 106 Fall, 2008 Description: ... Date Added: 2009-06-05 14:16:54 |
| Copy of EDTA titration.xls Path: Uni. Westminster >> RTM >> 0701 Fall, 2009 Description: Titration of 50 mL of 0.04 M Ca2+ with 0.08 M EDTA Cm = 0.04 Vm = 50 C(ligand) = 0.08 Kf\' = 1.80E+10 pM 1.3980 1.5364 2.00 3.00 4.00 5.91 7.00 8.00 8.86 M 4.00E-02 2.91E-02 1.00E-02 1.00E-03 1.00E-04 1.22E-06 1.00E-07 1.00E-08 1.38E-09 Phi V (ligand)... Date Added: 2009-06-05 14:18:18 |
| figure.doc Path: Uni. Westminster >> RTM >> 0701 Fall, 2009 Description: ... Date Added: 2009-06-05 14:18:54 |
| LAB1.doc Path: Uni. Westminster >> RTM >> 0701 Fall, 2009 Description: MEMORANDUM Nuclear Chemistry Summer School 2006 Date : To: From: Subject: Summary A G-M counter was tested using 204TI and 137Cs to study the properties the tube including Geiger plateaus, counting statistics, shelf ratios, resolving time, efficiency... Date Added: 2009-06-05 14:18:56 |
| 092408.pdf Path: Taylor IN >> CSE >> 265 Fall, 2009 Description: 9/25/2008 : 092408 Panel 1 Panel 2 Page 1 of 12 9/25/2008 : 092408 Panel 3 Panel 4 Page 2 of 12 9/25/2008 : 092408 Panel 5 Panel 6 Page 3 of 12 9/25/2008 : 092408 Panel 7 Panel 8 Page 4 of 12 9/25/2008 : 092408 Panel 9 Panel 10 Pag... Date Added: 2009-06-05 14:19:14 |
| fall2000midans.rtf Path: Texas Tech >> CS >> 5353 Fall, 2008 Description: Graduate Compiler - Fall, 2000 Open Book Name_Number_ Circle the best answer (2 points each) 1. What does a 2-pass assembler do during its first pass? c a. Counts the number of statements. b. Checks for external references c. Computes addresses of la... Date Added: 2009-06-05 14:19:36 |
| dpwj5-prototype.ppt Path: Texas Tech >> CS >> 5331 Fall, 2008 Description: Design Patterns Java Workshop Prototype TTU Computer Science Premise You want to Deepen your understanding of the Prototype pattern Build confidence in your ability to recognize and apply this pattern 2 TTU Computer Science Where Are We? ... Date Added: 2009-06-05 14:20:19 |
| TRACER.txt Path: Texas Tech >> CS >> 5353 Fall, 2008 Description: FILE QUARANTINED - Antigen for Exchange removed TRACER.EXE since it was found to match the FILE FILTER= *.exe file filter. ... Date Added: 2009-06-05 14:20:35 |
| mp2.s09.txt Path: Clemson >> CS >> 102 Fall, 2009 Description: Computer Science 102 Major Program 2 Due 24 April 11:59PM LAST DAY - 27 Apr 11:59 PM For this program the ONLY authorized so... Date Added: 2009-06-05 14:22:15 |
| Zheng-L.pdf Path: UCSD >> AB >> 1876 Fall, 2009 Description: C B @ 8 6 766 5 5 3 11 ) \' % $ % ! # AA94 sv#\"!rD oy R! r r hvA ssvDA d odbb}$bbo`q`s$d f ... Date Added: 2009-06-05 14:22:34 |
| 11x2.pdf Path: Stanford >> CS >> 156 Fall, 2009 Description: CS156: The Calculus of Computation Zohar Manna Winter 2008 Chapter 11: Arrays Page 1 of 55 Arrays I: Quantifier-free Fragment of TA Signature: where A : {[], , =} a[i] binary function read array a at index i (\"read(a,i)\") a i v ternary fun... Date Added: 2009-06-05 14:22:52 |
| Chapt. 20.ppt Path: Arkansas >> FINN >> 3053 Fall, 2008 Description: CHAPTER 20 Investment Companies History of Investment Companies Investment companies were first started in Belgium in 1822. Early U.S. investment companies Began at end of 1800s Closed-end companies First mutual fund in 1924 Declines in Great Depres... Date Added: 2009-06-05 14:23:27 |
| L14.pdf Path: W. Alabama >> ECE >> 493 Fall, 2009 Description: ECE 493T3 Lecture 14 Binding OCL to UML entities February 11, 2008 Use a context to say where OCL applies Context Model Entity init: . > initial value pre: . > constrains state before operation post: . > constrains state after ope... Date Added: 2009-06-05 14:24:20 |
| 00000075.pdf Path: Carnegie Mellon >> DISK >> 05102935 Fall, 2009 Description: ... Date Added: 2009-06-05 14:27:57 |
| 00000036.pdf Path: Carnegie Mellon >> DISK >> 05102072 Fall, 2009 Description: ... Date Added: 2009-06-05 14:28:40 |
| 00000005.pdf Path: Carnegie Mellon >> TERA >> 05101234 Fall, 2009 Description: ... Date Added: 2009-06-05 14:29:47 |
| 00000005.pdf Path: Carnegie Mellon >> DISK >> 05101234 Fall, 2009 Description: ... Date Added: 2009-06-05 14:29:47 |
| 00000015.pdf Path: Carnegie Mellon >> DISK >> 05103091 Fall, 2009 Description: ... Date Added: 2009-06-05 14:30:47 |
| 00000062.pdf Path: Carnegie Mellon >> DISK >> 05102611 Fall, 2009 Description: ... Date Added: 2009-06-05 14:31:11 |
| 00000102.pdf Path: Carnegie Mellon >> DISK >> 05101574 Fall, 2009 Description: ... Date Added: 2009-06-05 14:32:21 |
| 00000015.pdf Path: Carnegie Mellon >> DISK >> 05103070 Fall, 2009 Description: ... Date Added: 2009-06-05 14:33:43 |
| 00000037.pdf Path: Carnegie Mellon >> DISK >> 05102778 Fall, 2009 Description: ... Date Added: 2009-06-05 14:34:19 |
| 00000066.pdf Path: Carnegie Mellon >> TERA >> 05102577 Fall, 2009 Description: ... Date Added: 2009-06-05 14:35:40 |
| 00000066.pdf Path: Carnegie Mellon >> DISK >> 05102577 Fall, 2009 Description: ... Date Added: 2009-06-05 14:35:40 |
| 00000029.pdf Path: Carnegie Mellon >> DISK >> 05102993 Fall, 2009 Description: ... Date Added: 2009-06-05 14:36:09 |
| 00000017.pdf Path: Carnegie Mellon >> DISK >> 05101962 Fall, 2009 Description: ... Date Added: 2009-06-05 14:39:36 |
| 00000082.pdf Path: Carnegie Mellon >> TERA >> 05102828 Fall, 2009 Description: ... Date Added: 2009-06-05 14:40:42 |
| 00000082.pdf Path: Carnegie Mellon >> DISK >> 05102828 Fall, 2009 Description: ... Date Added: 2009-06-05 14:40:42 |
| 00000031.pdf Path: Carnegie Mellon >> DISK >> 05101969 Fall, 2009 Description: ... Date Added: 2009-06-05 14:41:12 |
| 00000073.pdf Path: Carnegie Mellon >> TERA >> 05103054 Fall, 2009 Description: ... Date Added: 2009-06-05 14:41:50 |
| 00000073.pdf Path: Carnegie Mellon >> DISK >> 05103054 Fall, 2009 Description: ... Date Added: 2009-06-05 14:41:50 |
| 00000082.pdf Path: Carnegie Mellon >> DISK >> 05103086 Fall, 2009 Description: ... Date Added: 2009-06-05 14:42:24 |
| 00000049.pdf Path: Carnegie Mellon >> TERA >> 05102217 Fall, 2009 Description: ... Date Added: 2009-06-05 14:42:44 |
| 00000049.pdf Path: Carnegie Mellon >> DISK >> 05102217 Fall, 2009 Description: ... Date Added: 2009-06-05 14:42:45 |
| 00000030.pdf Path: Carnegie Mellon >> DISK >> 05103048 Fall, 2009 Description: ... Date Added: 2009-06-05 14:42:57 |
| 00000036.pdf Path: Carnegie Mellon >> DISK >> 05103048 Fall, 2009 Description: ... Date Added: 2009-06-05 14:42:58 |
| 00000007.pdf Path: Carnegie Mellon >> DISK >> 05102903 Fall, 2009 Description: ... Date Added: 2009-06-05 14:43:14 |
| 00000079.pdf Path: Carnegie Mellon >> DISK >> 05102994 Fall, 2009 Description: ... Date Added: 2009-06-05 14:44:37 |
| 00000052.pdf Path: Carnegie Mellon >> TERA >> 05103053 Fall, 2009 Description: ... Date Added: 2009-06-05 14:45:05 |
| 00000052.pdf Path: Carnegie Mellon >> DISK >> 05103053 Fall, 2009 Description: ... Date Added: 2009-06-05 14:45:05 |
| 00000019.pdf Path: Carnegie Mellon >> DISK >> 05102827 Fall, 2009 Description: ... Date Added: 2009-06-05 14:46:36 |
| 00000017.pdf Path: Carnegie Mellon >> TERA >> 05101945 Fall, 2009 Description: ... Date Added: 2009-06-05 14:47:02 |
| 00000017.pdf Path: Carnegie Mellon >> DISK >> 05101945 Fall, 2009 Description: ... Date Added: 2009-06-05 14:47:02 |
| 00000041.pdf Path: Carnegie Mellon >> DISK >> 05101149 Fall, 2009 Description: ... Date Added: 2009-06-05 14:48:41 |
| 00000074.pdf Path: Carnegie Mellon >> DISK >> 05102128 Fall, 2009 Description: ... Date Added: 2009-06-05 14:49:21 |
| 00000034.pdf Path: Carnegie Mellon >> DISK >> 05102615 Fall, 2009 Description: ... Date Added: 2009-06-05 14:49:26 |
| 00000167.pdf Path: Carnegie Mellon >> DISK >> 05102615 Fall, 2009 Description: ... Date Added: 2009-06-05 14:49:45 |
| 00000034.pdf Path: Carnegie Mellon >> TERA >> 05101660 Fall, 2009 Description: ... Date Added: 2009-06-05 14:50:08 |
| 00000034.pdf Path: Carnegie Mellon >> DISK >> 05101660 Fall, 2009 Description: ... Date Added: 2009-06-05 14:50:08 |
| 00000025.pdf Path: Carnegie Mellon >> DISK >> 05101185 Fall, 2009 Description: ... Date Added: 2009-06-05 14:51:13 |
| book.pdf Path: Carnegie Mellon >> DISK >> 05101821 Fall, 2009 Description: ... Date Added: 2009-06-05 14:51:16 |
| 00000041.pdf Path: Carnegie Mellon >> TERA >> 05102833 Fall, 2009 Description: ... Date Added: 2009-06-05 14:52:26 |
| 00000041.pdf Path: Carnegie Mellon >> DISK >> 05102833 Fall, 2009 Description: ... Date Added: 2009-06-05 14:52:26 |
| 00000009.pdf Path: Carnegie Mellon >> DISK >> 05102808 Fall, 2009 Description: ... Date Added: 2009-06-05 14:54:22 |
| 00000132.pdf Path: Carnegie Mellon >> DISK >> 05101174 Fall, 2009 Description: ... Date Added: 2009-06-05 14:57:09 |
| 00000161.pdf Path: Carnegie Mellon >> DISK >> 05101174 Fall, 2009 Description: ... Date Added: 2009-06-05 14:57:14 |
| 00000091.pdf Path: Carnegie Mellon >> DISK >> 05102933 Fall, 2009 Description: ... Date Added: 2009-06-05 14:58:22 |
| 00000008.pdf Path: Carnegie Mellon >> TERA >> 05101341 Fall, 2009 Description: ... Date Added: 2009-06-05 14:58:40 |
| 00000008.pdf Path: Carnegie Mellon >> DISK >> 05101341 Fall, 2009 Description: ... Date Added: 2009-06-05 14:58:40 |
| Chp_9_PM_Hartley.ppt Path: Allan Hancock College >> CITP >> 0162 Fall, 2009 Description: CITP0162 Project Management Skills Chapter 9 Working with teams Building and sustaining commitment 1 References Please Note: This Power Point Presentation has been custom prepared for use with the text \"Project Management A competenc... Date Added: 2009-06-05 14:58:51 |
| Lab_2009_3_27_key.doc Path: CSU Northridge >> HHD >> 321 Fall, 2009 Description: MARCH 27, 2009 (due Monday, March 30, 2009 at beginning of your lab) 1. Check () the variables that are generally considered to be categorical True/False questions Color hue Numbers of calories Gender Level of depression Height Types of animal... Date Added: 2009-06-05 14:59:03 |
| lecturer_eval.doc Path: CSU Northridge >> MEMO >> 200506 Fall, 2009 Description: FULL-TIME LECTURER\'S ANNUAL SUMMARY OF ACHIEVEMENTS (To be completed by Lecturer and submitted to Department Chair) Lecturer Department Date The information requested on this form is to be prepared by each full-time lecturer and submitted to the D... Date Added: 2009-06-05 14:59:37 |
| eqnsht131.pdf Path: Lafayette >> PHYS >> 131 Fall, 2009 Description: Phys 131 Kinematics: v = v0 + at vP/A = vP/B + vB/A Forces and Potentials: F = 1 Us = k(x - xR )2 2 Equation Sheet 1 x = x0 + v0 t + at2 2 2 v 2 = v0 + 2a(x - x0 ) Spring 2007 arad = v2 r dp Ff r,s s FN Ff r,k = k FN Fs = -k(x - xR ) dt GM1 M2 GM... Date Added: 2009-06-05 15:00:38 |
| 19440517_0000035510.pdf Path: Princeton >> MC >> 019 Fall, 2009 Description: . . . . ., . :,: . . . . . . . . _ . . . . . . . . . , , . ,.( : . . . ;. . . . . . .-. , .: . . . . Approved far Re- Date OCT 1992 . 2 ... Date Added: 2009-06-05 15:03:41 |
| Lecture Week 1 (Mar4&6).pdf Path: Allan Hancock College >> ELEC >> 1000 Fall, 2009 Description: ELEC1000: Introduction to Electrical Engineering Lecture Outline: Week 1. (Textbook Topic 1, Ch 2.1-2.4) Electrical Quantities: We use SI units Note that we use prefixes for powers of 103 Question: Your electricity bill measures the amount of energy ... Date Added: 2009-06-05 15:03:56 |
| genderequity.pdf Path: UNC >> GEOG >> 203 Fall, 2008 Description: EQUAL RIGHTS ADVOCATES\' HIGHER EDUCATION LEGAL ADVOCACY PROJECT ROUNDTABLE REPORT INTRODUCTION On February 1, 2003, Equal Rights Advocates\' Higher Education Legal Advocacy Project convened a meeting of academics, lawyers and representatives of public... Date Added: 2009-06-05 15:04:39 |
| Lecture14-PoS1.pdf Path: CSU Channel Islands >> PSYCH >> 215 Fall, 2009 Description: About Language Psych 215: Language Sciences (Language Acquisition) Lecture 14 Poverty of the Stimulus I One way to think about how to classify the knowledge that you have when you know a language: You know what items (sounds, words, sentences, ques... Date Added: 2009-06-05 15:05:33 |
| Cryptography-1.pdf Path: Texas >> CS >> 337 Fall, 2008 Description: Cryptography: Public Key Cryptography; Mathematical Preliminaries Greg Plaxton Theory in Programming Practice, Fall 2005 Department of Computer Science University of Texas at Austin Secure Communication Earlier we discussed the problems associated ... Date Added: 2009-06-05 15:06:56 |
| 410-09-03-t1.pdf Path: ASU >> MAT >> 410 Fall, 2009 Description: MAT 410 March 26, 2009 Intro to General Topology Test 1 name /100 Put your initials in the TOP RIGHT CORNER of every page. 1 Work as many problems as you can. 100 points constitute a perfect score. 20 2 20 3 20 4 ... Date Added: 2009-06-05 15:07:25 |
| 600REV1.Summer06.pdf Path: S.F. State >> BSS >> 600 Fall, 2009 Description: Geography 600: Environmental Problems & Solution EXAM I Review SUMMER 2006 You are responsible for all lecture notes up to and including June 19th and in the text are Chs.1-4 and Economics part of Ch 14, plus Reserve readings 1-3: The reserve readin... Date Added: 2009-06-05 15:08:11 |
| ComfortAndLight96-TurnOff.pdf Path: Delaware >> MAST >> 622 Fall, 2008 Description: your monitor and small laser printers if I they will be idle for fifteen minutes or more. They also recommend turning off your whole computer if you are not going to use it for two hours or more. RMI has researched the subject to report that modern c... Date Added: 2009-06-05 15:08:20 |
| YLL017W.t2k.dssp-ehl2-logo.pdf Path: UCSC >> YLL >> 017 Fall, 2009 Description: YLL017W.t2k DSSP-EHL2 2 1 E E E E E E E EEEEEEXXXXEEXXXXXXHHHHHHXXE X X X X X X X CCCCCCCCCCCCCCCCCCCCCCCCCCCCCC E X X X X X X X X 1 10 20 30 40 E 2 1 S T T 51 60 70 80 90 E 2 1 C H H H X X X T S E T T T E T G E S CC 101 RG ... Date Added: 2009-06-05 15:09:49 |
| YLL038C.t2k.stride-ebghtl-logo.pdf Path: UCSC >> YLL >> 038 Fall, 2009 Description: YLL038C.t2k EBGHTL 3 2 1 CHH H C C X X X X 1 10 20 30 40 H 3 2 1 H T H H HHHHHHHHHHHH X X X X X X X X X X G C H H X X X X X X X X X CC CT TCCCTTT TTC C H T T C T C X X X X X X X X X H H X 51 60 70 80 90 T 3 2 1 H H HHH ... Date Added: 2009-06-05 15:10:03 |
| Chapter 09.ppt Path: UPenn >> OPIM >> 910 Fall, 2007 Description: CHAPTER 9: INTEGER PROGRAMMING to accompany Introduction to Mathematical Programming: Operations Research, Volume 1 4th edition, by Wayne L. Winston and Munirpallam Venkataramanan Presentation by H. Sarper 1 Copyright 2003 Brooks/Cole, a division... Date Added: 2009-06-05 15:11:04 |
| Chapter 16.ppt Path: UPenn >> OPIM >> 910 Fall, 2007 Description: Chapter 16 Neural Networks to accompany Introduction to Mathematical Programming: Operations Research, Volume 1 4th edition, by Wayne L. Winston and Munirpallam Venkataramanan by: H. Sarper 1 Copyright 2003 Brooks/Cole, a division of Thomson Lear... Date Added: 2009-06-05 15:11:05 |
| Primal and dual problems.doc Path: UPenn >> WEEK >> 910 Fall, 2009 Description: An example of dual problems 1 Primal Problem min s.t : (3x1 - 7x2) 2x1 + x2 = 5 x1 - x2 9 -2x1 + 3x2 2 x1 0 (1) (2) (3) (4) (5) Change the second inequality constraint and multiply both sides of the constraints by (u1), u2 0, u3 0, respectively... Date Added: 2009-06-05 15:11:08 |
| Group 8 comments.doc Path: UPenn >> OPIM >> 910 Fall, 2007 Description: Group 8 - Investment Management Jian\'s project Nothing to say. My comments A very similar project was done (very well) last year. You should do something a bit different. You might want to target a specific investment type, like a retirement fund. Y... Date Added: 2009-06-05 15:11:14 |
| Ch 10.pdf Path: CSU Chico >> GT >> 222 Fall, 2009 Description: CHAPTER 10 Other verb usage patterns This chapter deals with several other verb usage patterns. Two of these patterns involve the patterns of tenses between main and subordinate clauses. One pattern is used in indirect address, when direct quotatio... Date Added: 2009-06-05 15:14:08 |
| Chapter 30 Pathogenecity of Microorganisms.ppt Path: Kennesaw >> BIOL >> 3340 Fall, 2008 Description: Chapter 30 Pathogenicity of Microorganisms HostParasite Relationships commensalism Saprophytic organisms mutualism parasitism the \"living together\" of two organisms in a variety of relationships Symbiosis obtain nutrients from dead or decaying o... Date Added: 2009-06-05 15:14:48 |
| 326Quiz3.pdf Path: Wisconsin >> MATH >> 326 Fall, 2009 Description: Math 234 Quiz 3 Solutions 27 September 2007 Let z = z(x, y) be a differentiable function of x and y and let x = x(t, s) and y = y(t, s) be differentiable functions of t and s a. (4 points) Use the Chain Rule to write down expressions for the parti... Date Added: 2009-06-05 15:14:57 |
| helper_12-08-08.pdf Path: BU >> MATH >> 225 Fall, 2009 Description: 8% ( 15vd$arp% 6HH 0 7 6 z E3 E 0 6 % I E C% ( 7E3 23 ( @ 3 @ 7H 0 6E 2 0 23 7 ( 7E ( C 2 7E (E% I &A1AGH!}|5PA11yA1|1P$h9%5GG75!G(A!A531G$9HG%A1!`0y$G3UA$d}1~ ( 7E ( C 2 7E (E% I 3 H3 q ( E ywt vt r 23 n$G%g11`053U$dr5P1A!gxAu`sf92$f`%C... Date Added: 2009-06-05 15:15:16 |
| 2005629_r01x_04CV00136.pdf Path: Stanford >> MUSEE >> 1029 Fall, 2009 Description: BERMAN DEVALERIO PEASE TABACCO BURT & PUCILL O ATTORNEYS AT LA W 425 CALIFORNIA STREET, SUITE 2025 SAN FRANCISCO, CA 9410 4 TEL : (415) 433-3200 ONE LIBERTY SQUARE BOSTON , MA 02109 TEL : (617) 542-6300 FAX : (617) 542-1 (94 FAX : (415) 433-638 2 WWW... Date Added: 2009-06-05 15:15:21 |
| 0437-4715.pdf Path: UF >> PHYS >> 6347 Fall, 2009 Description: ... Date Added: 2009-06-05 15:17:23 |
| Zitzewitz.pdf Path: UF >> PHY >> 4802 Fall, 2009 Description: Instrumentation for Scientists Linking the physical/chemical and electrical worlds in the scientific laboratory Scale position Physical and chemical domains Number Conductivity, Potential difference, V Current, I Non-electrical domains Electrical... Date Added: 2009-06-05 15:17:39 |
| 2020-hw-p5.doc Path: UF >> PHYS >> 2020 Fall, 2009 Description: ... Date Added: 2009-06-05 15:17:54 |
| power_13.ppt Path: UCSB >> ECON >> 240 Fall, 2009 Description: The Vision Thing Power Thirteen Bivariate Normal Distribution 1 Outline Circles around the origin Circles translated from the origin Horizontal ellipses around the (translated) origin Vertical ellipses around the (translated) origin Sloping el... Date Added: 2009-06-05 15:18:29 |
| XM14-02.xls Path: UCSB >> ECON >> 240 Fall, 2009 Description: Teenager 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 Sunday 65 90 30 72 70 90 43 88 96 60 75 74 49 76 66 30 53 76 59 40 82 83 102 78 131 62 62 78 66 78 83 ... Date Added: 2009-06-05 15:18:52 |
| 2048_HITT_02-01-08.pdf Path: UF >> PHY >> 2048 Fall, 2008 Description: HITT: Question A massless rope is used to swing an object with mass m = 2 kg around in a circle of radius R = 2 m. If the object undergoes uniform circular motion with a constant speed v = 2 m/s and if there is no gravity present, what is the tensio... Date Added: 2009-06-05 15:19:16 |
| lab_8.doc Path: UCSB >> ECON >> 240 Fall, 2009 Description: Nov. 28, 2007 Lab #8 Econ140A/240A-1 L. Phillips Goodness of Fit, Chi-Square, and Contingency Table Analysis I. Goodness of Fit For A Variable with the Multinomial Distribution This is an example from the text, Chapter 16, problem 16.7, p.555. It use... Date Added: 2009-06-05 15:20:05 |
| ps_5.doc Path: UCSB >> ECON >> 240 Fall, 2009 Description: Nov. 1, 2007 Due Nov 8, 2007 1. 2. Ch. Six: Problems 6.75, 6.77, and 6.82 Ch. 7: Problems 7.116 and 7.117 Econ 140A/240A-1 L. Phillips 3. Ch. 8: Problems 8.75 and 8.76. ... Date Added: 2009-06-05 15:20:06 |
| lab_3.doc Path: UCSB >> ECON >> 240 Fall, 2009 Description: 4-19-2006 Lab Three 1 I. Simulation of an Autoregressive Process of Order One, AR(1) Open Eviews Object Menu: New Workfile Object: \"Autoregressive\" Frequency: undated observations: 1 1000 Workfile Menu: GENR \"WN=NRND\" Workfile Menu: GENR \"ARONE=W... Date Added: 2009-06-05 15:20:31 |
| hw04.pdf Path: University of Illinois, Urbana Champaign >> MATH >> 553 Spring, 2008 Description: Math 553 - Fall 2007 - Homework 4 Due: Friday 28 September, by 5pm. (1) Fix p < 1. Show that 1 |x|p = (-p) x |x|p+1 |x| weakly in R2 . Hints. This formula is a vector equation with x = (x1 , x2 ) R2 , and so really you are being asked to prove that... Date Added: 2009-06-05 15:22:21 |
| swarchch2.ppt Path: UConn >> CSE >> 298300 Fall, 2009 Description: Software Architectures Chapter 2: Architectural Styles CSE300 Prof. Steven A. Demurjian, Sr. Computer Science & Engineering Department The University of Connecticut 191 Auditorium Road, Box U-155 Storrs, CT 06269-3155 steve@engr.uconn.edu http:/www.... Date Added: 2009-06-05 15:23:10 |
| geog-10.pdf Path: East Los Angeles College >> OPEN >> 6788 Fall, 2009 Description: 3029-ch10.qxd 6/5/02 9:00 PM Page 207 10 Inhabiting: Landscapes and Natures Steve Hinchliffe This chapter opens up a number of questions regarding human and non-human relations. The focus is on landscape practices, which shape and are shaped by t... Date Added: 2009-06-05 15:23:33 |
| 9_23.txt Path: Penn State >> MTB >> 401 Spring, 2009 Description: Extens Quality 1.20 High 0.90 High 0.70 High 1.00 High 1.70 High 1.70 High 1.10 High 0.90 High 1.70 High 1.90 High 1.30 High 2.10 High 1.60 High 1.80 High 1.40 High 1.30 High 1.90 High 1.60 High ... Date Added: 2009-06-05 15:24:47 |
| helper_3-31-06.pdf Path: BU >> MATH >> 226 Fall, 2009 Description: t \'% | z xt w v t r u Y3 % \' 3 @ %\' % \' i T 3% 8 6%\'% 3 % 8\' 6 t i @ rR H% E @% 8% % @ 8H E @ P)mPlY)`i7)9jiyhCWg0PFg f 0AQ0FgY&R w f R E 8 6R @ E R D 8... Date Added: 2009-06-05 15:26:23 |
| Cases17.pdf Path: Michigan >> LAW >> 710 Winter, 2008 Description: PATRICK DEMERY v. EXTEBANK UNITED STATES COURT OF APPEALS FOR THE SECOND CIRCUIT 216 F.3d 283 June 15, 2000, Decided JOHN M. WALKER, JR., Circuit Judge: The sole question in this case is whether a certain deferred compensation plan is a so-called \"to... Date Added: 2009-06-05 15:27:10 |
| samples good and bad. ch2.ppt Path: SEMO >> MA >> 155 Fall, 2009 Description: Samples, Good and Bad MA155 Chapter 2 Dr. Imad Khamis How Can You Goof Up Sampling? Bias Geographical Generational Informational Financial There\'s More! Biased Sampling Methods Bias Systematically favors certain outcomes Convenience Samplin... Date Added: 2009-06-05 15:27:52 |
| Instructional Design Models1.ppt Path: Penn State >> JLG >> 506 Fall, 2009 Description: Instructional Design Models Learning theory + curriculum (philosophy) + instructional design = learning EDUC 506 Standards Helping develop your knowledge base 1.4 Demonstrate complete understanding of the three major categories of learning theory... Date Added: 2009-06-05 15:29:30 |
| 09DailyQuiz7Solution.pdf Path: UNC Charlotte >> MATH >> 3128 Spring, 2008 Description: ... Date Added: 2009-06-05 15:33:51 |
| 09DailyQuiz19Solution.pdf Path: UNC Charlotte >> MATH >> 3128 Spring, 2008 Description: ... Date Added: 2009-06-05 15:33:53 |
| lec5ts.pdf Path: University of Illinois, Urbana Champaign >> STAT >> 400 Fall, 2008 Description: Review: Set of Algebra Enumerate Conditional Probability Definition Two equations STAT400: Independence Tuesday: Lecture 5 2/5/2009 STAT400: WENXUAN ZHONG 1 2/5/2009 STAT400: WENXUAN ZHONG 2 I Definition Intuitive: Outcome of one even... Date Added: 2009-06-05 15:34:30 |
| ErrorNotes.pdf Path: Los Angeles Southwest College >> MATH >> 520 Fall, 2009 Description: DIFFERENTIAL EQUATIONS: A MODELING APPROACH by Glenn Ledder Corrections for the First Printing Corrections to the Exercise Statements p. 162, Exercise 3.3.24 The reference should be to Exercise 23, not Exercise 22. p. 168, Exercise 3.4.6 The differe... Date Added: 2009-06-05 15:34:44 |
| Carboxypeptidase.ppt Path: Rose-Hulman >> CHE >> 545 Fall, 2009 Description: Carboxypeptidase Carboxypeptidase B Carboxypeptidase B is used (primarily) in the manufacture of recombinant human insulin (Eli Lilly) About 20 kg are needed per year for the Lilly process Biochemistry Carboxypeptidase B catalyzes the removal of... Date Added: 2009-06-05 15:34:47 |
| ElectromagneticSpectrum.doc Path: Western Kentucky University >> BIO >> 475 Fall, 2009 Description: Electromagnetic Spectrum The electromagnetic spectrum covers a wide range of wavelengths and photon energies. Light used to \"see\" an object must have a wavelength about the same size as or smaller than the object. The ALS generates light in the far ... Date Added: 2009-06-05 15:36:01 |
| 12808.pdf Path: East Los Angeles College >> OPEN >> 12808 Fall, 2009 Description: Artificial Intelligence for Engineering Design, Analysis and Manufacturing (2007), 21, 227242. Printed in the USA. Copyright # 2007 Cambridge University Press 0890-0604/07 $25.00 DOI: 10.1017/S089006040700025X Externalizing tacit overview knowledge:... Date Added: 2009-06-05 15:37:03 |
| phys778readinglist_07.pdf Path: St. Mary MD >> PHYS >> 778 Fall, 2009 Description: PHYSICS 778: STAR FORMATION Course Reading List 1. Turbulent fragmentation: Ballesteros-Paredes, J. et al, 2007, Protostars and Planets V Elmegreen, B.G., Klessen, R.S. 2004, Rev. Mod. Phys., 76, 1... Date Added: 2009-06-05 15:37:26 |
| JMECymbals.pdf Path: Brookdale >> MYWEB >> 3303 Fall, 2009 Description: The Cymbal as an Instructional Device for Materials Education Mary Anne White and Peter MacMillan Department of Chemistry and Institute for Research in Materials, Dalhousie University, Halifax, Nova Scotia B3H 4J3, Canada ABSTRACT The materials scien... Date Added: 2009-06-05 15:38:12 |
| DRAFT_SSRD_LCO_QR_F04a_T11.xls Path: USC >> CSCI >> 577 Fall, 2009 Description: 0c7879fe73aaf98b4422d73b9eedee7fde16e934.xls - Areas of Concern Log Project Name: Team 11 Artifact: LCO 0.3 Module: n/a Inception MBASE Phase/level: Activity: Agile Internal Review Form Exit Criteria: print copy Review # Review Date: Review Time: SSR... Date Added: 2009-06-05 15:39:55 |
| Theory of Propulsion 3.ppt Path: UF >> EAS >> 4300 Spring, 2008 Description: THEORY OF PROPULSION 3. Conservation Equations P. M. SFORZA University of Florida Species conservation equation i V A d i/dt dz i+d i V+dV A+dA i - iVA + ( i + d i ) ( V + dV ) ( A + dA ) = Adz t -(rate of species i into CV)+(rate of species i ou... Date Added: 2009-06-05 15:40:32 |
| 13.0 Liquid Rockets 12-08.doc Path: UF >> EAS >> 4300 Spring, 2008 Description: Theory of Propulsion 13.0 LIQUID ROCKETS 13.1 Rocket Nozzles The rocket is the simplest jet propulsion device in that it carries all its propellant and liberates the chemical energy in that propellant under virtually quiescent conditions in the combu... Date Added: 2009-06-05 15:40:36 |
| Appendix A - Gas Dynamics Tables.doc Path: UF >> EAS >> 4300 Spring, 2008 Description: Theory of Propulsion APPENDIX A: SHOCK WAVES A.1 Normal Shock Wave Relations Regions of isentropic flow may be separated by discontinuities within which the entropy jumps. These abrupt transitions from one value of entropy to a higher one are called ... Date Added: 2009-06-05 15:40:37 |
| Teaching_and_Learning_Mangement_Plan_1998.pdf Path: Allan Hancock College >> PAGE >> 133646 Fall, 2009 Description: ... Date Added: 2009-06-05 15:40:50 |
| VermedPediatric.pdf Path: Air Force Academy >> SAL >> 426 Fall, 2009 Description: Tender-TrodeTM Tender Care for Tender Patients Vermed\'s Tender-Trode TM line represents a complete selection of electrodes for infant and pediatric use. Each electrode is carefully designed with gentle, hypoallergenic adhesives and soft conforming m... Date Added: 2009-06-05 15:40:56 |
| 101A_hw7.pdf Path: UCSD >> CENG >> 101 Fall, 2008 Description: ... Date Added: 2009-06-05 15:41:50 |
| hw6.pdf Path: UCSD >> MAE >> 294 Fall, 2008 Description: MAE294B/SIO203B: Methods in Applied Mechanics Winter Quarter 2003 Homework VI Due February 27, 2003. 1 Evaluate the following integrals: 1 0 2 0 3 0 dx (/18), + 1)(x2 + 4) cos x dx (a-1 e-a for a > 0; what happens when a < 0?) x2 + a2 dx (/n... Date Added: 2009-06-05 15:41:54 |
| photoho.pdf Path: Western Washington >> BIOL >> 205 Fall, 2008 Description: Plants and other autotrophs are the primary producers of the biosphere Organisms acquire organic molecules used for energy and carbon skeletons by one of two nutritional modes: 1) Autotrophy or 2) Heterotrophy. Autotrophy = (Auto = self, trophos = fe... Date Added: 2009-06-05 15:42:32 |
| chp7-notes.pdf Path: Blinn >> HELP >> 1324 Fall, 2009 Description: c ROB EBY Blinn College Department of set, roster notation A = {f, 1, 2, 3, g}, ways to write a Mathematics Chapter 7 Notes These are not intended to be fully comprehensive notes. Instead, they are intended to cover the major points of this chapter.... Date Added: 2009-06-05 15:42:55 |
| dampedvibeplot.pdf Path: Michigan State University >> ME >> 461 Fall, 2008 Description: 1 0.8 0.6 1 0.5 0 0.4 0.2 0 0 100 200 300 400 -0.5 -1 0 1 0.5 0 -0.5 -1 0 100 200 300 400 1 0.5 0 -0.5 -1 0 100 200 300 400 100 200 300 400 ... Date Added: 2009-06-05 15:43:17 |
| hw1sol.ps Path: UMass Lowell >> CS >> 305 Fall, 2009 Description: %!PS-Adobe-2.0 %Creator: dvipsk 5.58f Copyright 1986, 1994 Radical Eye Software %Title: hw1sol.dvi %Pages: 2 %PageOrder: Ascend %BoundingBox: 0 0 612 792 %EndComments %DVIPSCommandLine: dvips hw1sol %DVIPSParameters: dpi=600, compressed, comments rem... Date Added: 2009-06-05 15:44:52 |
| email.txt Path: Iowa State >> FOD >> 040611 Fall, 2009 Description: From: \"Nick Salmon\" Date: Fri, 11 Jun 2004 19:50:13 -0500 Subject: Hail in Fort Dodge 6pm 6-11-04 Hey John Mc and Troops, We had some scares as the st... Date Added: 2009-06-05 15:46:02 |
| email.txt Path: Iowa State >> AGRON >> 040826 Fall, 2009 Description: From: \"Kevin Fister\" Date: Thu, 26 Aug 2004 20:20:50 -0500 Subject: Weather pictures I took these pictures from my home in Guthrie Center, IA at 8:00pm Thursday Aug 26th, 2004. Just thought I would share them. Thanks Kevin Fister ... Date Added: 2009-06-05 15:46:14 |
| Chap007.ppt Path: Laurentian >> MGT >> 3040 Fall, 2009 Description: Chapter Seven Interest Rates and Bond Valuation 2003 The McGrawHill Companies, Inc. All rights reserved. 7.2 Key Concepts and Skills Know the important bond features and bond types Understand bond values and why they fluctuate Understand bo... Date Added: 2009-06-05 15:46:43 |
| T1.pdf Path: Georgia Tech >> MATH >> 1512 Fall, 2008 Description: # $ $ % # $ % # $ ! \" ! \" \" ! \" \" # ! ... Date Added: 2009-06-05 15:46:44 |
| chapter5b.doc Path: IUPUI >> M >> 119 Fall, 2009 Description: MATH 119 Chapter 5 Test (Sample B ) NAME: 1) Values of a function W (t ) are given in the table to the right. a) Estimate t 1 1.4 1.8 2.2 2.6 3 W ( t ) 25 28 35 45 50 60 W (t )dt 1 3 from left and from right then average them Left sum: Right... Date Added: 2009-06-05 15:49:37 |
| main_PAIO.c.txt Path: TN Tech >> ME >> 4370 Fall, 2009 Description: #include <hidef.h> /* common defines and macros */ #include <mc68hc912b32.h> /* derivative information */ #pragma LINK_INFO DERIVATIVE \"Sample12\" void main(void) { DDRA = 0xFF; while( 1 ) { PORTA = 85; / even pins for(i=1;i... Date Added: 2009-06-05 15:50:47 |
| Milestones in Atomic Theory[Ch2] 1.doc Path: Iowa State >> CHEM >> 177 Fall, 2008 Description: Outline of the History of Atomic Theory and the Periodic Table 400 500 BC Greek philosophers suggested that matter consisted of indivisible fundamental particles. In the 5th century, Democritus named the particles \"atoms\" from the Greek word for ind... Date Added: 2009-06-05 15:50:59 |
| ENT496 - Final.ppt Path: CSU San Marcos >> I >> 0603 Fall, 2009 Description: Network Management/Security Alan Blanks, CCNP Project Advisors: Dr. Sulbaran, Mr. Crosby, Mr. Johnsey Outline Background Existing Structure Internship Activities Objective Overall Results Personal Growth Background Innovation for Constructi... Date Added: 2009-06-05 15:51:14 |
| section1-3.pdf Path: Adams State >> CSCI >> 200 Fall, 2009 Description: The Foundations Predicates and Quantifiers Quantifiers Name Symbol Meaning For all x, P(x) For every x, P(x) For each x, P(x) For any x, P(x) There exists an x such that P(x) is true \"For some x\" \"For at least one x\" There exists exactly one x such ... Date Added: 2009-06-05 15:51:46 |
| slac-pub-8570.pdf Path: Stanford >> PUBS >> 8500 Fall, 2009 Description: SLAC-PUB-8570 August 2000 Comparison of Discrete Klystron Produced RF to Two-Beam Produced RF for Large Accelerator Systems Rainer Pitthan Invited talk presented at The 9th Workshop on Advanced Accelerator Concepts, 6/10/2000-6/16/2000, Santa Fe, ... Date Added: 2009-06-05 15:52:09 |
| Assignment2-Spring 08-OH & headings example.doc Path: University of Iowa >> PSYCHOLOGY >> 31043 Fall, 2009 Description: Assignment 2 Method Due 2/26/07 Due Tuesday at beginning of lecture in 6th week of classes 1-2 pages, 12 font, double-spaced; Worth 9 points All group members\' names, TA name, discussion section day/time Your paper should contain the following... Date Added: 2009-06-05 15:53:13 |
| clarknotes.pdf Path: University of Iowa >> PSYCHOLOGY >> 31141 Fall, 2009 Description: ... Date Added: 2009-06-05 15:53:22 |
| Lab1a.pdf Path: Maharishi >> CS >> 450 Fall, 2009 Description: Computer Networks Lab 1 Use Telnet to Contact a Time Server, get a Web Page and Send an Email Purpose: To learn how to use telnet to experiment with some application layer protocols. Overview: Use the telnet program to open a connection with network... Date Added: 2009-06-05 15:53:33 |
| Lab1a-telnet.pdf Path: Maharishi >> CS >> 450 Fall, 2009 Description: Computer Networks Lab 1 Use Telnet to Contact a Time Server, get a Web Page and Send an Email Purpose: To learn how to use telnet to experiment with some application layer protocols. Overview: Use the telnet program to open a connection with network... Date Added: 2009-06-05 15:53:37 |
| Ex3-00.pdf Path: Vanderbilt >> CHEM >> 231 Fall, 2009 Description: NAME: (please print) CHEMISTRY 231 - Tellinghuisen 3rd Hour Exam - 4/12/00 Honor Code Pledge and Signature: Fundamental Constants: R (mol1 K1) = 8.31451 J = 0.0820578 L atm = 1.9872 cal; F = 96485.3 C/mol I. (35) Galvanic Cells. The Daniell cell... Date Added: 2009-06-05 15:54:14 |
| 1303lectsyll-sat.doc Path: Texas El Paso >> GEO >> 1303 Fall, 2009 Description: GEOL 1303, Principles of Earth Science 1, Course Reference # 16312 Saturdays 0930-1120, 1 SEP 2001 15 DEC 2001 UTEP Geosciences BLDG, Room 123 Instructor: Anthony D. Feig (pronounced Feig as in leg, beg, keg) Office: GEOL 207. Phone: 747.5507. emai... Date Added: 2009-06-05 15:54:55 |
| lab2partb.pdf Path: Wisconsin >> ME >> 368 Fall, 2008 Description: Lab #2: Analog Oscilloscope Laboratory Part B The fundamental building block, and often most overlooked aspect of an instrument is the power supply. It is tacitly believed that the specifications provided by the manufacturer are accurate, and repre... Date Added: 2009-06-05 15:55:29 |
| EM_lecture_30.pdf Path: Georgia Tech >> PHYSICS >> 2212 Fall, 2009 Description: Hall effect Page 1 Hall effect Page 2 Hall effect Page 3 Hall effect Page 4 Hall effect Page 5 Hall effect Page 6 ... Date Added: 2009-06-05 15:56:17 |
| studentconnect-profile.pdf Path: Allan Hancock College >> PAGE >> 55946 Fall, 2009 Description: ... Date Added: 2009-06-05 15:56:56 |
| 111hw05.doc Path: Loyola Chicago >> HW >> 111 Fall, 2009 Description: HOMEWORK: SET 5 Newton\'s 2nd Law and Accelerated Motion 1) A constant force of 20 N acts on an object initially at rest on a smooth horizontal surface. The object is observed to move a distance of 25 meters in 5 seconds. a) What is the object\'s mass... Date Added: 2009-06-05 15:57:50 |
| CIF.pdf Path: Laurentian >> CHEM >> 4000 Fall, 2009 Description: The following brief description of the CIF format that is used very widely to distribute Xray structural information for molecular crystals is taken from a very practical handbook on crystal structure determination: \"Crystal structure analysis, princ... Date Added: 2009-06-05 15:57:55 |
| 130-02-2009-S-Grades-public.xls Path: Willamette >> MATH >> 130 Fall, 2009 Description: MATH 130-02 Fall 2009 Worksheets 1 2 3 Kiwikit 10 9 Junior English 10 10 9 Junior History 10 3455 10 9.5 10 Bolt 10 9 10 9853 Senior 10 10 Sociology 10 Pinky & the Brain 9 Senior Anthropology 10 10 P.J. Harvey 9 Senior Anthropology 9 10 Daisy 10 Sen... Date Added: 2009-06-05 15:58:27 |
| totals.pdf Path: Washington >> GENET >> 570 Fall, 2009 Description: 3.0 3.5 4.0 90 100 110 120 130 140 150 160 170 180 Genetics 570 Distribution of course point totals with indication of grade scale ... Date Added: 2009-06-05 15:58:47 |
| 220-2002-X06-Final.doc Path: Portland >> ARCH >> 220 Fall, 2009 Description: PSU ARC 220 2002 CHRISTIE | MOSBY | SHIGA | YOUNG | ZAL EXPLORATION 06 BUILT PROJECT Reading + Analyzing + Documenting + Interpreting phenomenology (f -n m -n l -j ) n. 1. A philosophy or method of inquiry based on the premise that reality consists o... Date Added: 2009-06-05 15:59:32 |
| 1976rcs1-225.pdf Path: Neumont >> CSC >> 1975 Fall, 2009 Description: ... Date Added: 2009-06-05 16:00:34 |
| 07Processing2.pptx Path: SUNY Buffalo >> CSE >> 562 Fall, 2009 Description: CSE 562 Database Systems Query Processing: Algebraic Optimization Click to edit Master subtitle style Some slides are based or modified from originals by Database Systems: The Complete Book, Pearson Prentice Hall 2nd Edition 2008 GarciaMolina, Ullma... Date Added: 2009-06-05 16:00:50 |
| 358- 6.pdf Path: UWO >> SS >> 358 Fall, 2009 Description: ... Date Added: 2009-06-05 16:01:02 |
| qos.pdf Path: Princeton >> COS >> 461 Spring, 2009 Description: Realtime Applications Require \"deliver on time\" assurances Quality of Service Outline Realtime Applications Integrated Services Differentiated Services must come from inside the network Microphone Sampler , A D converter Buffer , D A Speaker Ex... Date Added: 2009-06-05 16:01:56 |
| unparsing4.ps Path: Princeton >> COS >> 320 Spring, 2009 Description: vti_encoding:SR|utf8-nl vti_syncwith_localhost\\j\\:\\www\\courses\\cs320/j\\:/www/courses/cs320:TR|25 Feb 2003 22:30:45 -0000 vti_timelastmodified:TR|25 Feb 2003 22:30:45 -0000 vti_syncwith_localhost\\x\\:\\courses\\archive\\spring03\\cs320/x\\:/courses/archive/... Date Added: 2009-06-05 16:02:09 |
| Phillips.pdf Path: Allan Hancock College >> PAGE >> 71727 Fall, 2009 Description: Population Structure of the Western Rainbowfish, Melanotaenia australis in the East Kimberley. Photo: A. W. Storey Photo: G. R. Allen By Ryan Phillips Submitted in partial fulfilment of the Bachelor of Science (Honours) Degree School of Animal Bio... Date Added: 2009-06-05 16:02:14 |
| Email Quiz2.doc Path: Oregon State >> BA >> 131 Fall, 2008 Description: Email Quiz Take out paper/pen/pencil. Write your Name, User Name and Date in the upper RIGHT of your paper. Answer the following questions. Be precise and brief. Hand in your paper as soon as you are done. 1. How much storage space do you have in... Date Added: 2009-06-05 16:02:36 |
| Class38Program.xls Path: Bucknell >> PHYS >> 222 Fall, 2009 Description: Uo= dx= E= psi(0)= psi\'(0)= x 0 0.01 0.02 0.03 0.04 0.05 0.06 0.07 0.08 0.09 0.1 0.11 0.12 0.13 0.14 0.15 0.16 0.17 0.18 0.19 0.2 0.21 0.22 0.23 0.24 0.25 0.26 0.27 0.28 0.29 0.3 0.31 0.32 0.33 0.34 0.35 0.36 0.37 0.38 0.39 0.4 0.41 0.42 0.43 0.44 0.... Date Added: 2009-06-05 16:02:46 |
| psyc3510syl.doc Path: Clayton >> PSYC >> 3510 Fall, 2009 Description: PSYCH 3510 PSYCHOLOGICAL TESTS 1:30 2:00 pm E MAIL: williamhooper@mail.clayton.edu or by appointment TEXT: PSYCHOLOGICAL TESTING 5TH ED. R.Kaplan & D.Saccuzzo... Date Added: 2009-06-05 16:03:55 |
| 13.pdf Path: Acton School of Business >> MATH >> 443 Fall, 2009 Description: Math 443 Handout # 13 Let (M, d(x, y) be a metric space, and let x, y be elements of M , with x = y. If r = d(x, y), then B(y, r) is an open set in M that contains y but not x, and hence the topology on M determined by the metric satisfies the first... Date Added: 2009-06-05 16:05:32 |
| 26a.pdf Path: Acton School of Business >> MATH >> 443 Fall, 2009 Description: Math 443 Handout # 26a If X is a topological space, E X is countably compact, and A E is uncountable, then there is a condensation point p of A in E. This is analogous to the fact that compactness implies the strong limit point property. We have s... Date Added: 2009-06-05 16:05:36 |
| 41.pdf Path: Acton School of Business >> MATH >> 443 Fall, 2009 Description: Math 443 Handout # 41 Let X be a topological space, and suppose that {Ui }iI is a collection of open subsets of X such that X = iI Ui . If for every i I there is a collection Bi of open subsets of Ui which form a base for the topology of Ui , then ... Date Added: 2009-06-05 16:05:39 |
| 4c.pdf Path: Acton School of Business >> MATH >> 321 Fall, 2009 Description: Math 321 Handout # 4c Let (M, d(x, y) be a metric space. If E M , then E denotes the set of p M such that p is a limit point of E. The closure of E is denoted E and defined by E = E E . By definition, E M is a closed set if and only if E E, whi... Date Added: 2009-06-05 16:05:47 |
| 8c.pdf Path: Acton School of Business >> MATH >> 321 Fall, 2009 Description: Math 321 Handout # 8 c Let (M, d(x, y) be a metric space, let p be an element of M , and let E1 , E2 , . . . be a sequence of subsets of M . Suppose that En B(p, 1/n) for each n, and let E be the set consisting of p and the union of the En \'s. One ... Date Added: 2009-06-05 16:05:49 |
| lb5.pdf Path: Acton School of Business >> MATH >> 321 Fall, 2009 Description: Math 321 Introductory Lebesgue Measure Handout # 5 Let E1 , E2 be disjoint subsets of the real line, i.e., E1 E2 = . A basic question asks when the additivity conditions (E1 E2 ) = (E1 ) + (E2 ) and (E1 E2 ) = (E1 ) + (E2 ) (2) hold. Of course, o... Date Added: 2009-06-05 16:06:01 |
| 1973rcs0-493.pdf Path: Neumont >> CSC >> 1973 Fall, 2009 Description: R.C.S STANNARD KIDNER 493 Martin Cable Stannard and John Joseph Blouin and Plaintiffs Appellants Leroy Douglas Kidner Respondent 1972 October 17 18 1973 Present Laskin Defendant January 31 Spence and Martland Ritchie Hall JJ ON APPEAL FR... Date Added: 2009-06-05 16:06:11 |
| ex11_04_worksheet.pdf Path: NMSU >> TOP >> 216 Fall, 2009 Description: Worksheet for Exploration 11.4: Moment of Inertia and Angular Momentum A 1-kg red mass is incident on an identical black mass that is attached to a massless rigid string so that it can rotate around the origin as shown (position is shown in meters an... Date Added: 2009-06-05 16:06:59 |
| Presentation-Template.ppt Path: UCF >> COP >> 4331 Fall, 2009 Description: Project Presentation Format COP4331 Processes for OO Software Development Dr. David A. Workman March 20, 2009 Outline 1. Title Slide (Identify Project & Team) 2. Description of the Virtual World 3. Motivation for the Simulation What did you want to... Date Added: 2009-06-05 16:07:09 |
| acad_nag.pdf Path: UNLV >> CEE >> 301 Fall, 2008 Description: Autodesk Civil 3D 2007 Network Administrator\'s Guide April 2006 Copyright 2006 Autodesk, Inc. All Rights Reserved This publication, or parts thereof, may not be reproduced in any form, by any method, for any purpose. AUTODESK, INC., MAKES NO WARRA... Date Added: 2009-06-05 16:07:17 |
| exam2.pdf Path: UNL >> MATH >> 107 Spring, 2008 Description: Math 107 (Marley) TA: Exam II NAME: Fall 2007 This exam should have 4 pages; please check that it does. No books, notes, laptops or cell phones are to be used during this exam. Be sure to show all of your work! Problem Points Score 1 2 3 4 5... Date Added: 2009-06-05 16:08:03 |
| log.txt Path: Washington >> V >> 13500 Fall, 2009 Description: 000 (28342.000.000) 12/04 20:25:12 Job submitted from host: <128.95.94.28:4757> . 001 (28342.000.000) 12/04 22:47:03 Job executing on host: <172.25.101.195:1056> . 006 (28342.000.000) 12/04 23:07:11 Image size of job updated: 458524 . 005 (28342.000.... Date Added: 2009-06-05 16:11:01 |
| error.txt Path: Washington >> V >> 13500 Fall, 2009 Description: Starting test Glast-Gaudi job with job options file joboptions.txt Current time: Tue Dec 04 22:42:02 2007 ( 0 s elapsed) Area not found in title: assuming 60000 cm^2 Current time: Tue Dec 04 23:47:24 2007 ( 3922 s elapsed) ... Date Added: 2009-06-05 16:11:16 |
| submit.txt Path: Washington >> V >> 13500 Fall, 2009 Description: executable = allgamma_13746.bat universe = vanilla error = error.txt output = output.txt log = log.txt # set by submitting script Requirements= (OpSys = \"WINNT51\" ) initialdir = F:\\condor\\allgamma\\v13r5\\jobs13500-13999/13... Date Added: 2009-06-05 16:12:49 |
| error.txt Path: Washington >> V >> 13500 Fall, 2009 Description: Starting test Glast-Gaudi job with job options file joboptions.txt Current time: Tue Dec 04 23:03:51 2007 ( 0 s elapsed) Area not found in title: assuming 60000 cm^2 Current time: Wed Dec 05 00:09:42 2007 ( 3951 s elapsed) ... Date Added: 2009-06-05 16:13:00 |
| log.txt Path: Washington >> V >> 13500 Fall, 2009 Description: 000 (28483.000.000) 12/04 20:25:50 Job submitted from host: <128.95.94.28:4757> . 001 (28483.000.000) 12/05 00:12:17 Job executing on host: <172.25.101.88:1057> . 006 (28483.000.000) 12/05 00:32:25 Image size of job updated: 465032 . 006 (28483.000.0... Date Added: 2009-06-05 16:13:30 |
| submit.txt Path: Washington >> V >> 13500 Fall, 2009 Description: executable = allgamma_13549.bat universe = vanilla error = error.txt output = output.txt log = log.txt # set by submitting script Requirements= (OpSys = \"WINNT51\" ) initialdir = F:\\condor\\allgamma\\v13r5\\jobs13500-13999/13... Date Added: 2009-06-05 16:14:12 |
| lecture23.pdf Path: YCP >> CS >> 101 Fall, 2009 Description: Lecture 23 C# Continued Learning Objectives: Open File Dialog and Save File Dialog File Input/Output Try and Catch Working with Strings ListBoxes 1 OpenFileDialog and SaveFileDialog A Dialog Box is like a mini-form that pops up when you do som... Date Added: 2009-06-05 16:18:15 |
| lect_15powerspectrum.pdf Path: Wisconsin >> MP >> 573 Fall, 2009 Description: MEDICAL PHYSICS/BME 573: IMAGE SCIENCE Fall 2008 Holden Lecture 27. November 5, 2008 Spatial characteristics of noise: Apparent effects of spatial frequency composition; the power spectrum. Despite the fact that noise is never the same twice and has ... Date Added: 2009-06-05 16:19:37 |
| PS01309.txt Path: Case Western >> BXS >> 101 Fall, 2009 Description: >LT01_HORVU (Q42509) Low-temperature induced protein lt101.1 (Blt101) ( MGSATVLEVILAIILPPVGVFLRYKLGVEFWICLLLTILGYIPGIIYAVYVLVV >LT02_HORVU (Q9ARD5) Low-temperature induced protein lt101.2. MASATFIEVILAIILPPVGVFLRYGLAVEFWICLLLTLLGYIPGIIYAVYVLVA >OSR8_... Date Added: 2009-06-05 16:20:32 |
| p6.pdf Path: ECCD >> DOE >> 3909 Fall, 2009 Description: ... Date Added: 2009-06-05 16:20:32 |
| chap-07.pdf Path: Case Western >> EECS >> 423 Fall, 2009 Description: Fault Tolerance Chapter 7 Basic Concepts Dependability Includes Availability Reliability Safety Maintainability Failure Models Type of failure Crash failure Omission failure Receive omission Send omission Timing failure Response failure Value f... Date Added: 2009-06-05 16:23:30 |
| Xr12-50.xls Path: Laurentian >> ECON >> 200802 Fall, 2009 Description: Speeds 63 66 66 55 61 71 69 63 66 67 54 68 61 58 70 65 66 61 57 61 63 63 71 60 62 69 74 58 75 63 56 62 59 54 61 51 58 56 63 55 64 66 63 64 60 66 67 68 57 60 63 62 66 63 72 62 61 58 62 58 67 67 59 61 50 58 58 55 61 52 56 71 66 70 56 64 63 62 62 66 64... Date Added: 2009-06-05 16:28:17 |
| xsl1-4.ps Path: East Los Angeles College >> CS >> 153 Fall, 2009 Description: %!PS-Adobe-3.0 %Creator: groff version 1.18.1.4 %CreationDate: Wed Mar 5 10:14:01 2008 %DocumentNeededResources: font Helvetica-Bold %+ font Helvetica %+ font Helvetica-Oblique %+ font Courier-Bold %+ font Times-Roman %DocumentSuppliedResources: proc... Date Added: 2009-06-05 16:30:59 |
| Lab_Index_Page.pdf Path: Rose-Hulman >> ECE >> 351 Fall, 2009 Description: ECE 351 Lab Grades Lab Number Lab Name Page # Grade Initials 1 2 3 4 5 6 7 8 9 10 ... Date Added: 2009-06-05 16:31:42 |
| chapter12.pdf Path: Rose-Hulman >> ECE >> 454 Fall, 2009 Description: ... Date Added: 2009-06-05 16:31:48 |
| ECE351_HW5_P.pdf Path: Rose-Hulman >> ECE >> 351 Fall, 2009 Description: ECE 351 Homework #5 Due 10/6/06 Vcc Vcc + RB1 + - V2 DC = 15 Q3 Q2N3904 Q1 TIP31 D1N4001 D1N4001 + + - V3 DC = 15 D1 D2 D3 + RE1 Vo Vee D1N4001 Vin D1N4001 + RE2 + Load 8 Q2 TIP32 - D4 Q2N3906 Q4 + RB2 Vee Design the Darlington... Date Added: 2009-06-05 16:32:40 |
| ECE351-HW9-P.pdf Path: Rose-Hulman >> ECE >> 351 Fall, 2009 Description: ECE 351 HW#9 Due 11/14/2006 at 9:00. 8:00 a.m. 351 HW #10 Due 2/20/2006 at ECE Final Exam Tuesday 11/14/2006 at 9:00at 8am in a.m. Due 11/14/05 at 8:00 Final Exam Monday 2/20/2006 in O201 O101 Final exam Monday 11/14/05 at 8:00 a.m. in room G317. Pro... Date Added: 2009-06-05 16:32:40 |
| ES203 Lab3.pdf Path: Rose-Hulman >> ES >> 203 Fall, 2009 Description: ROSE-HULMAN INSTITUTE OF TECHNOLOGY Foundation Coalition Sophomore Engineering Curriculum ES 203 Electrical Systems Section 06 Laboratory Project 3 Location Laboratory, B-105 Equipment Agilent 34401A Digital Multimeter Agilent E3631A Power Supply Agi... Date Added: 2009-06-05 16:32:54 |
| LAB3.pdf Path: Rose-Hulman >> ECE >> 250 Fall, 2009 Description: II. Diode Switching Speed and Dynamic Response In this lab we will look at some of the dynamic properties of a diode. By dynamics, we mean the diode response over time due to changing input waveforms. For diodes, we are usually concerned with how f... Date Added: 2009-06-05 16:34:21 |
| NPDESfs2_06.pdf Path: Oregon State >> CE >> 543 Fall, 2008 Description: #\" !\" $ %& Storm Water Phase II Final Rule Fact Sheet Series Overview 1.0 Storm Water Phase II Final Rule: An Overview T his fact sheet profiles the Construction Site Runoff Control minimum control measure, one of six mea... Date Added: 2009-06-05 16:34:57 |
| Forensic_Botany_Lecture_1.pdf Path: Allan Hancock College >> PAGE >> 50060 Fall, 2009 Description: Part 1 \"Some commit murder, some get mixed up in murder, others have murder thrust upon them\" WHERE DO PLANTS FIGURE IN FORENSICS? ALMOST ALL PLANTS ARE TOXIC A cocktail of highly poisonous chemicals THE SOURCE OF NARCOTICS Cocaine, Heroin and Mar... Date Added: 2009-06-05 16:37:04 |
| u722_34c.pdf Path: CUNY Baruch >> CRJ >> 722 Fall, 2009 Description: create more jobs. The federal prison system is comprised of 61% drug offenders, so basically this war on drugs is the reason why the Prison Industrial Complex is a skyrocketing enterprise (Kemba Smith 1999). In two African American women were among t... Date Added: 2009-06-05 16:38:52 |
| cs3133-hw5.pdf Path: Columbia >> SH >> 553 Fall, 2009 Description: Data Structures in C 3133 Spring 2003 Columbia University Shlomo Hershkop Out: April 14 Due: April 30 Theory (90 points): 1. (5) What is a flow network? How do you find the maximum flow from a source node to a destination node? What is a real world ... Date Added: 2009-06-05 16:38:55 |
| 2260PQuiz4.pdf Path: UGA >> MATH >> 2260 Fall, 2008 Description: Math 2260 Practice Quiz 4 February 5, 2009 No calculators are permitted. You have 20 minutes to complete this quiz. Name : Student number: 1. (4 points) Find the area of the surface generated by revolving the curve y = 1 x 5 about the x-axis. x +... Date Added: 2009-06-05 16:43:49 |
| assignment_4.doc Path: N. Arizona >> MAT >> 239 Fall, 2008 Description: MAT 239 Spring 2007 Fourth Assignment Due Monday April 2nd 1. Use variation of parameters to solve a) b) c) y \' \'+ y = tan x y \' \'-4 y \'+3 y = 12e 3 x 1 + e 3x y\' \' \'- 3y\' \'+2 y\' = 2 xe x 2. Reduce the order of the following differential equatio... Date Added: 2009-06-05 16:44:06 |
| 24 Chaos - notes.pdf Path: BU >> BE >> 567 Fall, 2009 Description: ... Date Added: 2009-06-05 16:44:50 |
| Feng.Xj_BiophysJ_04.pdf Path: BU >> BE >> 567 Fall, 2009 Description: Biophysical Journal Volume 87 October 2004 21952202 2195 Optimizing Genetic Circuits by Global Sensitivity Analysis Xiao-jiang Feng,* Sara Hooshangi,y David Chen,y Genyuan Li,* Ron Weiss,yz and Herschel Rabitz* *Department of Chemistry, yDepartm... Date Added: 2009-06-05 16:44:53 |
| lecture8.pdf Path: Toledo >> MIE >> 363 Fall, 2009 Description: Scheduling The last step before actual production begins. This process varies for the types of production: process industries - determining the mix of ingredients or sequence of mixture production mass production - need to determine sequence of ord... Date Added: 2009-06-05 16:45:15 |
| midterm2_topics_06.pdf Path: UCSB >> CHEM >> 142 Fall, 2009 Description: Topics for the second midterm: Chem142A (Kahn, Summer 2006) You are expected to know all the material that was covered in the lecture. The following list, organized by textbook chapters, list concepts that I think are especially important. Chapter 4... Date Added: 2009-06-05 16:46:13 |
| RL-ARM Real-Time Executive (RTX).pdf Path: Auburn >> ELEC >> 5260 Spring, 2008 Description: Keil ARM Real-Time Library (RL-ARM) Real-Time Executive (RTX) Kernel Reference: Keil Help Files Using RTX in a project Project > Options for Target: Select: Operating System > RTX Kernel Copy RTX_Config.c from \\Keil\\ARM\\Startup for Philips LPC... Date Added: 2009-06-05 16:46:35 |
| dpechuli.txt Path: Virginia Tech >> CS >> 3204 Fall, 2000 Description: CS 3204: OS - Project 1 Grade = Student pid = dpechuli Grade = 103/125 1. Binary Tree Functionality (50 pts) a. Correct number of parent and child processes being generated (10 pts) b. Correct dat... Date Added: 2009-06-05 16:48:31 |
| lecture 4 notes - low pass filter.doc Path: CSU Channel Islands >> MAE >> 106 Fall, 2009 Description: Mechanical Systems Laboratory: Lecture 4 Analysis of a 1 -order, Low-Pass Filter Circuit in the Time and Frequency Domains The following circuit is a low-pass filter. It is useful to clean up signals with high frequency noise on them: st R C Vout V... Date Added: 2009-06-05 16:48:58 |
| Mechanical.xls Path: RIT >> P >> 08201 Fall, 2009 Description: 7204 8201 Platform Selection Criteria Robust Low Center of Gravity Ease of Manufacture Component Protection Modularity Weight Durbality Sum of 0 Sum of + Sum of Net Score 07204 (Ref) 0 0 0 0 0 0 0 7 0 0 0 8201 + + + 0 + 1 4 2 3 Weight 20 10 20 1... Date Added: 2009-06-05 16:50:22 |
| mic.pdf Path: Oklahoma State >> HOME >> 3222 Fall, 2009 Description: Here\'s How I Work 15 20 0 1 2 3 4 0 10 15 5 20 A 3 inch micrometer is selected Step 1 Record smallest measurement possible. Read the numbers on the sleeve. 2 3 Add the number of marks after the last number on the sleeve. (twentyfive thousa... Date Added: 2009-06-05 16:51:23 |
| 1964rcs0-375.pdf Path: Neumont >> CSC >> 1964 Fall, 2009 Description: Supreme Court of Canada Monarch Timber Exporters Ltd. v. Bell, [1964] S.C.R. 375 Date: 1964-03-23 Monarch Timber Exporters Ltd., McCorkle Brothers Logging Ltd., Menlo Construction Co. Ltd., Rue Creek Service Co. Ltd. (Plaintiffs) Appellants; and Ian ... Date Added: 2009-06-05 16:52:25 |
| StressDistChpt5.pdf Path: Clarkson >> ME >> 457 Fall, 2009 Description: Isotropic Material Axial Load x = x E z z x E x x x Composite Laminate Axial Load Parallel model uniform strain x = k x k=4 k=3 k=2 k=1 z E4 x E3 x x E2 x E1 x k = x k x x 1 = x 1 2 = x 2 x x x x z x x x Isotropic Material - B... Date Added: 2009-06-05 16:52:26 |
| HW13Sol.pdf Path: Clarkson >> ME >> 457 Fall, 2009 Description: ... Date Added: 2009-06-05 16:52:45 |
| EE321F05_Exam1_Solutions.pdf Path: Clarkson >> EE >> 321 Fall, 2009 Description: EE32101 SYS + SIGNAL PRO CARROLL,J 176 CAMP Number Hw#1 Hw#2 A#1 Hw#3 A#2 Hw#4 Hw#5 Hw#6 Hw#7 Hw#8 Hw#9 Proj Ex#1 Ex#2 Final Total Grade 137889 100 72 0 94 0 0 0 0 0 0 0 0 112 0 0 0.272 I 143986 97 77 1 111 0 0 0 0 0 0 0 0 111 0 0 0.274 I 137427 98 9... Date Added: 2009-06-05 16:52:58 |
| 09_routingbasics.pdf Path: Clarkson >> CS >> 454 Fall, 2009 Description: # \' ) * \' % $ # % ( % % % % ( , % 2 % . % % $ + ! ! \" * % % / 0 # % % . % * 3 % . % % 0 % ) % %( % % 6 + %( % 4 ( % % 7 + % ( % 7 0 % . % % 5 % % / % % ( & % 4+ . ... Date Added: 2009-06-05 16:53:29 |
| mid3ans.pdf Path: Emory >> MATHCS >> 361 Fall, 2009 Description: Math 361: Midterm III Answers 1 1. (a) 1 - e-1/2 - 2 e-1/2 . (b) 1 - e-5/2 . 1 (c) Fy (y) = 2 e-y/2 for y 0. 2. First get the cdf: Fmax (y) = P (Yj y)5 = Hence fmax (y) = Finally, 10 y 10 5 for y [0, 10]. 5y 4 105 y 0 for y [0, 10]. 5y 4 2... Date Added: 2009-06-05 16:53:37 |
| phys3170_lec04 (AProf Bostjan Kobe).pdf Path: Allan Hancock College >> PHYS >> 3170 Fall, 2009 Description: PHYS3170 Macromolecular crystallography A/Prof Bostjan Kobe Department of Biochemistry and Molecular Biology (SMMS) and IMB b.kobe@uq.edu.au, phone 3365 2132, room 76-159 Textbooks: Biophysical chemistry Part 2/ Charles R. Cantor, Paul R. Schimmel. ... Date Added: 2009-06-05 16:54:48 |
| phys1160_lec04-05.pdf Path: Allan Hancock College >> PHYS >> 1160 Fall, 2009 Description: Linear Motion What happens to an object if you push it across a desk? What happens when you stop pushing? A number of injuries are caused by falls. What affects the severity of the injury? What happens when two opposing rugby players collide? Moment... Date Added: 2009-06-05 16:55:01 |
| MECH2305_06_B.4_Va copy.pdf Path: Allan Hancock College >> MECH >> 2305 Fall, 2009 Description: MECH2305 Casting Fundamentals Prof Andrej Atrens A.Atrens@minmet.uq.edu.au Casting Fundamentals - Overview IMPORTANCE CASTABILITY ALLOY SOLIDIFICATION macrostructure segregation dentrites FLUIDITY test metal factors casting MOLD DESIGN ... Date Added: 2009-06-05 16:56:28 |
| foss_history.pdf Path: Allan Hancock College >> COMP >> 8440 Fall, 2009 Description: A Brief History of FOSS COMP8440: FOSSD Lecture 4 Early Days - 70s Early computers came with source Commercial focus was on hardware Strong academic influence No commercial advantage to restricting distribution Each machine vendor needed to de... Date Added: 2009-06-05 16:57:34 |
| spr05lect12.ps Path: SUNY Albany >> CSI >> 310 Fall, 2009 Description: %!PS-Adobe-2.0 %Creator: dvipsk 5.86 p1.5d Copyright 1996-2001 ASCII Corp.(www-ptex@ascii.co.jp) %based on dvipsk 5.86 Copyright 1999 Radical Eye Software (www.radicaleye.com) %Title: spr05lect12.dvi %Pages: 29 %PageOrder: Ascend %Orientation: Landsc... Date Added: 2009-06-05 16:58:00 |
| spr05lect12.ps Path: SUNY Albany >> L >> 310 Fall, 2009 Description: %!PS-Adobe-2.0 %Creator: dvipsk 5.86 p1.5d Copyright 1996-2001 ASCII Corp.(www-ptex@ascii.co.jp) %based on dvipsk 5.86 Copyright 1999 Radical Eye Software (www.radicaleye.com) %Title: spr05lect12.dvi %Pages: 29 %PageOrder: Ascend %Orientation: Landsc... Date Added: 2009-06-05 16:58:00 |
| final97f.ps Path: Duke >> CPS >> 110 Fall, 2009 Description: %!PS-Adobe-3.0 %BoundingBox: (atend) %Pages: (atend) %PageOrder: (atend) %DocumentFonts: (atend) %Creator: Frame 5.0 %DocumentData: Clean7Bit %EndComments %BeginProlog % % Frame ps_prolog 5.0, for use with Frame 5.0 products % This ps_prolog file is ... Date Added: 2009-06-05 16:58:52 |
| power3_wsn1.pdf Path: Washington University in St. Louis >> CSE >> 467 Fall, 2008 Description: Power Manager Chenyang Lu CSE 467S 1 HW vs. SW? Software (OS-based) power manager dominates due to flexibility Hardware and software co-design Software implements policy Hardware implements power change mechanisms Need standard interfaces t... Date Added: 2009-06-05 17:00:06 |
| homework_Homework_03_key.pdf Path: Washington >> CHEM >> 152 Fall, 2008 Description: ... Date Added: 2009-06-05 17:01:23 |
| Week 3 Reading 1996-8 Architecture BAC.pdf Path: Boston Architectural >> AR >> 501 Spring, 2009 Description: ... Date Added: 2009-06-05 17:01:43 |
| Alfredo_DPS Book_draft.pdf Path: Boston Architectural >> AR >> 501 Spring, 2009 Description: Subcultural Applications for Tomorrow\'s Design Community by Alfredo C. Rico-Dimas Instructor: Amy Korte Spring 2008 - Fall 2008 Final Review December xx, 2008 The Boston Architectural College Bachelor of Architecture Graduating Class of May 2009 Deg... Date Added: 2009-06-05 17:01:46 |
| 00000066.pdf Path: Carnegie Mellon >> DISK >> 05101163 Fall, 2009 Description: ... Date Added: 2009-06-05 17:02:36 |
| 00000231.pdf Path: Carnegie Mellon >> DISK >> 05101163 Fall, 2009 Description: ... Date Added: 2009-06-05 17:03:07 |
| 00000008.pdf Path: Carnegie Mellon >> DISK >> 05100790 Fall, 2009 Description: ... Date Added: 2009-06-05 17:03:18 |
| 00000045.pdf Path: Carnegie Mellon >> TERA >> 05102587 Fall, 2009 Description: ... Date Added: 2009-06-05 17:05:17 |
| 00000045.pdf Path: Carnegie Mellon >> DISK >> 05102587 Fall, 2009 Description: ... Date Added: 2009-06-05 17:05:17 |
| 00000160.pdf Path: Carnegie Mellon >> DISK >> 05101157 Fall, 2009 Description: ... Date Added: 2009-06-05 17:06:19 |
| 00000175.pdf Path: Carnegie Mellon >> DISK >> 05100298 Fall, 2009 Description: ... Date Added: 2009-06-05 17:07:56 |
| 00000326.pdf Path: Carnegie Mellon >> DISK >> 05100298 Fall, 2009 Description: ... Date Added: 2009-06-05 17:08:27 |
| 00000331.pdf Path: Carnegie Mellon >> DISK >> 05100298 Fall, 2009 Description: ... Date Added: 2009-06-05 17:08:28 |
| 00000439.pdf Path: Carnegie Mellon >> DISK >> 05100298 Fall, 2009 Description: ... Date Added: 2009-06-05 17:08:48 |
| 00000071.pdf Path: Carnegie Mellon >> TERA >> 05101104 Fall, 2009 Description: ... Date Added: 2009-06-05 17:10:38 |
| 00000071.pdf Path: Carnegie Mellon >> DISK >> 05101104 Fall, 2009 Description: ... Date Added: 2009-06-05 17:10:39 |
| 00000053.pdf Path: Carnegie Mellon >> DISK >> 05102014 Fall, 2009 Description: ... Date Added: 2009-06-05 17:10:57 |
| 00000280.pdf Path: Carnegie Mellon >> DISK >> 31004250 Fall, 2009 Description: ... Date Added: 2009-06-05 17:12:44 |
| 00000020.pdf Path: Carnegie Mellon >> DISK >> 05102862 Fall, 2009 Description: ... Date Added: 2009-06-05 17:13:22 |
| 00000008.pdf Path: Carnegie Mellon >> DISK >> 05101106 Fall, 2009 Description: ... Date Added: 2009-06-05 17:13:29 |
| 00000133.pdf Path: Carnegie Mellon >> DISK >> 05101572 Fall, 2009 Description: ... Date Added: 2009-06-05 17:14:46 |
| 00000062.pdf Path: Carnegie Mellon >> DISK >> 05102865 Fall, 2009 Description: ... Date Added: 2009-06-05 17:15:15 |
| tastetations.txt Path: Maryland >> CMSC >> 114 Spring, 2009 Description: Alias Q1 Q2 Q3 Q4 P1 P2 P3 P4 P5 P6 E1 E2 E3 Grade Opt tastetations 41 33 48 33 90 87 101 92 46 91 89 68 109 B 3 ... Date Added: 2009-06-05 17:18:21 |
| 8-2-BR-1.pdf Path: Allan Hancock College >> AGENDA >> 008 Fall, 2009 Description: Agenda, Volume 8, Number 2, 2001, pages 171-175 REVIEWS Anatomy of a Radical (?) Government Gwynneth Singleton (ed.), The Howard Government: Australian Commonwealth Administration 1996-1998, UNSW Press, Sydney, 2000 Reviewed by Peter Hay his volume ... Date Added: 2009-06-05 17:18:38 |
| SQ CH 13-15NA.pdf Path: Okaloosa-Walton >> FACULTY >> 20092 Fall, 2009 Description: Intro to Business Study Questions Ch 13 - 15 Multiple Choice Identify the choice that best completes the statement or answers the question. _ 1. When the average person defines a product, he or she usually considers only the product\'s _. a. physical ... Date Added: 2009-06-05 17:20:36 |
| lab3_exerc_sol.ps Path: East Los Angeles College >> NUME >> 202 Fall, 2009 Description: %!PS-Adobe-2.0 %Creator: dvips(k) 5.90a Copyright 2002 Radical Eye Software %Title: lab3_exerc_sol.dvi %CreationDate: Wed Mar 19 10:34:53 2003 %Pages: 6 %PageOrder: Ascend %BoundingBox: 0 0 596 842 %DocumentFonts: CMR12 CMBX12 CMMI12 CMSY10 CMEX10 CM... Date Added: 2009-06-05 17:21:03 |
| BIO 208A.pdf Path: Appalachian State >> CAS >> 20062007 Fall, 2009 Description: 2006-2007 Bachelor of Arts (BA) Degree Code 208A Checksheet for Biology Majors I. CORE CURRICULUM. 44 Chemistry 1101/1110 and 1102/1120 or Physics 1103-1104 will count toward science requirement. Math 1110 will count toward math requirement. Foreig... Date Added: 2009-06-05 17:23:00 |
| FLL236A.pdf Path: Appalachian State >> CAS >> 20052006 Fall, 2009 Description: 2005-2006 Bachelor of Science (BS) Teaching Degree Code 236A French Checksheet for Foreign Languages and Literatures Majors FRENCH EDUCATION (K-12) I. CORE CURRICULUM .. 44 See Core Curriculum checksheet for listing of all Foreign Language courses... Date Added: 2009-06-05 17:23:20 |
| sample3.pdf Path: New Mexico >> MATH >> 401 Fall, 2008 Description: REVIEW FOR TEST # 3 - MATH 401/501 - FALL 2006 December 5-7, 2006 Instructor: C. Pereyra 1. Let X R, and C positive real numbers. Suppose a function f : X R satisfies the following Hlder continuity property: o |f (x) - f (y)| C|x - y| , Show that... Date Added: 2009-06-05 17:24:56 |
| m162hc3sp09.doc Path: New Mexico >> M >> 162 Fall, 2009 Description: Math 162 SIPI Calculus I Homework Assignments Chapter 3 Calculus: Early Transcendentals, 6th Edition, J. Stewart Spring 2009 3.1 Derivatives of Polynomial and Exponential Functions 5, 7, 15, 17, 19, 21, 23, 25, 27, 29, 31, 33, 49, 51, 61, 73 3.2... Date Added: 2009-06-05 17:25:17 |
| 08 Joshua.pdf Path: Illinois State >> SED >> 373 Spring, 2008 Description: ... Date Added: 2009-06-05 17:28:06 |
| S 03-08.pdf Path: Ill. Chicago >> ECE >> 465 Fall, 2008 Description: ECE 465 : Digital Systems Design Module 03 : Boolean Algebras, Expressions, and Functions Solution 03.08 ab 00 01 10 11 ab 0 1 1 0 ab\' 0 0 1 0 a\'b 0 1 0 0 ab\' + a\'b 0 1 1 0 It can be easily seen that the column of ab is equal to the column ab\'... Date Added: 2009-06-05 17:28:23 |
| L5.ppt Path: Bowdoin >> CS >> 107 Fall, 2009 Description: Efficiency of Algorithms Csci 107 Lecture 5 Last time Algorithms for Find all occurences of target Find number of occurences of target Find number of values larger than target Find largest /smallest, sum, average Pattern matching Today Pa... Date Added: 2009-06-05 17:29:38 |
| H3-solution.ps Path: Bowdoin >> CS >> 231 Fall, 2009 Description: %!PS-Adobe-2.0 %Creator: dvips(k) 5.86 Copyright 1999 Radical Eye Software %Title: H3-solution.dvi %Pages: 2 %PageOrder: Ascend %BoundingBox: 0 0 612 792 %DocumentFonts: CMR17 CMR12 CMMI12 CMSY10 CMMI8 CMR8 CMBX12 CMEX10 %+ CMTI12 %EndComments %DVIPS... Date Added: 2009-06-05 17:30:01 |
| H3-solution.ps Path: Bowdoin >> CS >> 130 Fall, 2009 Description: %!PS-Adobe-2.0 %Creator: dvips(k) 5.86 Copyright 1999 Radical Eye Software %Title: H3-solution.dvi %Pages: 2 %PageOrder: Ascend %BoundingBox: 0 0 612 792 %DocumentFonts: CMR17 CMR12 CMMI12 CMSY10 CMMI8 CMR8 CMBX12 CMEX10 %+ CMTI12 %EndComments %DVIPS... Date Added: 2009-06-05 17:30:22 |
| PfauThesis.pdf Path: Arizona >> SBS >> 535 Fall, 2009 Description: Features and Categories in Language Production Inauguraldissertation zur Erlangung des Grades eines Doktors der Philosophie im Fachbereich Neuere Philologien der Johann Wolfgang Goethe-Universitt zu Frankfurt am Main vorgelegt von: Roland Pfau aus ... Date Added: 2009-06-05 17:32:03 |
| 2-2-NT-2.pdf Path: Allan Hancock College >> AGENDA >> 002 Fall, 2009 Description: ... Date Added: 2009-06-05 17:34:47 |
| 09-Probabilistic Contract Signing.pdf Path: Stanford >> CS >> 259 Fall, 2009 Description: CS 259 Rabin\'s Beacon A \"beacon\" is a trusted party that publicly broadcasts a randomly chosen number between 1 and N every day Michael Rabin. \"Transaction protection by beacons\". Journal of Computer and System Sciences, Dec 1983. Probabilistic Co... Date Added: 2009-06-05 17:36:43 |
| hw6sheet.xls Path: Cincinnati >> CEE >> 340 Winter, 2008 Description: Microsoft Excel 8.0a Answer Report Worksheet: [lp5-1.xls]filtered Report Created: 8/16/00 9:16:05 AM Target Cell (Min) Cell Name $B$972 Z(min)= Time=1079:00 Original Value Final Value -7 5 Adjustable Cells Cell $C$942 inj1 $D$942 inj2 $E$942 inj3 ... Date Added: 2009-06-05 17:36:52 |
| FINAL_GREEN ROOFS.ppt Path: Columbia >> V >> 1003 Fall, 2009 Description: Glenn Hills | Nate Howland | Neil Mehta December 10, 2007 Intro to Urban Heat Island Intro to Green Roofs United States Japan Germany Canada Proving Green Roofs Reduce UHI Proving Green Roofs Reduce UHI 85 84 83 3.2 F Temperature (F) 82 81 8... Date Added: 2009-06-05 17:37:17 |
| Ch9,10,11-2evo.pdf Path: CSU Northridge >> PDF >> 100 Fall, 2009 Description: Evolution 2 Adaptation Beak size and shape changed in populations of medium ground finch and cactus finch over 30 years Changes in size and shape were correlated with weather and seed availability Adaptation Process: the changes caused by natural... Date Added: 2009-06-05 17:37:50 |
| mcmclintroJordan.ps Path: Pittsburgh >> CS >> 3750 Fall, 2008 Description: %!PS-Adobe-2.0 %Creator: dvips(k) 5.86 Copyright 1999 Radical Eye Software %Title: mlintro.dvi %Pages: 48 %PageOrder: Ascend %BoundingBox: 0 0 612 792 %DocumentFonts: Helvetica %EndComments %DVIPSWebPage: (www.radicaleye.com) %DVIPSCommandLine: dvips... Date Added: 2009-06-05 17:38:08 |
| 400-18-food-adds.pdf Path: Virgin Islands >> CHEM >> 400 Fall, 2009 Description: FOOD ADDITIVES - A PARTIAL LIST OF ADDITIVES \"THAT ARE GENERALLY RECOGNISED AS SAFE\" - THE \"GRAS LIST\" Allergies etc: http:/www.cfsan.fda.gov/~dms/wh-alrg1.html 1 PRESERVATIVES prevent bacteria + oxidation: dry and/or use salt/sugar or add a BACTER... Date Added: 2009-06-05 17:39:29 |
| 243F95E3.pdf Path: Arizona >> CHEM >> 246 Fall, 2009 Description: CHEMISTRY 243 EXAM 3 November 6, 1995 1._ (24) Name:_ ID#:_ Use your models! There is scratch paper at the end of the exam, as well as a periodic table. 2._ (12) 3._ (20) 4._ (12) 5._ (10) 6._ (22) B + XC_ (6) SECTION 2 (McGrath) Total_ (106) GOOD ... Date Added: 2009-06-05 17:40:26 |
| MentalHealthMaze.pdf Path: UF >> HSA >> 6152 Spring, 2008 Description: ... Date Added: 2009-06-05 17:41:18 |
| lecture_05_06_BW.pdf Path: Allan Hancock College >> CIVL >> 4414 Fall, 2009 Description: ernr rsrr enree eD 1 1 -1 -1 A.E 2 2 H - 1 -1 1 1 -1 -1 1 1 1 1 -1 -1 rr e r r0 Y ggr r lb s Y HwPuP|7 HyyHH{b|7y7( y | w | y HPP|7 HyHHb|7y7( s yyHwwPuuP7 HHwwH{b77(zzz 1+ -1 0 - - 0 0 0 0 0 0 ... Date Added: 2009-06-05 17:42:04 |
| Singley_Feb3_Lighting.pdf Path: Penn State >> EDS >> 145 Fall, 2009 Description: Eric Singley Countrywide Conference Room February 03, 2006 All files used are located at P:/thesis/Feb3 Luminaire Data: Fixture (A) Lamp Data: Manufacturer: Catalog number: Se \'lux International M6R1-1T5-MP Type and Color: Number per luminaire:... Date Added: 2009-06-05 17:42:49 |
| 17-dynamic2.pdf Path: Sanford-Brown Institute >> EN >> 160 Fall, 2009 Description: Brown University Design of VLSI Systems Backgate Coupling Brown University Design of VLSI Systems EN160 Design and Implementation of VLSI Systems Spring 2005 Lecture 17: Dynamic Logic March 7, 2005 Prof. Iris Bahar Reading Assignment: Digital Inte... Date Added: 2009-06-05 17:43:06 |
| eecs211q06.pdf Path: E. Kentucky >> EECS >> 211 Fall, 2009 Description: ... Date Added: 2009-06-05 17:44:13 |
| PracWord.doc Path: Oregon State >> BA >> 131 Fall, 2008 Description: Welcome to the BA131 Practice Midterm. 1. Change the font of this entire line to Arial and change the font size to 14 point. 2. Change the page margins to a top margin of 1.5 inch, a bottom margin of 1.0 inch, a left margin of 1.25 inches, and a righ... Date Added: 2009-06-05 17:45:28 |
| output.txt Path: Washington >> V >> 12718 Fall, 2009 Description: = running on = COMPUTERNAME=PHYSLAB-715QNB1 - local directory - Volume in drive C has no label. Volume Serial Number is 9843-D647 Directory of C:\\condor\\execute\\dir_280 12/04/2007 09:14 AM <DIR> . 12/04/2007 09:14 A... Date Added: 2009-06-05 17:48:19 |
| submit.txt Path: Washington >> V >> 12500 Fall, 2009 Description: executable = allgamma_12658.bat universe = vanilla error = error.txt output = output.txt log = log.txt # set by submitting script Requirements= (OpSys = \"WINNT51\" ) initialdir = F:\\condor\\allgamma\\v13r5\\jobs12500-12999/12... Date Added: 2009-06-05 17:49:34 |
| dqam.pdf Path: Maryland >> ENEE >> 420 Fall, 2008 Description: i W a c Y p x S t ` Ys S X c V QRS i Y qa V a c p a r R X uY Y T TV Y T b ` W ` TXY WS TUV S QRS P c V P X aVX Y p c c Y cS a U f gde a y P V ! s RS X Yr x W ` RX S aY R t RS x q T T c XY c V R U c X Y q x qS RX WY Y T X S T S... Date Added: 2009-06-05 17:54:18 |
| 00000224.pdf Path: Carnegie Mellon >> DISK >> 31005447 Fall, 2009 Description: ... Date Added: 2009-06-05 17:56:47 |
| 00000077.pdf Path: Carnegie Mellon >> DISK >> 31004220 Fall, 2009 Description: ... Date Added: 2009-06-05 17:57:23 |
| 00000156.pdf Path: Carnegie Mellon >> DISK >> 31004220 Fall, 2009 Description: ... Date Added: 2009-06-05 17:57:41 |
| 00000273.pdf Path: Carnegie Mellon >> DISK >> 31004220 Fall, 2009 Description: ... Date Added: 2009-06-05 17:58:12 |
| 00000174.pdf Path: Carnegie Mellon >> DISK >> 31007091 Fall, 2009 Description: ... Date Added: 2009-06-05 17:59:30 |
| 00000029.pdf Path: Carnegie Mellon >> TERA >> 05101920 Fall, 2009 Description: ... Date Added: 2009-06-05 18:00:14 |
| 00000029.pdf Path: Carnegie Mellon >> DISK >> 05101920 Fall, 2009 Description: ... Date Added: 2009-06-05 18:00:14 |
| 00000233.pdf Path: Carnegie Mellon >> DISK >> 31003462 Fall, 2009 Description: ... Date Added: 2009-06-05 18:01:10 |
| 00000125.pdf Path: Carnegie Mellon >> DISK >> 31003644 Fall, 2009 Description: ... Date Added: 2009-06-05 18:01:53 |
| 00000324.pdf Path: Carnegie Mellon >> DISK >> 31003140 Fall, 2009 Description: ... Date Added: 2009-06-05 18:04:03 |
| 00000392.pdf Path: Carnegie Mellon >> DISK >> 31003140 Fall, 2009 Description: ... Date Added: 2009-06-05 18:04:16 |
| 00000045.pdf Path: Carnegie Mellon >> DISK >> 31005600 Fall, 2009 Description: ... Date Added: 2009-06-05 18:04:44 |
| 00000116.pdf Path: Carnegie Mellon >> DISK >> 31005600 Fall, 2009 Description: ... Date Added: 2009-06-05 18:04:59 |
| 00000341.pdf Path: Carnegie Mellon >> DISK >> 31005600 Fall, 2009 Description: ... Date Added: 2009-06-05 18:05:40 |
| 00000012.pdf Path: Carnegie Mellon >> DISK >> 31004684 Fall, 2009 Description: ... Date Added: 2009-06-05 18:06:36 |
| 00000073.pdf Path: Carnegie Mellon >> DISK >> 31004684 Fall, 2009 Description: ... Date Added: 2009-06-05 18:06:45 |
| 00000179.pdf Path: Carnegie Mellon >> DISK >> 05102943 Fall, 2009 Description: ... Date Added: 2009-06-05 18:07:54 |
| 00000039.pdf Path: Carnegie Mellon >> DISK >> 31004222 Fall, 2009 Description: ... Date Added: 2009-06-05 18:08:29 |
| 00000002.pdf Path: Carnegie Mellon >> TERA >> 31006192 Fall, 2009 Description: ... Date Added: 2009-06-05 18:09:00 |
| 00000002.pdf Path: Carnegie Mellon >> DISK >> 31006192 Fall, 2009 Description: ... Date Added: 2009-06-05 18:09:01 |
| 00000048.pdf Path: Carnegie Mellon >> DISK >> 31006192 Fall, 2009 Description: ... Date Added: 2009-06-05 18:09:13 |
| 00000048.pdf Path: Carnegie Mellon >> TERA >> 31006192 Fall, 2009 Description: ... Date Added: 2009-06-05 18:09:13 |
| 00000014.pdf Path: Carnegie Mellon >> DISK >> 31003641 Fall, 2009 Description: ... Date Added: 2009-06-05 18:11:47 |
| 00000014.pdf Path: Carnegie Mellon >> TERA >> 31003641 Fall, 2009 Description: ... Date Added: 2009-06-05 18:11:47 |
| 00000062.pdf Path: Carnegie Mellon >> DISK >> 31006530 Fall, 2009 Description: ... Date Added: 2009-06-05 18:14:05 |
| 00000081.pdf Path: Carnegie Mellon >> DISK >> 31006530 Fall, 2009 Description: ... Date Added: 2009-06-05 18:14:08 |
| 00000116.pdf Path: Carnegie Mellon >> DISK >> 05102751 Fall, 2009 Description: ... Date Added: 2009-06-05 18:15:11 |
| 00000154.pdf Path: Carnegie Mellon >> DISK >> 31008299 Fall, 2009 Description: ... Date Added: 2009-06-05 18:16:20 |
| 00000330.pdf Path: Carnegie Mellon >> DISK >> 31008299 Fall, 2009 Description: ... Date Added: 2009-06-05 18:16:49 |
| 00000156.pdf Path: Carnegie Mellon >> DISK >> 31006531 Fall, 2009 Description: ... Date Added: 2009-06-05 18:17:31 |
| 00000259.pdf Path: Carnegie Mellon >> DISK >> 31006531 Fall, 2009 Description: ... Date Added: 2009-06-05 18:17:47 |
| 00000277.pdf Path: Carnegie Mellon >> DISK >> 31006531 Fall, 2009 Description: ... Date Added: 2009-06-05 18:17:50 |
| 00000083.pdf Path: Carnegie Mellon >> TERA >> 31006953 Fall, 2009 Description: ... Date Added: 2009-06-05 18:18:15 |
| 00000083.pdf Path: Carnegie Mellon >> DISK >> 31006953 Fall, 2009 Description: ... Date Added: 2009-06-05 18:18:15 |
| 00000081.pdf Path: Carnegie Mellon >> DISK >> 31007634 Fall, 2009 Description: ... Date Added: 2009-06-05 18:18:32 |
| 00000033.pdf Path: Carnegie Mellon >> DISK >> 31007985 Fall, 2009 Description: ... Date Added: 2009-06-05 18:19:12 |
| 00000264.pdf Path: Carnegie Mellon >> DISK >> 31004448 Fall, 2009 Description: ... Date Added: 2009-06-05 18:20:25 |
| 00000330.pdf Path: Carnegie Mellon >> DISK >> 31004448 Fall, 2009 Description: ... Date Added: 2009-06-05 18:20:36 |
| 00000242.pdf Path: Carnegie Mellon >> DISK >> 31003985 Fall, 2009 Description: ... Date Added: 2009-06-05 18:21:23 |
| 00000332.pdf Path: Carnegie Mellon >> DISK >> 31003985 Fall, 2009 Description: ... Date Added: 2009-06-05 18:21:37 |
| 00000330.pdf Path: Carnegie Mellon >> DISK >> 31003985 Fall, 2009 Description: ... Date Added: 2009-06-05 18:21:37 |
| 00000043.pdf Path: Carnegie Mellon >> DISK >> 05102807 Fall, 2009 Description: ... Date Added: 2009-06-05 18:22:00 |
| 00000314.pdf Path: Carnegie Mellon >> DISK >> 31003489 Fall, 2009 Description: ... Date Added: 2009-06-05 18:26:58 |
| 00000091.pdf Path: Carnegie Mellon >> TERA >> 05102820 Fall, 2009 Description: ... Date Added: 2009-06-05 18:27:35 |
| 00000091.pdf Path: Carnegie Mellon >> DISK >> 05102820 Fall, 2009 Description: ... Date Added: 2009-06-05 18:27:35 |
| 00000036.pdf Path: Carnegie Mellon >> DISK >> 31004008 Fall, 2009 Description: ... Date Added: 2009-06-05 18:28:00 |
| 00000055.pdf Path: Carnegie Mellon >> DISK >> 31004008 Fall, 2009 Description: ... Date Added: 2009-06-05 18:28:03 |
| 00000366.pdf Path: Carnegie Mellon >> DISK >> 31004008 Fall, 2009 Description: ... Date Added: 2009-06-05 18:28:52 |
| 00000393.pdf Path: Carnegie Mellon >> DISK >> 31004008 Fall, 2009 Description: ... Date Added: 2009-06-05 18:28:57 |
| 00000028.pdf Path: Carnegie Mellon >> DISK >> 31003957 Fall, 2009 Description: ... Date Added: 2009-06-05 18:29:29 |
| 00000126.pdf Path: Carnegie Mellon >> DISK >> 31003957 Fall, 2009 Description: ... Date Added: 2009-06-05 18:29:45 |
| 00000233.pdf Path: Carnegie Mellon >> DISK >> 31004007 Fall, 2009 Description: ... Date Added: 2009-06-05 18:30:47 |
| 00000050.pdf Path: Carnegie Mellon >> DISK >> 05102073 Fall, 2009 Description: ... Date Added: 2009-06-05 18:31:19 |
| 00000072.pdf Path: Carnegie Mellon >> DISK >> 05102073 Fall, 2009 Description: ... Date Added: 2009-06-05 18:31:21 |
| 00000083.pdf Path: Carnegie Mellon >> DISK >> 31004951 Fall, 2009 Description: ... Date Added: 2009-06-05 18:31:36 |
| 00000100.pdf Path: Carnegie Mellon >> DISK >> 31004951 Fall, 2009 Description: ... Date Added: 2009-06-05 18:31:39 |
| 00000122.pdf Path: Carnegie Mellon >> DISK >> 31003477 Fall, 2009 Description: ... Date Added: 2009-06-05 18:32:15 |
| 00000198.pdf Path: Carnegie Mellon >> TERA >> 31003793 Fall, 2009 Description: ... Date Added: 2009-06-05 18:34:21 |
| 00000198.pdf Path: Carnegie Mellon >> DISK >> 31003793 Fall, 2009 Description: ... Date Added: 2009-06-05 18:34:22 |
| 00000200.pdf Path: Carnegie Mellon >> TERA >> 31003793 Fall, 2009 Description: ... Date Added: 2009-06-05 18:34:22 |
| 00000200.pdf Path: Carnegie Mellon >> DISK >> 31003793 Fall, 2009 Description: ... Date Added: 2009-06-05 18:34:22 |
| 00000032.pdf Path: Carnegie Mellon >> DISK >> 31004691 Fall, 2009 Description: ... Date Added: 2009-06-05 18:34:53 |
| 00000308.pdf Path: Carnegie Mellon >> DISK >> 31004691 Fall, 2009 Description: ... Date Added: 2009-06-05 18:35:40 |
| 00000033.pdf Path: Carnegie Mellon >> DISK >> 05102986 Fall, 2009 Description: ... Date Added: 2009-06-05 18:36:33 |
| 00000143.pdf Path: Carnegie Mellon >> DISK >> 31004009 Fall, 2009 Description: ... Date Added: 2009-06-05 18:37:48 |
| 00000323.pdf Path: Carnegie Mellon >> DISK >> 31004009 Fall, 2009 Description: ... Date Added: 2009-06-05 18:38:26 |
| 00000287.pdf Path: Carnegie Mellon >> DISK >> 31004139 Fall, 2009 Description: ... Date Added: 2009-06-05 18:39:15 |
| 00000107.pdf Path: Carnegie Mellon >> DISK >> 31003137 Fall, 2009 Description: ... Date Added: 2009-06-05 18:39:33 |
| Hum 5 Lee 1 Path: UCSD >> HUMANITIES >> Hum 5 Spring, 2009 Description: Humanities 5 Professor John Hoon Lee Spring 2009 Writing Assignment #1: Mill, Marx, Wagner, and Nietzsche Note: Evidence for your essay must be based only on the assigned texts. 1. Both Nietzsche and Mill seem to place a high value on individuality. ... Date Added: 2009-06-05 18:40:47 |
| 00000184.pdf Path: Carnegie Mellon >> DISK >> 31007292 Fall, 2009 Description: ... Date Added: 2009-06-05 18:40:54 |
| 00000473.pdf Path: Carnegie Mellon >> DISK >> 31007292 Fall, 2009 Description: ... Date Added: 2009-06-05 18:41:40 |
| 00000031.pdf Path: Carnegie Mellon >> DISK >> 05102791 Fall, 2009 Description: ... Date Added: 2009-06-05 18:41:47 |
| 00000081.pdf Path: Carnegie Mellon >> DISK >> 31006534 Fall, 2009 Description: ... Date Added: 2009-06-05 18:43:31 |
| 00000102.pdf Path: Carnegie Mellon >> DISK >> 31006534 Fall, 2009 Description: ... Date Added: 2009-06-05 18:43:34 |
| 00000040.pdf Path: Carnegie Mellon >> DISK >> 31003147 Fall, 2009 Description: ... Date Added: 2009-06-05 18:43:46 |
| 00000144.pdf Path: Carnegie Mellon >> DISK >> 31003147 Fall, 2009 Description: ... Date Added: 2009-06-05 18:44:02 |
| 00000026.pdf Path: Carnegie Mellon >> DISK >> 05102554 Fall, 2009 Description: ... Date Added: 2009-06-05 18:45:01 |
| 00000037.pdf Path: Carnegie Mellon >> DISK >> 31004475 Fall, 2009 Description: ... Date Added: 2009-06-05 18:45:09 |
| 00000119.pdf Path: Carnegie Mellon >> DISK >> 31004475 Fall, 2009 Description: ... Date Added: 2009-06-05 18:45:22 |
| 00000167.pdf Path: Carnegie Mellon >> DISK >> 31004475 Fall, 2009 Description: ... Date Added: 2009-06-05 18:45:29 |
| 00000164.pdf Path: Carnegie Mellon >> DISK >> 31004685 Fall, 2009 Description: ... Date Added: 2009-06-05 18:46:45 |
| 00000424.pdf Path: Carnegie Mellon >> DISK >> 31004685 Fall, 2009 Description: ... Date Added: 2009-06-05 18:47:27 |
| 00000007.pdf Path: Carnegie Mellon >> DISK >> 05102818 Fall, 2009 Description: ... Date Added: 2009-06-05 18:47:58 |
| 00000410.pdf Path: Carnegie Mellon >> DISK >> 31006180 Fall, 2009 Description: ... Date Added: 2009-06-05 18:49:10 |
| 00000139.pdf Path: Carnegie Mellon >> DISK >> 31003658 Fall, 2009 Description: ... Date Added: 2009-06-05 18:49:39 |
| 00000026.pdf Path: Carnegie Mellon >> DISK >> 31003554 Fall, 2009 Description: ... Date Added: 2009-06-05 18:49:52 |
| 00000123.pdf Path: Carnegie Mellon >> DISK >> 31003554 Fall, 2009 Description: ... Date Added: 2009-06-05 18:50:07 |
| 00000175.pdf Path: Carnegie Mellon >> DISK >> 31003554 Fall, 2009 Description: ... Date Added: 2009-06-05 18:50:16 |
| 00000333.pdf Path: Carnegie Mellon >> DISK >> 31003554 Fall, 2009 Description: ... Date Added: 2009-06-05 18:50:40 |
| 00000138.pdf Path: Carnegie Mellon >> DISK >> 31005189 Fall, 2009 Description: ... Date Added: 2009-06-05 18:51:49 |
| 00000251.pdf Path: Carnegie Mellon >> DISK >> 31005189 Fall, 2009 Description: ... Date Added: 2009-06-05 18:52:08 |
| 00000219.pdf Path: Carnegie Mellon >> DISK >> 31004687 Fall, 2009 Description: ... Date Added: 2009-06-05 18:53:12 |
| 00000456.pdf Path: Carnegie Mellon >> DISK >> 31004687 Fall, 2009 Description: ... Date Added: 2009-06-05 18:53:53 |
| 00000039.pdf Path: Carnegie Mellon >> TERA >> 31008134 Fall, 2009 Description: ... Date Added: 2009-06-05 18:54:24 |
| 00000039.pdf Path: Carnegie Mellon >> DISK >> 31008134 Fall, 2009 Description: ... Date Added: 2009-06-05 18:54:25 |
| 00000072.pdf Path: Carnegie Mellon >> DISK >> 31008122 Fall, 2009 Description: ... Date Added: 2009-06-05 18:55:27 |
| 00000040.pdf Path: Carnegie Mellon >> TERA >> 31003128 Fall, 2009 Description: ... Date Added: 2009-06-05 18:57:03 |
| 00000040.pdf Path: Carnegie Mellon >> DISK >> 31003128 Fall, 2009 Description: ... Date Added: 2009-06-05 18:57:03 |
| 00000176.pdf Path: Carnegie Mellon >> TERA >> 31003128 Fall, 2009 Description: ... Date Added: 2009-06-05 18:57:38 |
| 00000176.pdf Path: Carnegie Mellon >> DISK >> 31003128 Fall, 2009 Description: ... Date Added: 2009-06-05 18:57:38 |
| 00000192.pdf Path: Carnegie Mellon >> TERA >> 31003128 Fall, 2009 Description: ... Date Added: 2009-06-05 18:57:42 |
| 00000192.pdf Path: Carnegie Mellon >> DISK >> 31003128 Fall, 2009 Description: ... Date Added: 2009-06-05 18:57:42 |
| 00000316.pdf Path: Carnegie Mellon >> TERA >> 31003128 Fall, 2009 Description: ... Date Added: 2009-06-05 18:58:15 |
| 00000316.pdf Path: Carnegie Mellon >> DISK >> 31003128 Fall, 2009 Description: ... Date Added: 2009-06-05 18:58:15 |
| 00000186.pdf Path: Carnegie Mellon >> DISK >> 31008079 Fall, 2009 Description: ... Date Added: 2009-06-05 18:58:59 |
| 00000102.pdf Path: Carnegie Mellon >> DISK >> 31007636 Fall, 2009 Description: ... Date Added: 2009-06-05 18:59:37 |
| 00000375.pdf Path: Carnegie Mellon >> DISK >> 31007636 Fall, 2009 Description: ... Date Added: 2009-06-05 19:00:23 |
| 00000018.pdf Path: Carnegie Mellon >> DISK >> 31004880 Fall, 2009 Description: ... Date Added: 2009-06-05 19:00:27 |
| 00000047.pdf Path: Carnegie Mellon >> DISK >> 31004880 Fall, 2009 Description: ... Date Added: 2009-06-05 19:00:31 |
| 00000077.pdf Path: Carnegie Mellon >> TERA >> 31004231 Fall, 2009 Description: ... Date Added: 2009-06-05 19:02:48 |
| 00000077.pdf Path: Carnegie Mellon >> DISK >> 31004231 Fall, 2009 Description: ... Date Added: 2009-06-05 19:02:48 |
| CSCI 450 Windows NT - Lab 5.doc Path: St. Ambrose >> CSCI >> 450 Fall, 2009 Description: CSCI 450 Windows NT Laboratory Project 5 Install TCP/IP Networking on the PDC IP Address 192.168.2.xx Gateway leave blank Verify IP is working by using ping Create a host file identify for the Instructor\'s computer as 192.168.2.1 Verify ... Date Added: 2009-06-05 19:02:49 |
| 00000217.pdf Path: Carnegie Mellon >> TERA >> 31004231 Fall, 2009 Description: ... Date Added: 2009-06-05 19:03:26 |
| 00000217.pdf Path: Carnegie Mellon >> DISK >> 31004231 Fall, 2009 Description: ... Date Added: 2009-06-05 19:03:26 |
| 00000035.pdf Path: Carnegie Mellon >> DISK >> 31005234 Fall, 2009 Description: ... Date Added: 2009-06-05 19:03:52 |
| 00000049.pdf Path: Carnegie Mellon >> DISK >> 31005144 Fall, 2009 Description: ... Date Added: 2009-06-05 19:06:39 |
| 00000103.pdf Path: Carnegie Mellon >> DISK >> 31005144 Fall, 2009 Description: ... Date Added: 2009-06-05 19:07:04 |
| 00000245.pdf Path: Carnegie Mellon >> DISK >> 31005144 Fall, 2009 Description: ... Date Added: 2009-06-05 19:07:26 |
| 00000268.pdf Path: Carnegie Mellon >> DISK >> 31005144 Fall, 2009 Description: ... Date Added: 2009-06-05 19:07:30 |
| 00000472.pdf Path: Carnegie Mellon >> DISK >> 31005144 Fall, 2009 Description: ... Date Added: 2009-06-05 19:08:01 |
| 00000076.pdf Path: Carnegie Mellon >> TERA >> 05102726 Fall, 2009 Description: ... Date Added: 2009-06-05 19:08:36 |
| 00000076.pdf Path: Carnegie Mellon >> DISK >> 05102726 Fall, 2009 Description: ... Date Added: 2009-06-05 19:08:36 |
| 00000171.pdf Path: Carnegie Mellon >> DISK >> 31007966 Fall, 2009 Description: ... Date Added: 2009-06-05 19:09:11 |
| 00000044.pdf Path: Carnegie Mellon >> DISK >> 05103520 Fall, 2009 Description: ... Date Added: 2009-06-05 19:09:22 |
| 00000118.pdf Path: Carnegie Mellon >> DISK >> 05102556 Fall, 2009 Description: ... Date Added: 2009-06-05 19:10:20 |
| 00000228.pdf Path: Carnegie Mellon >> TERA >> 31004886 Fall, 2009 Description: ... Date Added: 2009-06-05 19:11:31 |
| 00000228.pdf Path: Carnegie Mellon >> DISK >> 31004886 Fall, 2009 Description: ... Date Added: 2009-06-05 19:11:31 |
| 00000348.pdf Path: Carnegie Mellon >> TERA >> 31004886 Fall, 2009 Description: ... Date Added: 2009-06-05 19:12:02 |
| 00000348.pdf Path: Carnegie Mellon >> DISK >> 31004886 Fall, 2009 Description: ... Date Added: 2009-06-05 19:12:02 |
| 00000436.pdf Path: Carnegie Mellon >> TERA >> 31004886 Fall, 2009 Description: ... Date Added: 2009-06-05 19:12:26 |
| 00000436.pdf Path: Carnegie Mellon >> DISK >> 31004886 Fall, 2009 Description: ... Date Added: 2009-06-05 19:12:26 |
| 00000452.pdf Path: Carnegie Mellon >> TERA >> 31004886 Fall, 2009 Description: ... Date Added: 2009-06-05 19:12:30 |
| 00000452.pdf Path: Carnegie Mellon >> DISK >> 31004886 Fall, 2009 Description: ... Date Added: 2009-06-05 19:12:30 |
| 00000011.pdf Path: Carnegie Mellon >> DISK >> 05102955 Fall, 2009 Description: ... Date Added: 2009-06-05 19:13:17 |
| 00000308.pdf Path: Carnegie Mellon >> DISK >> 31003130 Fall, 2009 Description: ... Date Added: 2009-06-05 19:14:29 |
| 00000053.pdf Path: Carnegie Mellon >> DISK >> 31007373 Fall, 2009 Description: ... Date Added: 2009-06-05 19:15:10 |
| 00000230.pdf Path: Carnegie Mellon >> DISK >> 31007373 Fall, 2009 Description: ... Date Added: 2009-06-05 19:15:38 |
| 00000241.pdf Path: Carnegie Mellon >> DISK >> 31007373 Fall, 2009 Description: ... Date Added: 2009-06-05 19:15:40 |
| 00000372.pdf Path: Carnegie Mellon >> DISK >> 31007373 Fall, 2009 Description: ... Date Added: 2009-06-05 19:16:00 |
| 00000082.pdf Path: Carnegie Mellon >> DISK >> 31005501 Fall, 2009 Description: ... Date Added: 2009-06-05 19:16:35 |
| 00000099.pdf Path: Carnegie Mellon >> DISK >> 31005501 Fall, 2009 Description: ... Date Added: 2009-06-05 19:16:37 |
| 00000149.pdf Path: Carnegie Mellon >> TERA >> 31007861 Fall, 2009 Description: ... Date Added: 2009-06-05 19:17:37 |
| 00000149.pdf Path: Carnegie Mellon >> DISK >> 31007861 Fall, 2009 Description: ... Date Added: 2009-06-05 19:17:37 |
| 00000170.pdf Path: Carnegie Mellon >> TERA >> 31007861 Fall, 2009 Description: ... Date Added: 2009-06-05 19:17:42 |
| 00000170.pdf Path: Carnegie Mellon >> DISK >> 31007861 Fall, 2009 Description: ... Date Added: 2009-06-05 19:17:42 |
| 00000013.pdf Path: Carnegie Mellon >> TERA >> 31006460 Fall, 2009 Description: ... Date Added: 2009-06-05 19:17:59 |
| 00000013.pdf Path: Carnegie Mellon >> DISK >> 31006460 Fall, 2009 Description: ... Date Added: 2009-06-05 19:17:59 |
| 00000028.pdf Path: Carnegie Mellon >> DISK >> 31006460 Fall, 2009 Description: ... Date Added: 2009-06-05 19:18:03 |
| 00000028.pdf Path: Carnegie Mellon >> TERA >> 31006460 Fall, 2009 Description: ... Date Added: 2009-06-05 19:18:03 |
| 00000011.pdf Path: Carnegie Mellon >> DISK >> 31006777 Fall, 2009 Description: ... Date Added: 2009-06-05 19:18:55 |
| 00000011.pdf Path: Carnegie Mellon >> TERA >> 31006777 Fall, 2009 Description: ... Date Added: 2009-06-05 19:18:55 |
| 00000151.pdf Path: Carnegie Mellon >> DISK >> 31004006 Fall, 2009 Description: ... Date Added: 2009-06-05 19:20:20 |
| 00000237.pdf Path: Carnegie Mellon >> DISK >> 31004006 Fall, 2009 Description: ... Date Added: 2009-06-05 19:20:34 |
| 00000025.pdf Path: Carnegie Mellon >> DISK >> 05102076 Fall, 2009 Description: ... Date Added: 2009-06-05 19:21:09 |
| 00000082.pdf Path: Carnegie Mellon >> DISK >> 05102076 Fall, 2009 Description: ... Date Added: 2009-06-05 19:21:19 |
| 00000019.pdf Path: Carnegie Mellon >> DISK >> 31007293 Fall, 2009 Description: ... Date Added: 2009-06-05 19:21:25 |
| 00000190.pdf Path: Carnegie Mellon >> DISK >> 31007293 Fall, 2009 Description: ... Date Added: 2009-06-05 19:21:53 |
| 00000006.pdf Path: Carnegie Mellon >> DISK >> 05101342 Fall, 2009 Description: ... Date Added: 2009-06-05 19:22:07 |
| 00000051.pdf Path: Carnegie Mellon >> DISK >> 05103512 Fall, 2009 Description: ... Date Added: 2009-06-05 19:22:31 |
| 00000057.pdf Path: Carnegie Mellon >> DISK >> 31003553 Fall, 2009 Description: ... Date Added: 2009-06-05 19:22:57 |
| 00000320.pdf Path: Carnegie Mellon >> DISK >> 31003553 Fall, 2009 Description: ... Date Added: 2009-06-05 19:23:39 |
| 00000093.pdf Path: Carnegie Mellon >> DISK >> 05102305 Fall, 2009 Description: ... Date Added: 2009-06-05 19:24:33 |
| 00000113.pdf Path: Carnegie Mellon >> DISK >> 31003541 Fall, 2009 Description: ... Date Added: 2009-06-05 19:25:53 |
|
|
Get Started With Course Hero Today!
Get study guides, join study groups, and more!
Sign up in seconds with your Facebook account!
Course Hero is a Facebook Application Partner.
Click below to sign-up for FREE.
Our Social Learning Network was built to provide students and key learning partners like professors a platform to share, meet and collaborate while accelerating their comprehension of course-related theories and concepts. We are committed to providing you immediate access to a growing wealth of study materials and an unparalleled academic network of students, professors and other key partners. Why do you care? Because you want the best grade possible and at times need a 24/7 resource that’s responsive to your needs. |
|
What People Are Saying About Course Hero
|
|||
|
|||
|
Explore the benefits of joining Course Hero's social learning network.
|
|||
![]() |
Get millions of study materials now!Need lecture notes for a missed class or want insightful explanation of the theories and concepts you learn in class? Look no further, Course Hero’s Study Materials empowers you to find a broad and deep set of materials that can help you right now!
Click below to sign-up for FREE.
|
||
![]() |
Get over 200,000 textbook solutions now!Having difficulty with your homework and need documents that are relevant for your Textbook? Don't be frustrated. Course Hero's Textbook Help presents you study materials from many college courses.
Click below to sign-up for FREE.
|
||
![]() |
Meet over 300,000 students and your fellow classmates now!Want to meet your current classmates or those that took the class last year? Don’t worry or have anxiety. Course Hero’s Study Groups gives you the seamless opportunity to develop both anonymous or direct relationships with those classmates whom you want to meet and get help from right now!
Click below to sign-up for FREE.
|
||


