Course Solutions And Notes - 16 jan 2008 0c
| KW Inclass1.pdf Path: University of Iowa >> C >> 010350 Fall, 2009 Description: Rhetoric 10:001 WilhiteFall 2001 In-Class Writing 1 This course will help you think about, analyze, and responsibly discuss ongoing cultural controversies. All of the formal and informal assignments are designed to help you better understand the comp... Date Added: 2009-06-24 04:47:28 |
| chap2_22mars.doc Path: NSULA >> CHAPITRE >> 802 Fall, 2009 Description: Chapitre 2 Introduction Le but de ce chapitre est de mettre en parallle les diverses lgislations rpertories dans quatre (4) provinces canadiennes, incluant celle du Qubec; dans six (6) tats amricains, de mme que dans quatre (4) pays europens. Nous al... Date Added: 2009-06-24 04:47:36 |
| ch8iis05.pdf Path: CSU Northridge >> HBBIO >> 258 Fall, 2009 Description: ... Date Added: 2009-06-24 04:49:25 |
| Ed337-lesson4.pdf Path: Wisc Stevens Point >> EKOST >> 456 Fall, 2009 Description: Lesson 4: Properties continued and Review (D) Rationale: The purpose of this lesson is for students to make connections between chemical and physical properties and chemical and physical changes. Also it provides a review of the fundamental component... Date Added: 2009-06-24 04:50:36 |
| 380Assignment6.pdf Path: Washington >> A >> 380 Fall, 2009 Description: Arch. 380 Introduction to Computers in Architecture Assignment 6: Final Project The University of Washington College of Architecture & Urban Planning Winter 2006 The final project incorporates all the work you have done and all the skills you have bu... Date Added: 2009-06-24 04:52:11 |
| Lecture11 .pdf Path: Sveriges lantbruksuniversitet >> LING >> 407 Fall, 2009 Description: LINGUISTICS 407 MORPHOLOGICAL CHANGE (Part 2) Lecture #11 Analogical changes that have little or nothing to do with regularization: 1. In the course of leveling, extension may be made from inflected rather than from base forms back formation: an a... Date Added: 2009-06-24 04:52:15 |
| supp3.pdf Path: UVA >> PHYS >> 356 Fall, 2008 Description: ... Date Added: 2009-06-24 04:54:30 |
| ce2810 Structs.ppt Path: MSOE >> CE >> 2810 Fall, 2009 Description: vti_encoding:SR|utf8-nl vti_timelastmodified:TR|23 Apr 2008 18:54:42 -0000 vti_extenderversion:SR|6.0.2.8161 vti_backlinkinfo:VX|Courses/ce2810/index.htm vti_author:SR|MSOE\\hornick vti_modifiedby:SR|MSOE\\hornick vti_timecreated:TR|05 May 2008 17:51:2... Date Added: 2009-06-24 04:55:23 |
| design plan.doc Path: George Mason >> MASON >> 601 Fall, 2009 Description: Developing a class to teach JAWS for graduate students. Study objectives: How to download files from the Internet How to navigate Web sites How to use the JAWS virtual cursor How to move through links How to recognize parts of Web sites such a... Date Added: 2009-06-24 04:58:47 |
| Lecture 2.doc Path: Mercer >> CSC >> 205 Fall, 2009 Description: Lecture 2 Java Review 1 Appendix A provides a good review for the Java language. To be a good programmer, one needs to have a good knowledge of the following language features: - basic (primitive) data types: Java is a strongly typed language - contr... Date Added: 2009-06-24 05:00:34 |
| LoopStructures.ppt Path: ECCD >> ECOR >> 1606 Fall, 2009 Description: vti_encoding:SR|utf8-nl vti_timelastmodified:TR|09 Sep 2008 16:02:38 -0000 vti_extenderversion:SR|5.0.2.2623 vti_backlinkinfo:VX|lectures/lectures.html ... Date Added: 2009-06-24 05:02:13 |
| hw5-solution.pdf Path: UCSD >> CSE >> 105 Fall, 2001 Description: 1 Decidability L = { M, w | M is a TM and w is a string and M never overwrites its tape on input w} Here we consider TMs as defined in Sipser with tapes that are only infinite to the right. We will prove that the language L is decidable. Consider a... Date Added: 2009-06-24 05:02:45 |
| Web Criteria6.doc Path: NJIT >> ENG >> 352 Fall, 2009 Description: English 352 (Technical Communication) Portfolio Assessment Spring 2006 Student\'s Name Reader\'s Name Writing and Editing 1. The contents of this portfolio exhibit clear style (readable, concise, cohesive). 2. The contents of this portfolio demonstrat... Date Added: 2009-06-24 05:03:10 |
| Light-redefined-ad.pdf Path: Uni. Westminster >> JJB >> 0702 Fall, 2009 Description: Light ReDefined. Up to 100 Lumens Per Watt 360 Viewing Angle Low Heat Output Long Lifetime Waterproof Removable Package RoHS compliant .. . .. . .. . .. . light (lt) n. 1 a: DynastyTM High Flux LED: 360 degree horizontal and 275 degree vertical... Date Added: 2009-06-24 05:04:42 |
| sandCone.doc Path: Washington University in St. Louis >> CE >> 420 Fall, 2009 Description: Cover Letter Mr. Kenneth M. Berry, PE URS Corporation 1001 Highlands Plaza Drive St. Louis, Mo 63110 April 5, 2007 Re: Project No. 2007-CE420-7 Dear Mr. Berry, The soil for which you provided sample data does not fill the stated requirements for dry ... Date Added: 2009-06-24 05:05:13 |
| blt6060_fiche_droites.pdf Path: Neumont >> BLT >> 6060 Fall, 2009 Description: Rappel - quation d\'une droite : y = a + bx 4 exemples Axe des Y (ordonnes) 18 16, 17 18 16 14, 15 16 14 12, 13 14 (y2-y1) Ordonne l\'origine i.e. o la droite coupe l\'axe des Y Notation: a Ici a = 11 0, 11 10, 11 Axe des Y (ordonnes) 12 12 ... Date Added: 2009-06-24 05:06:39 |
| 423p815.xls Path: MSOE >> IE >> 423 Fall, 2009 Description: IE-423 Problem 8.15 i = Year 0 1 2 3 4 5 6 15.00% Variable Dual -$250,000.00 -$231,000.00 -$231,000.00 -$231,000.00 -$270,000.00 -$231,000.00 -$181,000.00 -$1,124,897.50 -$225,000.00 -$235,000.00 -$235,000.00 -$235,000.00 -$26,000.00 -$235,000.00 ... Date Added: 2009-06-24 05:07:26 |
| activity sheet.doc Path: N. Georgia >> AEMCCA >> 8639 Fall, 2009 Description: SHARK ADVENTURE Name: _ Date: _ Even though you are in groups of two, each group member needs to answer and turn in their own activity sheet. To answer the following fill in the blank questions, please go to the main page. To find the answers on t... Date Added: 2009-06-24 05:07:37 |
| St. Mary Presentation New.pdf Path: Laurentian >> ENVS >> 4000 Fall, 2009 Description: The St. Mary River A long history of water-use and apportionment leading to its altered state and current ecological status Background of the St. Mary River St. Mary in Blackfoot language translates to Coniferous tree (\"apahtok\"), Buffalo jump/Cor... Date Added: 2009-06-24 05:07:58 |
| Classical Economics & Relative Prices.ppt Path: Oakland University >> FIN >> 475 Fall, 2009 Description: vti_encoding:SR|utf8-nl vti_timelastmodified:TR|07 Jan 2004 23:46:15 -0000 vti_extenderversion:SR|4.0.2.7802 vti_cacheddtm:TX|07 Jan 2004 23:46:15 -0000 vti_filesize:IR|628224 vti_cachedlinkinfo:VX| vti_cachedsvcrellinks:VX| vti_cachedtitle:SR|Classi... Date Added: 2009-06-24 05:08:11 |
| selective-targeting-biophys-j-2003.pdf Path: Washington University in St. Louis >> CHE >> 515 Fall, 2009 Description: Biophysical Journal Volume 84 June 2003 40234032 4023 Selective Cell Targeting with Light-Absorbing Microparticles and Nanoparticles Costas M. Pitsillides,*y Edwin K. Joe,* Xunbin Wei,* R. Rox Anderson,* and Charles P. Lin* *Wellman Laboratories... Date Added: 2009-06-24 05:08:24 |
| radiant_slides.pdf Path: UC Davis >> GEL >> 134 Winter, 2008 Description: Image provided by NASA ... Date Added: 2009-06-24 05:08:35 |
| words.txt Path: Wisconsin Milwaukee >> LIB >> 2156 Fall, 2009 Description: ! 52556:35100:160:924 \" 41611:35276:642:374 41344:26099:642:396 33155:56776:561:352 53252:35100:508:264 \"\'whe 43912:22952:6101:924 \"o 16671:55588:3880:1078 \"wha 44662:55125:4790:924 .^ 25609:13908:7439:88 1 32433:56820:240:946 20 12710:7856:1337:572 ... Date Added: 2009-06-24 05:08:49 |
| Mario(212).pdf Path: Bethel VA >> OAK >> 212 Fall, 2009 Description: Mario Secaira \"Latinoamrica\" (Entrevistas #3) (3 pginas) Nombre: Mario acaba de sacar su Maestra en Administracin de Empresas (MBA) aqu en O.U. y va a narrar un poco la historia de los pases de Latinoamrica y su relacin con el resto del mundo. Obvi... Date Added: 2009-06-24 05:09:11 |
| tp3.txt Path: Université du Québec à Montréal >> AH >> 591415 Fall, 2009 Description: INF2170-21 Organisation des ordinateurs et assembleur Et 2001 Travail pratique #3 (20%) Objet: Programme utilitaire qui effectue des conversions en point-flottant. Le programme dsir sera crit en assembleur Motorola 68000 pour tre... Date Added: 2009-06-24 05:10:52 |
| SampleQuestions5.pdf Path: N. Illinois >> BIOS >> 208 Fall, 2008 Description: BIOS 208T Sample Questions #5 1. In crossing a homozygous recessive with a heterozygote, what is the chance of getting a homozygous recessive phenotype in the F1 generation? a. zero d. 75% b. 25% e. 100% c. 50% In snapdragons, heterozygotes have pink... Date Added: 2009-06-24 05:11:24 |
| lect-6dec07.pdf Path: University of Illinois, Urbana Champaign >> CS >> 273 Spring, 2008 Description: ... Date Added: 2009-06-24 05:12:33 |
| astr6000_finproj.pdf Path: Colorado >> ASTR >> 6000 Fall, 2008 Description: FINAL PROJECT ASTR 6000: PROPOSAL OUTLINE The final project for ASTR 6000 is intended to familiarize you with the procedures necessary for completing an observing (or theory) proposal to one of the major space missions or groundbased observatories. I... Date Added: 2009-06-24 05:12:36 |
| refrences.doc Path: University of Hawaii - Hilo >> COM >> 490 Fall, 2009 Description: Modeling co-creativity in art and technology Full text Source Pdf (221 KB) Creativity and Cognition archive Proceedings of the 4th conference on Creativity & cognition table of contents Loughborough, UK Pages: 134 - 141 Year of Publication: 2002 ISB... Date Added: 2009-06-24 05:12:46 |
| Women Equity ITI.pdf Path: East Los Angeles College >> SV >> 266 Fall, 2009 Description: Background This is the second in a series of concept papers commissioned by the International Trachoma Initiative (ITI) to bridge the mission and programmatic work of ITI with the current discussions and efforts in other health and development relate... Date Added: 2009-06-24 05:13:01 |
| STAT2601QUIZ2AnswerKey(S2006).doc Path: Minnesota >> STAT >> 2601 Fall, 2009 Description: STAT 1601 QUIZ #2 NAME: Student ID: Problem 1. Each of 10 children in the third grade was given a reading aptitude test. The score were as follows: 83, 79, 92, 81, 95, 62, 87, 96, 97, 72. (a) What is the first quartile Q1? (1 pts) 62, 72, 79, 81, 83... Date Added: 2009-06-24 05:14:01 |
| input4_2.txt Path: UF >> CGS >> 3460 Fall, 2008 Description: Hi ... Date Added: 2009-06-24 05:14:35 |
| bio345 09 week 14 day 2.doc Path: UCCS >> BIO >> 345 Fall, 2009 Description: Biology 345 Spring 2009 - Week 14 Day 2 Sport Psychology Introduction to Mental Skills Thought for the day: I learn teaching from teachers, I learn golf from golfers, and I learn winning from coaches. Harvey Penick I. Schedule a. Putting Project... Date Added: 2009-06-24 05:15:51 |
| Layer3-a.ppt Path: UCF >> ISM >> 4228 Spring, 2008 Description: IPv4 Addressing TCP/IP Protocol Stack Flat vs. Hierarchical Addresses A flat address cannot be subdivided into parts Computer names in a NT domain Unless you create a naming scheme that imposes a structure (i.e. KCFIN01, KCFIN02, NYFIN01) A... Date Added: 2009-06-24 05:15:59 |
| week1b.ps Path: Ohio State >> EE >> 701 Fall, 2009 Description: %! nup.pre.ps - Prelude for n-up printing. $Revision: 4.2 $ /$Nup 75 dict def $Nup begin/spots 2 def/reverse? false def/startspot 0 def gsave/transforms[/ind 0 def[2 4 8 16]{spots eq{exit}if/ind ind 1 add def}forall/upright?[false true false true]ind... Date Added: 2009-06-24 05:17:19 |
| gcnR_flux_ul.txt Path: Berkeley >> ASTRO >> 00174738 Fall, 2009 Description: 0 1.491938e-01 2.748251e-02 none yes -719.712 1.491938e-01 2.748251e-02 none yes 1201.82 3.117100e-04 5.741910e-05 none yes 3944.16 2.842829e-04 5.236684e-05 ... Date Added: 2009-06-24 05:18:39 |
| ep_nfl_dat.txt Path: Berkeley >> ASTRO >> 00174738 Fall, 2009 Description: # Ep dEp lprob lNiso dlNiso 367.029 0.299 -6.97e-05 132.740 0.200 367.349 0.343 -5.46e-04 132.740 0.200 367.716 0.392 -2.09e-04 132.740 0.200 368.136 0.449 -6.57e-04 132.740 0.200 368.617 0.514 -1.52e-03 132.740 0.200 369.168 0.589 -1.68e-03 132.740 ... Date Added: 2009-06-24 05:18:49 |
| Reading Worksheet 10.pdf Path: Redlands >> PHYS >> 231 Fall, 2009 Description: RW 10 About this assignment Sections 4.1-4.1.3 (pages 116-120): work 1. You bring a boat toward the dock by pulling on a rope with a force of 130 newtons through a distance of 8 meters. How much work do you do? (Include the appropriate sign.) _ joule... Date Added: 2009-06-24 05:19:00 |
| 35-Causal Layered Analysis.pdf Path: Penn State >> NC >> 5014 Fall, 2009 Description: The Millennium Project Futures Research Methodology-V3.0 CAUSAL LAYERED ANALYSIS: AN INTEGRATIVE AND TRANSFORMATIVE THEORY AND METHOD by Sohail Inayatullah1 I. History of the Method II. Description of the Method III. Applications IV. Strengths an... Date Added: 2009-06-24 05:21:10 |
| teaching websites.doc Path: N. Georgia >> HLWATS >> 1426 Fall, 2009 Description: Holly Watson Helpful Teaching Links 1. www.bravenet.com- offers free tools to hep in building websites 2. www.4teachers.org- offers tips to teachers and helpful \"sites of the week,\" also has ideas on how to integrate technology in the classroom 3. ww... Date Added: 2009-06-24 05:22:22 |
| 2h.pdf Path: Ohio State >> LING >> 384 Fall, 2009 Description: Language and Computers Topic 2: Searching Introduction Text Speech Outline Language and Computers Topic 2: Searching Introduction Text Speech Searching Language and Computers Topic 2: Searching Introduction Text Speech Searching in a Library Cat... Date Added: 2009-06-24 05:22:43 |
| entries.pdf Path: Auburn >> AC >> 612 Fall, 2009 Description: Comprehensive Governmental Fund Exercise Below are the entries we did in class, and the ones that we didn\'t get to. The ones that I skipped are in italics. You should try to do the entire exercise in accordance with the instructions that are in the o... Date Added: 2009-06-24 05:23:02 |
| 080208Team3.ppt Path: Alaska Anch >> CE >> 438 Fall, 2009 Description: Group Members r r r r r r r Matt Dougherty JR Gilliland Ramadan Greva Robert Limstrom Kaity Longden Jamie Suttie James Smith NEW FEATURES r r r r Pods begin in alignment with the corner of the building due to MOA Right-of-way. Terraces will better... Date Added: 2009-06-24 05:23:19 |
| cal2.pdf Path: Kentucky >> AS >> 100 Fall, 2009 Description: A A 82E w h u dm A A 82 n r u m6m (UHEi`w u { y w qc(dd9ir`6 u u w x w u { y w (UHEi`w 1~d2~ n r B g A o (UHEi`w u { y w p u d9 m \"9 x o u p u d9 m l w p u d9 tm ... Date Added: 2009-06-24 05:23:57 |
| exam2mspr03.pdf Path: Kentucky >> AS >> 100 Fall, 2009 Description: s j l Em0v800Qdmd j0IC#C0dd0~}W{zWwv tsqomdj W0iffd j h r | r y x r u u r p n l k j h g e yy Qs r t xs w v Qs u Ts v s 0s y Qs x t Qs w hs y hs t x x w v t u t s q DPPB f Fcb F DH X V X rpihhECA gX edCa ESBT`P YWU P... Date Added: 2009-06-24 05:23:58 |
| StringDemo.txt Path: CSU Chico >> CH >> 111 Fall, 2009 Description: import java.awt.*; import java.applet.*; import java.util.*; import java.awt.event.*; public class StringDemo extends Applet implements ActionListener { private TextField string1Field, string2Field; private TextField resultField; p... Date Added: 2009-06-24 05:25:16 |
| ISECON.2004.Reynolds.ppt Path: BYU Hawaii >> COLTON >> 1222 Fall, 2009 Description: TUTORIAL: HOW TO MAP YOUR IS PROGRAM TO IS 2002 John H. Reynolds George Nezlek School of CIS, Grand Valley State University Allendale, MI 49401 USA Jeffrey P. Landry Herbert E. Longenecker, Jr. University of South Alabama School of CIS Mobile,... Date Added: 2009-06-24 05:26:29 |
| ISECON.2004.Abraham.txt Path: BYU Hawaii >> COLTON >> 2213 Fall, 2009 Description: Assessing the Learning Outcomes of a Computer Information Systems (CIS) Program Samuel Abraham Computer Information Systems Department Siena Heights University Adrian MI 49221 sam@sienahts.edu Track: Information Systems Assessment Abstract In r... Date Added: 2009-06-24 05:27:01 |
| finalreview.doc Path: Bowling Green >> CS >> 3410 Fall, 2009 Description: Final Exam Review Test 1 Problems Test 2 Problems, plus how to build a Min Heap from empty heap using insertion function and buildHeap function. Chapter 9 Insertion sort algorithm, merge sort algorithm, shell sort algorithm and quicksort algorithm. K... Date Added: 2009-06-24 05:27:31 |
| Introduction to Logic Families.doc Path: New Hampshire >> ECE >> 543 Fall, 2008 Description: Introduction to Logic Families This handout will introduce the basic concepts related to digital circuit devices (integrated circuits). A digital integrated circuit consists of transistors, resistors, and capacitors configured to perform a certain lo... Date Added: 2009-06-24 05:28:07 |
| ep_fl_dat.txt Path: Berkeley >> ASTRO >> 00118248 Fall, 2009 Description: # Ep dEp lprob lEiso dlEiso 60.668 0.050 4.34e-04 -11.721 0.110 60.721 0.057 1.95e-03 -11.721 0.101 60.782 0.065 3.62e-03 -11.746 0.096 60.852 0.075 5.47e-03 -11.746 0.095 60.931 0.085 7.53e-03 -11.746 0.095 61.023 0.098 9.78e-03 -11.746 0.095 61.128... Date Added: 2009-06-24 05:28:21 |
| hwb7.pdf Path: Caltech >> PH >> 205 Fall, 2009 Description: Ph 205b Problem Set 7 d for e+ e- . Don\'t look in the text for the solution. Work at high energies 1. Calculate the differential section d and neglect the electron mass. 2. Calculate d for e- e- . Again don\'t copy the text, try it yourself and ne... Date Added: 2009-06-24 05:31:02 |
| P231-HW1.pdf Path: Redlands >> PHYSICS >> 231 Fall, 2009 Description: Physics 231 General Physics I Assignment #1 Reading: The following sections from Matter & Interactions should be read before class, except for the first day. Wednesday, Sept. 3 Thursday, Sept. 4 Friday, Sept. 5 1.1 1.4 1.5 1.6 1.9* Note that there ... Date Added: 2009-06-24 05:31:22 |
| Accessioningassistant-0001.doc Path: Washington >> MAILMAN >> 20060223 Fall, 2009 Description: STUDENT TECHNICIAN SPECIAL COLLECTIONS ALLEN LIBRARY, B81 SALARY: TITLE: $7.85 - $9.60 Accessioning Assistant PRIMARY Create lists of archival materials using Encoded Archival Description (EAD) DUTIES: Rebox, folder, and label files Create labels ... Date Added: 2009-06-24 05:31:28 |
| 1.1_Logic.doc Path: Virginia Tech >> MATH >> 2534 Summer, 2008 Description: W8BNMSWD#? #A)1.1_Logic.doc#1.1_Logic.doc# # #A)## # # ## # # ##X M# ... Date Added: 2009-06-24 05:32:03 |
| Assignment 4.pdf Path: Oklahoma State >> SOIL >> 4563 Fall, 2008 Description: Assignment 4 Dynamic of Wetlands, Forest And Rangeland Soils Due 4 October 2002 1. Identify how wetlands impact: a. Ecology b. Production c. Water quality d. Water quantity e. Financial f. Recreational g. Aesthetic h. Flooding i. Watersheds You may u... Date Added: 2009-06-24 05:32:23 |
| Jude.doc Path: Texas >> E >> 379 Fall, 2008 Description: Rajesh Reddy September 14th, 2004 Journal College Idealism What usually comes to my mind when we speak of college idealism is not the college environment or campus, but the quality of the teaching faculty and the aspirations of the student populati... Date Added: 2009-06-24 05:35:02 |
| Engaging Chat Over Breakfast on Audits.doc Path: Washington >> FACULTY >> 301 Fall, 2009 Description: The Seattle Times, Sunday, July 8, 2007. Business Section, p. 1 Engaging chat over breakfast on audits By Rami Grunbaum, deputy business editor, and Seattle Times Business staff (Highlighting added by E. Widdison) Anyone who\'s slogged though a 10-K ... Date Added: 2009-06-24 05:35:24 |
| Replication.pdf Path: CSU Mont. Bay >> CS >> 6580 Fall, 2009 Description: Replication Jorge Cardoso University of Madeira Introduction Replication of data The maintenance of copies of data at multiple computers. Enhanced performance High availability and Fault tolerance. For example, the caching of resources from web ser... Date Added: 2009-06-24 05:35:51 |
| lecture05.pdf Path: Rutgers >> CS >> 107 Fall, 2009 Description: CS107: Computing for Math and Science Lecture 05: CS107, Prof. Steinberg, f06 Lecture 05 1 October 2 I will not be here Probably will have a guest lecture But check web page in case of announcement CS107, Prof. Steinberg, f06 Lecture 05 2 ... Date Added: 2009-06-24 05:36:10 |
| Review of Chapters 14 and 15.doc Path: Iowa State >> ECON >> 101 Fall, 2008 Description: Review of Chapters 14 and 15. Econ 101 Sections 1 & 4 This is for your Exam preparation. Answers are attached on the last two pages. REMINDER: 3rd Midterm Exam, Friday, 11 April 2003 Covers all Materials from pgs. 257 - 368. Chapters 12, 13, 14, an... Date Added: 2009-06-24 05:37:58 |
| ep_fl_dat.txt Path: Berkeley >> ASTRO >> 00102861 Fall, 2009 Description: # Ep dEp lprob lEiso dlEiso 134.988 0.106 5.86e-06 -8.501 0.021 135.101 0.122 -1.57e-04 -8.501 0.019 135.232 0.139 -8.23e-06 -8.501 0.019 135.381 0.160 -1.56e-04 -8.501 0.019 135.552 0.183 -3.85e-04 -8.494 0.020 135.747 0.209 -7.20e-04 -8.494 0.020 1... Date Added: 2009-06-24 05:39:28 |
| Gant Chart Travis.xls Path: WVU >> EE >> 180 Fall, 2009 Description: # 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 19 20 21 23 24 25 Task Design JP Design Motor Control System Design Dynamic Braking System Design Cruise Control System Design Driver Logic Interface Design Input Logic Interface Design Cruise Logic Interf... Date Added: 2009-06-24 05:39:29 |
| gcn.txt Path: Berkeley >> ASTRO >> 00217704 Fall, 2009 Description: # Time [days] Mag Magerr Band Uplim Ref 20.2 -0.2 R no GCN5290 0.00145 18.5 -0.2 White yes GCN5285 0.00148 20.37 0.29 WHITE no GCN5294 0.0... Date Added: 2009-06-24 05:40:14 |
| StudyGuide2.pdf Path: UConn >> IMS >> 201 Fall, 2009 Description: MMAT 201-01 Materials Science and Engineering I Spring 2001 Study Guide Quiz 2 General Quiz 2 willl be held Apr. 12, 2001 (Thu.), 10:55 am 12:20 pm in CAST204 (class room). The exam will be an individual (not team) exam. It will be closed book and n... Date Added: 2009-06-24 05:41:49 |
| assn3.pdf Path: Maryland >> ENEE >> 350 Fall, 2008 Description: Problem 1: (a) Assume that a = 7, b = 45, c = 23, d = 17, e = 6, f = 8. Evaluate the following expression by rst converting it into a post-order expression and then coding it using CodeMill instructions. a + 2 (b - c) + 8 d + 4 (e + f ) This expr... Date Added: 2009-06-24 05:42:59 |
| b8601_shihanyu_pagenum.pdf Path: Columbia >> SY >> 2213 Fall, 2009 Description: B8601 Consumer Behavior Term Paper A Study on Customers From Hell Instructor: Morris. B. Holbrook Student: Shih-An Yu School: Grad. School of Art and Science 1 Motivation With the growth of the service economy, there are high expectations on bound... Date Added: 2009-06-24 05:43:13 |
| 104hw10.pdf Path: Duke >> STA >> 104 Summer, 2008 Description: W V Y u T f W VI Y Y V T H W W q T H Y T H evY QQI vd 6PjPP5P6g Xe%5XV aPQQQQI 9 P9A q W V Y u T f W T T W T H W W II VI Y g H U z jz e % WXY}du QQI vd V u T f W g W VI Y Y IWiPHTV6TPHWCWHfWg6TPeqdrgetCWx9tt g WddYX... Date Added: 2009-06-24 05:43:57 |
| bc.txt Path: Berkeley >> CS >> 267 Fall, 2008 Description: BC: Data Distribution Map: 0 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 0: 0 0 0 1 1 1 2 2 2 3 3 3 4 4 4 5 5 5 6 6 1: 0 0 0 1 1 1 2 2 2 3 3 3 4 4 4 5 5 5 6 6 2: 0 0 0 1 1 1 2... Date Added: 2009-06-24 05:44:19 |
| F0103.ps Path: Trinity U >> CS >> 2321 Fall, 2009 Description: %!PSAdobe3.0 %Title: (F.01.03) %Creator: (Adobe Illustrator\\252 5.5: PSPrinter 8.1.1) %CreationDate: (11:36 AM Friday, July 18, 1997) %For: (Morgan Kaufmann Publishers) %Pages: 1 %DocumentFonts: FranklinGothicBook % %DocumentNeededFonts: FranklinGo... Date Added: 2009-06-24 05:46:42 |
| lzk12z.txt Path: University of Illinois, Urbana Champaign >> ATMOS >> 20081124 Fall, 2009 Description: UPPER AIR CALCULATIONS AND PLOTTING (Ver 5.48.1-LINUX-X11) Current filename: /mnt/noaaport/nwstg/convert/08112400_upa.wxp Date: 0000Z 24 NOV 08 Searching for KLZK. Searching the city database file for: KLZK . Date:0000Z 24 NOV 08 Station: KLZK... Date Added: 2009-06-24 05:47:44 |
| hw2.doc Path: Rose-Hulman >> SL >> 451 Fall, 2009 Description: SL 451 Bremmer March 4, 2008 Name _ CM _ Homework Assignment #2 - - Due Monday, March 10, 2008 Assume a perfectly competitive firm faces market price P and it must pay an excise tax of t per unit. Assume the firm maximizes profits and it picks its ... Date Added: 2009-06-24 05:48:09 |
| pic18f4520_149.ps Path: UCSD >> PHY >> 120 Fall, 2009 Description: %!PS-Adobe-3.0 % Produced by xpdf/pdftops 3.02 %Creator: FrameMaker 7.2 %Title: PIC18F2420/2520/4420/4520 Data Sheet %LanguageLevel: 2 %DocumentSuppliedResources: (atend) %DocumentMedia: plain 612 792 0 () () %BoundingBox: 0 0 612 792 %Pages: 1 %EndC... Date Added: 2009-06-24 05:49:03 |
| Transhyd_writeup.pdf Path: Carleton >> CHEM >> 234 Fall, 2009 Description: Chemistry 234 G. E. Hofmeister Winter, 2004 Transfer Hydrogenation Write-up When evaluating your data, you may find the following pages in your Mohrig, et. al. \"Techniques.\" book to be useful: IR chapter, particularly pages 206-219; NMR chapter, pa... Date Added: 2009-06-24 05:52:18 |
| summative_evaluation math.pdf Path: Wisc Stevens Point >> PFRAN >> 310 Fall, 2009 Description: University of Wisconsin - Stevens Point Student Teaching Summative Evaluation Report Teacher Candidate: Paul Frank Cooperating Teacher: Laurie Sloma Grade/Subjects Taught: Freshmen/Sophomore Geometry School: Waupaca High School City: Waupaca DE... Date Added: 2009-06-24 05:53:41 |
| Lecture_7_Link_Margin_Thermo.xls Path: Sanford-Brown Institute >> EN >> 176 Fall, 2009 Description: \"Thermodynamicist\'s\" downlink budget for BPSK modulation earth rad (km) c (Gm/s) Eb/No at 1e-6 (dB) orbit altitude (km) carrier freq (GHz) antenna diam (m) system noise (K) Tx power (W) bit rate (bps) s/c ant. gain (dB) Boltzmann\'s Const wavelength (... Date Added: 2009-06-24 05:53:45 |
| 572-Assignment4-F05.doc Path: CSU Long Beach >> CECS >> 572 Fall, 2008 Description: CECS 572 Advanced Computer Networking Assignment 4 Due Wednesday, November 9, 2005 Answer the following questions from Kurose and Ross, Chapter 6: 1. Review Question 1, page 559. 2. Review Question 3, page 559. 3. Review Question 4, page 559. 4. Pro... Date Added: 2009-06-24 05:55:22 |
| centibots-title.pdf Path: Harvard >> CS >> 285 Fall, 2009 Description: Task inference and distributed task management in the Centibots robotic system Charles L. Ortiz, Jr. Regis Vincent Benoit Morisset Artificial Intelligence Center SRI International 333 Ravenswood Avenue Menlo Park, CA 94025 U.S.A {ortiz | vincent | mo... Date Added: 2009-06-24 05:56:19 |
| lab08.pdf Path: Allan Hancock College >> COSC >> 3011 Fall, 2009 Description: COSC 3011/3911 Scientific Computing Laboratory Session 8 Question 1 (3011 & 3911): The fluid model for traffic presented in lectures assumes a simple linear relationship between velocity v and density . This leads to a parabolic relation for the flux... Date Added: 2009-06-24 05:56:31 |
| compositespowder.pdf Path: Michigan State University >> ME >> 477 Fall, 2008 Description: ME477 Fall 2004 General Classification Shaping Processes for Polymer Matrix Composites (PMC) 1. 2. 3. 4. 5. 6. Metals Starting Materials for PMC Open Mold Processes Ceramics Polymer Closed Mold Processes Filament Winding Rubber Glass Pultrusion Pro... Date Added: 2009-06-24 05:57:20 |
| YMR270C.t2k.dssp-ehl2-logo.pdf Path: UCSC >> YMR >> 270 Fall, 2009 Description: YMR270C.t2k DSSP-EHL2 1 CC 1 C H H C C C C C C H C C C C H E C E E C C C C C H H C C C C C C C C C C C C C C C C C C H C H C C X X X X X X X X X X X X X X X H H X X 10 20 30 40 H 1 C X C C C X X X H T E H 51 60 70 80 90 H E H 1 CEECC... Date Added: 2009-06-24 05:58:48 |
| L5_1.pdf Path: Washington >> ARCH >> 3431 Fall, 2009 Description: L5 Thermal Comfort 4/15/08 Thermal Comfort ARCH 331/431 Spring 2008 Lecture 5 announcements 4/15/08 A3: Envelope Heat Transfer Available on Thursday, 4/17 Due: week 5 Quiz 2: Tuesday 4/22 Climate Analysis II. Analysis and Graphic Articulation Cl... Date Added: 2009-06-24 05:58:55 |
| ranges.pdf Path: Texas A&M >> GEOG >> 203 Fall, 2008 Description: 10k b.p. F G Community Response C D A B E I H 5k b.p. C D A E B Present A B I J F G Individualistic Response C D A B E B H A C D G H E I A B J ... Date Added: 2009-06-24 06:00:09 |
| lec2_phk.pdf Path: CUNY Baruch >> GEOG >> 221 Fall, 2009 Description: Lecture 2 Economic Geography Source: Wheeler et al., p38 Elements in Economic Development i) Population Characteristics -the rate of demographic growth and structure and the makeup of the population ii) Cultural Attribute -is fundamental to the cl... Date Added: 2009-06-24 06:00:26 |
| 04fafb.doc Path: Drake >> ECON >> 001 Fall, 2009 Description: Principles of Macroeconomics (Econ 1) Drake University, Fall 2004 William M. Boal Signature: Printed name: FINAL EXAMINATION VERSION B December 16, 2004 SECTION: In which section are you enrolled? Please check one box. CRN 3521 12:30-1:45 CRN 3523 ... Date Added: 2009-06-24 06:01:46 |
| table22.pdf Path: ECCD >> EARTHSCI >> 149 Fall, 2009 Description: TABLE 22. COMPOSITE LISTS OF PALYNOMORPHS FROM KIRTLAND FORMATION Ojo Alamo Type Area Pot Mesa Locality Abietineaepollenites Appendicisporites sp. Aequitriradites Alnipollinites Aquilapollenites 3 sp. Aquilapollenites Aquilapollenites quadrilobus Are... Date Added: 2009-06-24 06:02:04 |
| 445 Slides Attribution 2.doc Path: Washington >> FACULTY >> 445 Fall, 2009 Description: 0ca2cd05f699229b81506a93dd24238513d727db.doc 0ca2cd05f699229b81506a93dd24238513d727db.doc Last saved: 11/9/2003 10:40:00 PM 1 Slide 1 Attribution 2 _ _ _ _ _ _ _ Review Attributions are answers to why questions Like trained psychologists... Date Added: 2009-06-24 06:02:12 |
| linear_algebra.pdf Path: UWO >> CHAPTER >> 359 Fall, 2009 Description: Linear Algebra Background n n matrix P * i, jth element = Pi,j * multiplication, addition, associativity, commutativity (or not) * transpose, inverse, symmetry, idempotence, determinant, trace, definiteness Facts: (P T)-1 = (P -1)T, T T (P1P2)T ... Date Added: 2009-06-24 06:04:18 |
| ode.pdf Path: St. Mary MD >> CAS >> 708 Fall, 2009 Description: CS708, S. Qiao Part 6, Page 1 Ordinary Differential Equations Initial Value Problem (first order): find y(t) such that y = f (y, t) given initial value y(t0 ), usually assume t0 = 0 A differential equation has a family of solutions, each correspon... Date Added: 2009-06-24 06:04:56 |
| YOR286W.t2k.stride-ebghtl-logo.pdf Path: UCSC >> YOR >> 286 Fall, 2009 Description: YOR286W.t2k EBGHTL 3 2 1 C TC H H T X X 1 10 20 30 40 H 3 2 1 T E H H T E H T E EEE CC C X GG C T T C T T C C G C B C C G T G T C T E T C G T T C C C H C T G X X X X X X X XXEXXTXTECCCCCCHXXXXCXXXXXXXXCTXXXGXX X X X T CETTTTGGHH X ... Date Added: 2009-06-24 06:05:21 |
| 4.ppt Path: Carnegie Mellon >> EE >> 525 Fall, 2009 Description: [M2] Huffman Encoder Project Howd - Zur Hung Eric Lai Wei Jie Lee Yu - Chiang Lee Design Manager: Jonathan P. Lee Overall Project Objective: Design a Low Power Huffman Encoder Presentation #4 Huffman Encoder Project Status Design Proposal Chip Arch... Date Added: 2009-06-24 06:05:51 |
| YOR217W.t2k.str2-logo.pdf Path: UCSC >> YOR >> 217 Fall, 2009 Description: 4 3 2 1 C CC CSTC HSC H SCSS H S H C H XSXXXXXXX X X S H H T X GT GG C TT C H H T H X H H 1 10 20 30 40 G 6 5 4 3 2 1 H T T H G H H HHHH X X X X H C T S T T T T S X X X X X X X X X X X X X X HT H T C S H HC CH 51 60 70 80 ... Date Added: 2009-06-24 06:05:52 |
| YOR217W.t2k.CB_burial_14_7-logo.pdf Path: UCSC >> YOR >> 217 Fall, 2009 Description: YOR217W.t2k CB_BURIAL_14_7 3 2 1 AAA X B B B B AAA AB BAB BCBBCBACCAACC X C B D D CE B E E E D BC E C C C D D D B A D D C E F D D D C D C C ACDDBDCBCDDDEDDFCD CDDEDDDCEDDDEFAD C C E C C D D D D D A A A A D C D C D D D D D D D D E D D X X X X X X X... Date Added: 2009-06-24 06:05:52 |
| res.pdf Path: Texas >> E >> 871 Fall, 2008 Description: !% }% \"yF(888F% p\"F@\"%6F%1m06 o yssB)$8\"m|6\"m#Ds\')V68m%10 o \" 1 C 8Fm)CYo 9 t r r\'!% r t t rB r! 4 % t r \' r\' 4 9 t qB\' A q r\'!% r t % r \' r\' 4 9 y\"F@\")wy6\"s1B)DF\"m|66F8wCYw9 v rB\' B# \' # E% x q r\'!% r t % 4 \' r\' ... Date Added: 2009-06-24 06:06:35 |
| Engineering the Brain.doc Path: S.F. State >> ART >> 511 Fall, 2008 Description: Engineering the Brain New tools are allowing neuroscientists to precisely control neurons. By Edward Boyden Audio o Listen - Flash o Listen - MP3 o o Subscri be to podcast What is this? Powere d by o Share o Digg this o Add to del.icio. us... Date Added: 2009-06-24 06:07:46 |
| sphere_space.ps Path: Southern Oregon >> LEC >> 025 Fall, 2009 Description: %!PS-Adobe-2.0 %Title: sphere_space.ps %Creator: fig2dev Version 3.2 Patchlevel 3d %CreationDate: Sat Jan 15 13:42:40 2005 %For: zzdjeffe@occ (jeffery david) %Orientation: Portrait %Pages: 2 %BoundingBox: 0 0 612 792 %BeginSetup %IncludeFeature: *Pag... Date Added: 2009-06-24 06:09:27 |
| septa2.pdf Path: Penn State >> ARM >> 5077 Fall, 2009 Description: ... Date Added: 2009-06-24 06:11:28 |
| 4052checkingaccounts.pdf Path: Michigan State University >> WEB >> 4000 Fall, 2009 Description: AGRISCIENCE AND NATURAL RESOURCES EDUCATION CURRICULUM (4000) Curriculum Area: BUSINESS MANAGEMENT AND MARKETING (4050) Unit: ACCOUNTING / ECONOMIC PRINCIPLES Leyna Dussel (4052) Topic: Checking Accounts Topic Objectives: Upon completion of this les... Date Added: 2009-06-24 06:13:35 |
| L06.ppt Path: Wilfrid Laurier >> CPSC >> 233 Fall, 2009 Description: Functions Continued Re re Param te fe nce e rs VariableS cope Function De sign 1 Reference Parameters type num1; int& num2) { i... Date Added: 2009-06-24 06:14:57 |
| Activity Sheet.doc Path: N. Georgia >> MJSMIT >> 3585 Fall, 2009 Description: Phase Changes Lab Date _ Materials Needed: Baby food jar and lid, aluminum foil, scissors, masking tape, two ice cubes (small enough to fit in jar), table salt, paper towels, candle and matches. My Guess: What I Do NOT Do: Do not remove the ice f... Date Added: 2009-06-24 06:15:03 |
| swb_timeinfo_1s.txt Path: Berkeley >> ASTRO >> 00296805 Fall, 2009 Description: #file=swb15-350lc.txt dt=1.0 tstart=0.810 tstop=15.210 #t90 dt90 t50 dt50 rt90 drt90 rt50 drt50 rt45 drt45 tav dtav tmax dtmax trise dtrise tfall dtfall cts cts_err pk_rate dpk_rate band 10.000 1.344 3.000 0.197 6.000 0.... Date Added: 2009-06-24 06:15:14 |
| laura malone hw3.doc Path: UNC >> HW >> 111 Fall, 2009 Description: Laura Malone February 2, 2006 BMME 111 HW 3 Problem 1: EKG (Heart Electrocartiogram) a. Sensor/transducer sticky electrodes b. The EKG uses a bridge amplifier to track the electronic signals of the heart through the skin. c. d. The EKG can be use... Date Added: 2009-06-24 06:16:04 |
| 97r.doc Path: Middlebury >> F >> 1087 Fall, 2009 Description: Chapter 97 Mickey Gilchrist Westminister Abbey Mausoleums Queen Elizabeth I Sarcophagus apsidal chapel relics Amiens Chartres Canterbury Royal peculiar William the conqueror Edward the confessor Prince Andrew Sarah Ferguson Henry V Diana Princess of ... Date Added: 2009-06-24 06:18:14 |
| Ni09_AP11.pdf Path: Washington University in St. Louis >> FL >> 2300 Fall, 2009 Description: 2007 Pearson Education, Inc., Upper Saddle River, NJ. All rights reserved. This material is protected under all copyright laws as they currently exist. No portion of this material may be reproduced, in any form or by any means, without permission in... Date Added: 2009-06-24 06:21:10 |
| Ni09_P59.pdf Path: Washington University in St. Louis >> FL >> 2300 Fall, 2009 Description: 2007 Pearson Education, Inc., Upper Saddle River, NJ. All rights reserved. This material is protected under all copyright laws as they currently exist. No portion of this material may be reproduced, in any form or by any means, without permission in... Date Added: 2009-06-24 06:21:20 |
| eut4108_seance_03_etudes_exploratoires_descriptives.ppt Path: Université du Québec à Montréal >> EUT >> 4108 Fall, 2009 Description: Benoit Duguay, 2009 Plan la sance 3 Les tudes exploratoires et descriptives Donnes primaires et secondaires Recherche exploratoire Analyse qualitative vs quantitative Mthodes d\'analyse qualitative Mthodes d\'analyse quantitative tudes par ... Date Added: 2009-06-24 06:21:28 |
| M112_Assignment01_winter_2008.pdf Path: UMBC >> MATH >> 112 Fall, 2009 Description: Okanagan College Math 112 (71) Winter 2008 Assignment One Instructor: Clint Lee Due: Tuesday, February 12 Instructions. Do all parts of all 7 questions. Show all significant steps in your work. You will not receive any marks for just an answer, even ... Date Added: 2009-06-24 06:21:31 |
| hw3.pdf Path: UCSC >> CMPS >> 180 Winter, 2008 Description: CMPS 180: Homework 3 Due by 5PM, Friday Feb 11th 1. Solve exercises 5.2.1, 5.2.3, 5.2.4, 5.2.5, 5.2.8, 5.2.10 2. You are given the following relational schema: P erson(P ersonID, N ame, Sex, CityOf Birth) P arent(P arentID, ChildID) P arentID and Ch... Date Added: 2009-06-24 06:21:58 |
| Review for MT2.pdf Path: UCSB >> PSTAT >> 120 Fall, 2009 Description: Review Questions for Exam II Sections Covered 8.1, 8.2, 9.1-9.4, 9.6-9.7 You will also need to know the results about order statistics (6.7) and the useful theorems in Ch. 7. 8.13 - Page 395 9.43 - Page 463 9.70 - Page 475 9.82 (a), (b) - Page 481... Date Added: 2009-06-24 06:22:02 |
| exam1_sample.pdf Path: Arizona >> CE >> 210 Fall, 2009 Description: CE 210 Exam #1 (50 minutes) (SAMPLE) Last name: _ First name: _ Lab Section: _ Draw: Using your tools. Sketch: By hand, no tools needed. 1. (10 points) Letter the following statement in 5/32 - in. (4mm) capital letters using an appropriate pencil. Th... Date Added: 2009-06-24 06:22:51 |
| 1020L28.pdf Path: Colorado >> PHYS >> 1020 Fall, 2008 Description: http:/physics.colorado.edu/phys1020 Judah Levine JILA S-460 Judah.Levine@colorado.edu 303 492-7785 (2-7785) Tuesday, Thursday 9-11 am also by appointment Drop-ins with short questions welcome with no appointment Judah Levine, 1020L28 1 Announcement... Date Added: 2009-06-24 06:23:02 |
| Ch 11 - Process Assessment.pdf Path: Muskingum >> ACCT >> 420 Fall, 2009 Description: Systems Study: Planning and Analysis Business Process Improvement Assessment Introduction The System Development Life Cycle: An Introduction Systems Planning and the Initial Investigation Systems Analysis The Systems Development Life Cycle Wh... Date Added: 2009-06-24 06:24:45 |
| Ch1_DominantTerms_ans.pdf Path: Iowa State >> M >> 165 Fall, 2009 Description: MIKE ANCTIL MATH 165, LIMITS AT INFINITY: DOMINANT TERMS 1. lim x 2 x 5 + 27 x 2 - 2 x 2.5 - 27 x + 5 Don\'t let the radical trick you. x5 = x 2.5 25 lim 2.5 x x 2 = 2 1 5 x3 - x 2 + 17 2. lim x x 2 - 13 x + 1 Make sure you catch that x 3 < ... Date Added: 2009-06-24 06:28:29 |
| quiz4_f08.pdf Path: Wyoming >> M >> 2200 Fall, 2009 Description: Math 2200 September 12, 2008 Show all work for credit. Quiz 4 Name: Use of calculators or other aids is not permitted. 1. Evaluate the following limits: (a) lim x3 - 3x + 1 x2 (b) lim t0 16 + t - 4 t (c) lim x2 - 9 x3 x - 3 ... Date Added: 2009-06-24 06:28:47 |
| quiz4.pdf Path: Iowa State >> M >> 307 Fall, 2009 Description: MATH 307 FALL 2002 QUIZ 4 Name: 2 1 z 1. (8 points) Let A = 0 3 1 . 1 z 4 a) Compute det A. b) Using the result of a) find all values of z for which A is invertible. 2. (4 points) Suppose that a matrix U has the property that U T = U -1 (such... Date Added: 2009-06-24 06:29:04 |
| 5edsoftwarefinal.doc Path: CSU Northridge >> GAA >> 76717 Fall, 2009 Description: Name: June 16, 2005 (1) General Software Review. In this activity you will be reviewing software that you would find useful in your roll as... Date Added: 2009-06-24 06:30:09 |
| PHARlecture6Notes.doc Path: Allan Hancock College >> PHAR >> 2811 Fall, 2009 Description: PHAR2811 Dale\'s lecture 6 Page 1 Phar lecture 6: DNA repair and Mutation Repair : Repair of DNA is vital to the survival of the species. DNA has the capability to repair itself, unlike RNA. The extra copy provides the template and elaborate repair ... Date Added: 2009-06-24 06:30:23 |
| Access Workshop.pdf Path: Cuyamaca College >> COMP >> 3503 Fall, 2009 Description: Managing Data with Access Dr. D Silver Comp 3503 Technology Workshops A c c e s s Managing Data What are we Coving. Planning a Database g tin ea t s Cr por Re Creating Forms Creating Tables Modifying Tables Working with Queries Classroom Suppo... Date Added: 2009-06-24 06:31:16 |
| M2210_syl_s09.pdf Path: Weber >> MATH >> 2210 Fall, 2008 Description: CALCULUS III MATH 2210, CRN 30777, Spring 2009 http:/faculty.weber.edu/aghoreishi/Math2210_s09/Math2210_s09.asp/ Prerequisite: Math 1220, with a grade of C or better, or placement test. Text: Required: Optional: Calculus by James Stewart, 5th Edition... Date Added: 2009-06-24 06:33:39 |
| Lab08s01.pdf Path: Georgia Tech >> ECE >> 2025 Fall, 2008 Description: GEORGIA INSTITUTE OF TECHNOLOGY SCHOOL of ELECTRICAL and COMPUTER ENGINEERING ECE 2025 Spring 2001 Lab #8: Everyday Sinusoidal Signals Date: 5-29 March 2001 * Lab #8 will be graded out of 150 points. * This is the official Lab #8 description; it is ... Date Added: 2009-06-24 06:33:41 |
| T0473.t04.pb-logo.pdf Path: UCSC >> T >> 0473 Fall, 2009 Description: T0473.t04 pb 6 5 4 3 2 1 1 10 20 30 40 D 6 5 4 3 2 1 F K F K M F K M N O P A F H I A K G M F K M N O P A 51 F K M 60 DA D KLVKE LNEYFEKKEV 50 MK I TKDMI IADVLQMDRGTAPIFINNG M HC L GC P S SM G E S IE D A C AV H G I ... Date Added: 2009-06-24 06:35:04 |
| Comm_Outreach.pdf Path: Middlesex CC >> ID >> 3828 Fall, 2009 Description: Community Outreach CAREER TRAINING CENTER The Career Training Center provides adults with the opportunities to enhance their present career or prepare for a new career through computer-based training programs. These programs, which meet the needs of ... Date Added: 2009-06-24 06:36:33 |
| PrExam2a-109-f04.pdf Path: Carleton >> MATH >> 109 Fall, 2009 Description: 7 F T U TD \' 320 \' % )( 3 )2 q 32 u ` E ` Y E U X S E UR W R E G F ED i 7 F U WD 3 ) 9 5 ) 5 32 6 3 5( \' % # % 3 # & 9 3 ) 6 # q 32 ... Date Added: 2009-06-24 06:38:33 |
| syllabus.pdf Path: Bethel VA >> CS >> 644 Fall, 2009 Description: Advanced Topics in Computer Networking CS644 (01333) Fall 2008/2009 Class Meetings: Wednesdays and Fridays, 1:10pm - 3:00pm Stocker 326 (mostly) Instructor: Dr. Shawn Ostermann Office: Office hours: Stocker 330 (through 335) 59-31234 Mondays at 10... Date Added: 2009-06-24 06:38:52 |
| D08synjunsedlabankans.pdf Path: Columbia >> JS >> 3204 Fall, 2009 Description: Birtist Deiglan.com, 21. janar 2008. Synjun Selabankans Jn Steinsson Fyrir rmum mnui lagist Selabankinn gegn v a Kauping fengi leyfi til ess a fra bkhald og semja rsreikninga evrum. essi afstaa Selabankans var bygg tiltlulega einstrengingslegri t... Date Added: 2009-06-24 06:39:46 |
| alphatest.doc Path: UGA >> MYWEB >> 6200 Fall, 2009 Description: PARTICIPANT PROFILE Name: Age: Gender: Occupation: Education: EXPERT REVIEW SURVEY Directions Please highlight or mark your rating on each aspect of the Greenhouse Environmental Controls Training Unit. Answer each question according to the scale bel... Date Added: 2009-06-24 06:47:19 |
| Note33.ppt Path: Wisc Platteville >> CS >> 143 Fall, 2009 Description: Selection Sorting Pseudocode (Forward) for i = 0 to size - 2 find the index of the required element between s[i] and s[size - 1] If i not the same as index swap s[i] and s[index] - Selection Sorting Pseudocode (Backward) for i = size 1 to 1 find th... Date Added: 2009-06-24 06:47:32 |
| Exercise on Hospital Incinerator.doc Path: New College FL >> BSC >> 4057 Fall, 2009 Description: vti_encoding:SR|utf8-nl vti_timelastmodified:TR|10 Jan 2001 02:53:55 -0000 vti_title:SR|Exercise on Hospital Incinerator vti_syncwith_localhost\\:80/copy_of_gilchrist:TR|10 Jan 2001 02:53:55 -0000 vti_syncwith_131.247.152.8\\:80/gilchrist:TR|10 Jan 200... Date Added: 2009-06-24 06:49:07 |
| practiceproblems_week3.pdf Path: Wisconsin >> ECON >> 101 Fall, 2008 Description: Practice Problems-Week 3 ECON 101-Principles of Microeconomics TA: Robert Kelchen Problem 1 There are two goods in the economy: coconuts and bananas. Draw at least two indifference curves and indicate which one is preferred in the following situation... Date Added: 2009-06-24 06:50:55 |
| coffin_diac4class.key.pdf Path: Georgia Tech >> LCC >> 2400 Fall, 2008 Description: Jil 1 For this study, I took a look at successful open source hacker communities and teased out characteristics that they held in common. Then I applied these characteristics as a framework to analyze non-hacker communities which have adopted the o... Date Added: 2009-06-24 06:53:01 |
| problemset2.ps Path: Iowa State >> CS >> 573 Fall, 2009 Description: %!PS-Adobe-2.0 %Creator: dvips 5.519 Copyright 1986, 1993 Radical Eye Software %Title: problemset2.dvi %CreationDate: Fri Oct 6 13:52:53 2000 %Pages: 3 %PageOrder: Ascend %BoundingBox: 0 0 612 792 %EndComments %DVIPSCommandLine: dvips problemset2 %DV... Date Added: 2009-06-24 06:53:20 |
| lesson3.pdf Path: St. John Fisher >> KEEP >> 04733 Fall, 2009 Description: Lesson Plan # 3 Grade: 5th Time: 3 days at 1 hour intervals. Objective: SWBAT understand how senators do their job. SWBAT understand how congress is elected. SWBAT how house members do their job. NYSS: Social Studies # 5: Civics, Citizenship and ... Date Added: 2009-06-24 07:00:29 |
| hw14.doc Path: BYU >> CE >> 562 Fall, 2009 Description: CE 562: Homework #14 Hints Problem 15-1 Problem 15-2 Problem 15-3 Problem 15-4 Draw visibility triangles between vehicles A and B and vehicles C and D. Then, read pages 393-397. Draw visibility triangles between vehicles A and B and vehicles A and C.... Date Added: 2009-06-24 07:02:20 |
| Zhengxi Zhu Macromolecular Rapid Communications.pdf Path: Minnesota >> ZHUXX >> 086 Fall, 2009 Description: 1736 Communication Summary: Polypyrrole nanotubes with high electric conductivity and azo function have been fabricated in high yield via an in-situ polymerization. During the process fibrillar complex of FeCl3 and methyl orange (MO), acting as a r... Date Added: 2009-06-24 07:03:06 |
| assignment_1.pdf Path: Washington >> MENGR >> 565 Fall, 2009 Description: Q u 2ifowpgwuw|gs ugfoy o r z x ryirvyx v u x uu xu uv u y u x x u x x y s ifo)7rfyx G@ig YGS y ir)fgsreu ov gy u x x u y v u y su x u xgx ofx uywu uqhgfoPwuW wgcggrgox o { v x p u x x u y y u x y ... Date Added: 2009-06-24 07:03:10 |
| skinpath.pdf Path: N. Illinois >> OLDBIOS >> 213 Fall, 2009 Description: GENERALIZATIONS Principal Pathogens- Gram reaction G+ve cocci 1. Several Pathogens causes multiple diseases Staph such as Staphylococcus Strep 2. some diseases- several pathogens (pneumonia, meningitis) G+ve Bacilli Corynebacterium Bacillus 3. Bacter... Date Added: 2009-06-24 07:06:35 |
| MEW 1111 2p5 to 2p7.pdf Path: Colorado >> CHEM >> 1111 Fall, 2008 Description: Chapter 2: The Components of Matter 2.5 The Atomic Theory Today 2.6 Elements: A First Look at the Periodic Table 2.7 Compounds: Introduction to Bonding General features of the atom today. The atom is an electrically neutral, spherical entity compose... Date Added: 2009-06-24 07:07:51 |
| Week_12_TutorialCH12[1].pdf Path: Colorado >> CHEM >> 1111 Fall, 2008 Description: CHEM 1111 Tutorial (Chapter 12) Spring 2007 April 9-13 Recitations Topics for Review Molecular Interactions 1. Calculate the heat released when 36.0 g gaseous water at 120C changes to ice at 10C. (Hfus = 6.02 kJ/mol; Hvap = 40.7 kJ/mol; Csolid = 37... Date Added: 2009-06-24 07:08:05 |
| cover.doc Path: UF >> PROJECT >> 4600 Fall, 2009 Description: COP 4600 - Operating Systems, Summer 2001 Project One Minix Multitasking and Communication Using Pipes Full Name: _ CISE Username: _ Please read the following and sign below. This assignment will not be accepted until signed. I have read and underst... Date Added: 2009-06-24 07:08:29 |
| Ohmori4.ppt Path: Stanford >> MSANDE >> 237 Fall, 2009 Description: 1 Experiments using Stratospheric platform (July 2002 at Hawaii) Pathfinder-Plus Wing length: 36.3m Wing width: 3.4m Propeller: 8-DC motors Payload: 50kg Mission power: 600W AeroVironment developed for NASA (Environmental Research Aircraft and... Date Added: 2009-06-24 07:08:42 |
| Math113Handout6_answers.pdf Path: UConn >> MATH >> 113 Fall, 2009 Description: Math 113 Trigonometric Substitution & The Method of Partial Fractions Answers Compute the following integrals. 1. 10 dx 25 - x2 2 25 - x2 Answer: - +C 5x x2 2. 1-x dx x arcsin(2x - 1) Answer: + x - x2 + C 2 3. 5-x dx 2x2 + x - 1 Answer: 3 l... Date Added: 2009-06-24 07:19:59 |
| Results Summary Scaled.xlsx Path: RIT >> P >> 09712 Fall, 2009 Description: HAMBURGERS New KRoll Speeds Old KRoll Speeds New KRoll Speeds HOT DOGS Old KRoll Speeds Defects (4 Buns) Throughput (8 Buns) Defects (4 Buns) Throughput (8 Buns) Defects (4 Buns) Throughput (8 Buns) Defects (4 Buns) Throughput (8 Buns) 121 995 182 ... Date Added: 2009-06-24 07:20:17 |
| review-ind.pdf Path: Allan Hancock College >> COMP >> 3500 Fall, 2009 Description: Page . of . Individual Review Form Review team: Project: Document: Reviewer: . . . . Date . . . .. Total: Issue No. . . . . . . . . . . . . . . . . . . . . Preparation Log Time Spent (mins) . . . . _ . Severity . . . . . . . . . . . . . . . . . . ... Date Added: 2009-06-24 07:22:22 |
| 2-Electromagnetic Communications.ppt Path: BYU >> IT >> 443 Fall, 2008 Description: Wireless Communications The scheme The real scheme Electromagnetics F1(t) = Sin t F1(t) = Sin t 3 F2(t) = Sin 3 t F1(t) = Sin t 3 F2(t) = Sin 3 t F(t) = F1(t) + F2(t) F1(t) = Sin t 3 F2(t) = Sin 3 t 5 F3(t) = Sin 5 t F1(t) = Sin t 3 F2(t... Date Added: 2009-06-24 07:24:37 |
| 04_PvsChild.pdf Path: CSU San Marcos >> LBST >> 361 Fall, 2009 Description: Quality of Life Research 13: 12971307, 2004. 2004 Kluwer Academic Publishers. Printed in the Netherlands. 1297 How well do parents know their children? Implications for proxy reporting of child health-related quality of life A. Jokovic1, D. Locker... Date Added: 2009-06-24 07:24:59 |
| attachment-0001.pdf Path: New Mexico >> CS >> 481 Spring, 2008 Description: CS 481: Operating System Principles Spring \'09 Problem Set #4: File Systems Due: Tuesday, April 21 (in class) 1) In FFS, 3 categories of optimizations were made: reduce internal fragmentation, leveraging hardware characterstics and improved data layo... Date Added: 2009-06-24 07:31:00 |
| GPA07007-GPAR-FIGURE6.pdf Path: Cuyamaca College >> DOCS >> 090326 Fall, 2009 Description: Embly General Plan Amendment Report DPLU Case # PAA 06-012 FIGURE 6 SLOPE ANALYSIS Embly 5466.00 GPAR Page 33 of 108 Revised 1/29/2009 ... Date Added: 2009-06-24 07:33:00 |
| POD08012-LA.pdf Path: Cuyamaca College >> DOCS >> 081107 Fall, 2009 Description: . County of San Diego DEPARTMENT OF PLANNING AND LAND USE 5201 RUFFIN ROAD, SUITE B, SAN DIEGO, CALIFORNIA 92123-1666 INFORMATION (858) 694-2960 TOLL FREE (800) 411-0017 www.sdcounty.ca.gov/dplu NOTICE OF PREPARATION OF AN ENVIRONMENTAL IMPACT REPO... Date Added: 2009-06-24 07:33:10 |
| Lecture_9_logistic.ppt Path: Oregon State >> FRWS >> 3810 Fall, 2009 Description: SECOND LAW OF POPULATIONS: Population growth cannot go on forever - P. Turchin 2001 (Oikos 94:17-26) !? The Basic Mathematics of Density Dependence: The Logistic Equation How does population growth change as numbers in the population change? We can... Date Added: 2009-06-24 07:33:53 |
| syllabus_March_1_2005.pdf Path: Oregon State >> FRWS >> 3810 Fall, 2009 Description: FRWS 3810 Plant and Animal Population Ecology Instructor: Dr. Jennifer Gervais BNR 177 797-8164 jennifer.gervais@usu.edu Office hours: M, W 12:00 - 1:30 or by appointment 2005 Teaching Assistant: Craig Thompson JQL 227 cthomp@cc.usu.edu Office hour... Date Added: 2009-06-24 07:33:58 |
| T0497.t06.o_notor-logo.pdf Path: UCSC >> T >> 0497 Fall, 2009 Description: T0497.t06 o_notor 3 2 1 1 10 20 30 40 N 3 2 1 H N P B N G N B N G N B P 51 60 70 80 90 N 3 2 1 H N P B N B A N B N B N H M N 101 110 120 130 H N G N G N B A B N G N A B N H 140 NP Y VAAWY EGGKDDPKLALLRL... Date Added: 2009-06-24 07:36:10 |
| T0497.t2k.bys-logo.pdf Path: UCSC >> T >> 0497 Fall, 2009 Description: T0497.t2k bys 4 3 2 1 10 20 30 40 G P 4 3 2 1 H G P G E P T H G T H P E P E P H P T S P E H 4 3 2 1 T P E H T G P E Y E G P H 101 110 120 130 P H P T P H G D H G E P H G E P S G H 140 NP Y VAAWY EGGKDDPKLALLRLDADHA Q IW L... Date Added: 2009-06-24 07:36:25 |
| soluc_quiz1.pdf Path: UCSC >> ENG >> 156 Fall, 2009 Description: # $ g S g a S q c X a # S a c S X a Sq X V # c S V V V X X S V ~ c T S # # $ g%X%H%UffT #`HaH%V #hUa`fW3HHT%HT `X`XHHedUXH%UX\'H%h# p%HUXfxH%h#hdHa g#H%3`f c T S # # W X a S a c c S V a X S f $ dHa g#H%HXe%Hfh%\'%X`W IhT $VTc S fX#V... Date Added: 2009-06-24 07:38:39 |
| 28OctBusiness.doc Path: Minnesota >> PHELP >> 008 Fall, 2009 Description: 1 HIST 3881 MERICAN BUSINESS AND THE POLITICS OF INTERNATIONAL A CONOMICS E Friday, 28 October ARGUMENT: While U.S. production increased after the Civil War, protectionist trade policies made it difficult for the U.S. government to secure... Date Added: 2009-06-24 07:41:59 |
| PowerPoint Guidelines.ppt Path: UVA >> EDLF >> 786 Fall, 2009 Description: PowerPoint Guidelines By: EDLF 786 PowerPoint Don\'ts Write exactly what you plan to say on the PPT slide Use distracting graphics PowerPoint Do\'s Make text large enough to read easily Proofread Make sure that graphics have a specific purpose ... Date Added: 2009-06-24 07:42:17 |
| c111_wk2_11am.pdf Path: Earlham >> CHEM >> 111 Fall, 2008 Description: Chemistry 11, 11 AM section Week of September 1, 2003 Atomic and Nuclear Structure Chapters 2 (secs 1-4), 21 Homework for this week: Chapter 2: 17 Chapter 21: 6, 11,12, 13, 23a,e, 24d,e, 53, 54, 57 Laboratory: Nuclear transformation and half-life ... Date Added: 2009-06-24 07:47:45 |
| 05fft.pdf Path: Princeton >> COS >> 423 Spring, 2009 Description: Fast Fourier Transform: Applications Convolution and FFT Applications. Optics, acoustics, quantum physics, telecommunications, control systems, signal processing, speech recognition, data compression, image processing. DVD, JPEG, MP3, MRI, CAT scan... Date Added: 2009-06-24 07:48:53 |
| 040109.pdf Path: Canada College >> BIOL >> 230 Fall, 2009 Description: ... Date Added: 2009-06-24 07:49:35 |
| baldwinetal1991.pdf Path: Bethel VA >> PBIO >> 480 Fall, 2009 Description: ... Date Added: 2009-06-24 07:49:48 |
| 2007_5K_Registration_Form.doc Path: Minnesota >> PETE >> 2497 Fall, 2009 Description: Presented by: PRSSA, Neuroscience Club, CLA Student Board and STLF 100% of Proceeds go to Research for Autism BE a hero, dress your HERO 5K Run for Research-Autism www.5krunforresearch.com REGISTRATION FORM SATURDA... Date Added: 2009-06-24 07:49:57 |
| Sign_upPresentations.doc Path: Washington >> TC >> 310 Fall, 2009 Description: SignUP sheet Group Presentations PowerPoint Poster: Monday October 8 Group Name: Group Members LastFM Amy | Kelvan | Eric Word Document: Monday October 15 Group Name: Group Members Pitaya Katherine | Shalina | Reshma | Christine Visio Si... Date Added: 2009-06-24 07:54:13 |
| ms431_2007W_syllabus.pdf Path: North-West Uni. >> MS >> 431 Fall, 2009 Description: M&S 431: Business Strategy, Section 71 Winter Quarter 2007 Course Syllabus Professor Justin Lenzo 610 Leverone Hall Donald P. Jacobs Center j-lenzo@kellogg.northwestern.edu 1 1.1 Course Description Course Overview For the purposes of this course, ... Date Added: 2009-06-24 07:54:46 |
| ex2solns.pdf Path: Minnesota >> KIRC >> 0076 Fall, 2009 Description: Math 1051, Summer 2007, Exam II Solutions Name: KEY Instructions: This is the second midterm exam for Math 1051, precalculus. You have 55 minutes to complete the test. Do not start until you are told to begin. When you receive this booklet, count the... Date Added: 2009-06-24 07:56:43 |
| 11-cardiovascular_system.pdf Path: Orange Coast College >> BIOL >> 221 Fall, 2008 Description: The cardiovascular system The heart Located within mediastinum Enclosed by a double-layered serous membrane (= pericardium) The epicardium hugs the heart, while the parietal pericardium is external The fibrous pericardium supports the heart Layers ... Date Added: 2009-06-24 07:58:20 |
| Math731Fall05Syllabus.doc Path: University of South Dakota >> MATH >> 731 Fall, 2008 Description: Partial Differential Equations - Math 731 (3CR) University of South Dakota Fall 2005 Tuesday, Thursday 5:30pm-6:45pm Location: AS 103 (Presentations will be in Math. Lab. AS 16B) Instructor: Nan Jiang, PhD Office Hours: M 12:00-1:00pm ... Date Added: 2009-06-24 07:59:12 |
| Math471Fall04Syllabus.doc Path: University of South Dakota >> MATH >> 471 Fall, 2009 Description: Numerical Analysis I - Math 471/571 University of South Dakota Fall 2004 Tuesday, Thursday 11:00am-12:15pm Location: SL 302 (Lab will be held in Math. Lab. AS 16B) Instructor: Nan Jiang, PhD Office Hours: M-F 12:55 1:55pm Office/ Phone: 337 Dakota ... Date Added: 2009-06-24 07:59:20 |
| Math216Fall04Syllabus.doc Path: University of South Dakota >> MATH >> 216 Fall, 2008 Description: Discrete Structures - Math 216, Section 015 (3CR) University of South Dakota Fall 2004 MWF 11:00-11:50am (Location: SL 312) Contact Information: Instructor: Office Hours: Office / Phone: E-mail: URL: Course Description: Nan Jiang, PhD M-F 12:55 1:55... Date Added: 2009-06-24 07:59:25 |
| webhws.xls Path: University of South Dakota >> MATH >> 216 Fall, 2008 Description: Sheet1 vti_encoding:SR|utf8-nl vti_timelastmodified:TR|28 Jan 2003 16:31:50 -0000 vti_author:SR|njiang vti_timecreated:TR|28 Jan 2003 16:31:50 -0000 vti_backlinkinfo:VX| vti_extenderversion:SR|4.0.2.3015 vti_syncwith_localhost\\c\\:\\documents and sett... Date Added: 2009-06-24 08:00:01 |
| Lecture31.pdf Path: SD State >> MICR >> 422 Fall, 2009 Description: Hypersensitivity Reactions Type 1 - Antibody-mediated Allergy Type 2 - IgG-Mediated Cytotoxicity Type 3 -Immune Complex Hypersensitivity Type 4- DTH/Cell-mediated Allergy Hypersensitivity Responses Allergic/Hypersensitivity responses are not necessa... Date Added: 2009-06-24 08:01:23 |
| Lab08S09.pdf Path: SD State >> BIOL >> 204 Fall, 2009 Description: If you have two alleles in a population with allele frequencies of p and q Population genetics Laboratory 8 Then allele frequencies: p+q=1 and Expected genotypic frequencies: p2 + 2pq + q2 = 1 Genotypes 31 TPAAluI/TPAAluI = 62 TPAAluI 44 TPAAluI/T... Date Added: 2009-06-24 08:01:35 |
| section09.pdf Path: Tennessee >> MATH >> 152 Fall, 2009 Description: MATH 152 Notation: formulas for obtaining derivatives section 9 Derivatives of Elementary Functions: Sum Rule: page 1 of 2 MATH 152 Product Rule: formulas for obtaining derivatives section 9 Quotient Rule: Reciprocal Rule: page 2 of 2 ... Date Added: 2009-06-24 08:05:02 |
| winter outline.pdf Path: Brookdale >> AC >> 292 Fall, 2009 Description: BROCK UNIVERSITY COURSE OUTLINE ECON 2P92: Research Methods in Economics, Winter 2006/07 Lectures: Seminars: Tuesday and Thursday, 11:00 12:30, TH246 S1- Friday, 11-12, MC C401 S2- CANCELLED S3- Wednesday, 3-4, WH202 S4- Friday, 11-12, MC C400 Pr... Date Added: 2009-06-24 08:07:00 |
| strainplot.ps Path: Michigan >> PHYSICS >> 375 Fall, 2008 Description: %!PS-Adobe-2.0 %Title: ./s3/h1/375/strainplot.ps (Portrait A 4) %Pages: (atend) %Creator: HIGZ Version 1.27/03 %CreationDate: 2004/06/25 12.49 %EndComments %BeginProlog /s {stroke} def /l {lineto} def /m {moveto} def /t {translate} def /sw {stringwid... Date Added: 2009-06-24 08:07:15 |
| RevenueFinancingAttachment1.pdf Path: North Texas >> BORFEBRUAR >> 10112005 Fall, 2009 Description: ... Date Added: 2009-06-24 08:16:37 |
| hansen_imp_resp.pdf Path: Brandeis >> ECON >> 303 Fall, 2009 Description: Hansen Model: Tech. Shock on labor and capital 1.4 lambda labor capital 1.2 1 0.8 percentage 0.6 0.4 0.2 0 -0.2 0 5 10 15 20 25 periods 30 35 40 45 50 Hansen Model: Tech. Shock on q,c,i 7 lambda output consumption investment 6 5... Date Added: 2009-06-24 08:16:42 |
| GSP_Wshp_Guide.pdf Path: Los Angeles Southwest College >> MATH >> 532 Fall, 2009 Description: Professional Development Workshop Guide The Geometer\'s Sketchpad Workshop Guide Contents Tour 1: Constructing a Square 2 Tour 2: A Theorem About Quadrilaterals 5 Tour 3: Algebra Potpourri 8 Tour 4: Investigating Triangle Centers 11 Tour 5: Introduc... Date Added: 2009-06-24 08:17:39 |
| T0509.t06.CB8-sep9-logo.pdf Path: UCSC >> T >> 0509 Fall, 2009 Description: T0509.t06 CB8-sep9 3 2 1 M SN A F E Y L R T YV E S TT E T DA A V AR A RE D A A E F GL P A PD E M TG Q L LT T L AA T T N G NG S T G A I A I T P A AG L V G L Y I LN G L A D N T TL T C I D P E SE H Q R Q A K AL 1 10 20 30 40 50 60 70 80 90 A 3 2 1 EFA... Date Added: 2009-06-24 08:22:03 |
| quiz5key.pdf Path: Elmhurst >> MATH >> 341 Spring, 2009 Description: Math 341 Quiz #5 1. For the following dierential equation: dy = (y dt 1) (y + 2) = f (y) ; Name: KEY 1 < y0 < 1 (a) Sketch the graph of f (y) versus y and indicate all relevant information. (b) Sketch several graphs of solutions in the ty plane, m... Date Added: 2009-06-24 08:23:08 |
| exam3key.pdf Path: Elmhurst >> EXAM >> 152 Fall, 2009 Description: 1. Evaluate 1 4x5 dx 0 x6 +10 u = x6 + 10 du = 6x5 dx 2 1 4x5 dx = du 6 + 10 x 3 u 2 = ln |u| + C 3 2 = ln x6 + 10 + C 3 1 0 4x5 2 dx = ln x6 + 10 x6 + 10 3 0 2 2 = ln 11 - ln 10 3 3 11 2 = ln 3 10 1 2. Evaluate x e3x dx f (x) = x f (x) = 1 g (... Date Added: 2009-06-24 08:23:48 |
| SINUTOPO.pdf Path: Maryland >> PHIL >> 250 Fall, 2008 Description: ... Date Added: 2009-06-24 08:24:13 |
| textForSampleWebpage.doc Path: Washington >> TC >> 310 Fall, 2009 Description: Usability: An Important TC Topic Usability is an important design consideration in software and website design. A designer concerned about usability is concerned about the ability of users to use the software with minimal problems. A more precise exp... Date Added: 2009-06-24 08:25:00 |
| midterm03_ans.pdf Path: National Taiwan University >> ECON >> 741 Fall, 2009 Description: Econ 741 (Spring 2003): Suggested Answer for Midterm < Question 1 > a) Price elasticity of rose demand is -0.301 and cross price elasticity of rose demand is -0.102. In other words, on the average, the demand for rose falls 0.301 % as price of rose ... Date Added: 2009-06-24 08:26:41 |
| quiz02.pdf Path: Purdue >> MATH >> 261 Fall, 2009 Description: Math 261 Name: Quiz # 2 1. (5 pts.) Sketch a contour diagram with at least four labeled contours for the following function: f (x, y) = y - x2 . 2. (10 pts.) Rachel sells home-grown radishes every Saturday at the outdoor farmer\'s market. The numbe... Date Added: 2009-06-24 08:28:57 |
| w6example.pdf Path: Coastline Community College >> ENGLISH >> 100 Fall, 2009 Description: Those Happy People By Rachel Aihara Who are these people, and why are they so happy? They are the girls, and sometimes guys, who fill the halls of your school: your friends who you hold many dear memories of, your foes whose memories you wish you cou... Date Added: 2009-06-24 08:30:21 |
| chap11.pdf Path: Coastline Community College >> EDU >> 180 Fall, 2009 Description: Chapter 11-Summary-Traditional and Innovative Strategies for Working Together* This chapter examines traditional and innovative practices for collaborative action. The authors contend that successful schools need to become embedded partners with pare... Date Added: 2009-06-24 08:30:26 |
| lincode.pdf Path: UNL >> M >> 203 Fall, 2009 Description: asas aaesa aaes ases C b h b b E R h V C C V d C R X b G h G E i t ` R h b C V GV ` V t E R h R X H G E b h d h R G X H G ` R V d i C C X g C t b h ecceccsUaYcFFIacqfU#IIjIaFmYla&akeI#cejIIwIIFcahFIcaD e E t h i ` RV h... Date Added: 2009-06-24 08:36:23 |
| dis4.pdf Path: Berkeley >> ME >> 106 Fall, 2009 Description: ... Date Added: 2009-06-24 08:37:18 |
| hw6.pdf Path: Berkeley >> ME >> 106 Fall, 2009 Description: ME 106 Fluid Mechanics Homework 6 Due Monday, 9 March TOPICS COVERED: Streamlines Calculating the acceleration field The velocity gradient Spring 2009 1. Munson, Problem 4.9. 2. Munson, Problem 4.15. 3. Munson, Problem 4.19. 4. (a) Munson, Prob... Date Added: 2009-06-24 08:37:19 |
| Small_groups.pdf Path: USP >> MATH >> 360 Fall, 2009 Description: Special Topics Course Lia Vas Groups with Small Number of Elements In this presentation, we will describe the groups with small number of elements. For us, \"small\" will mean at most 10 elements. This is relevant for point groups of molecules with sm... Date Added: 2009-06-24 08:41:05 |
| Section_16_4.pdf Path: USP >> MATH >> 202 Fall, 2009 Description: Double Integrals in Polar Coordinates (Section 16.4) Let z = f (x, y) be a function of two variables defined on a region D = { (r, ) | , r1 () r r2 () }. The double integral of f over D is f (x, y)dxdy = r2 () r1 () D f (r cos , r sin ) rd... Date Added: 2009-06-24 08:41:13 |
| 3b9b21f6.pdf Path: Wisconsin >> WILL >> 0031 Fall, 2009 Description: ... Date Added: 2009-06-24 08:52:00 |
| 3b9b23a8.pdf Path: Wisconsin >> WILL >> 0031 Fall, 2009 Description: ... Date Added: 2009-06-24 08:52:21 |
| 3b9b01ec.pdf Path: Wisconsin >> WILL >> 0025 Fall, 2009 Description: ... Date Added: 2009-06-24 08:53:36 |
| assign4.pdf Path: Ill. Chicago >> MTHT >> 411 Fall, 2008 Description: Math 411: Advanced Euclidean Geometry Contact Information Office hours or T: 4-5 or Th at 3-5,after class if desired or by appointment in 327 SEO. (Subject to change) Feel free to e-mail me at jbaldwin@uic.edu or phone to make an appointment to discu... Date Added: 2009-06-24 08:54:51 |
| 4876e9cd.pdf Path: Wisconsin >> WILL >> 0070 Fall, 2009 Description: ... Date Added: 2009-06-24 08:55:34 |
| 4876e801.pdf Path: Wisconsin >> WILL >> 0070 Fall, 2009 Description: ... Date Added: 2009-06-24 08:56:06 |
| 4876e99c.pdf Path: Wisconsin >> WILL >> 0070 Fall, 2009 Description: ... Date Added: 2009-06-24 08:56:06 |
| 48775a2e.pdf Path: Wisconsin >> WILL >> 0101 Fall, 2009 Description: ... Date Added: 2009-06-24 08:56:50 |
| 487707d2.pdf Path: Wisconsin >> WILL >> 0078 Fall, 2009 Description: ... Date Added: 2009-06-24 08:58:19 |
| 487708c6.pdf Path: Wisconsin >> WILL >> 0078 Fall, 2009 Description: ... Date Added: 2009-06-24 08:58:37 |
| 487708cb.pdf Path: Wisconsin >> WILL >> 0078 Fall, 2009 Description: ... Date Added: 2009-06-24 08:58:38 |
| 487709c0.pdf Path: Wisconsin >> WILL >> 0078 Fall, 2009 Description: ... Date Added: 2009-06-24 08:58:56 |
| 487733ca.pdf Path: Wisconsin >> WILL >> 0090 Fall, 2009 Description: ... Date Added: 2009-06-24 08:59:46 |
| Baxter_Internship_Program.pdf Path: CSU Northridge >> HFBIO >> 002 Fall, 2009 Description: Baxter\'s College Internship Opportunities Get your career moving with Baxter Healthcare Corp. (www.baxter.com) Baxter develops, manufactures and markets products that save and sustain the lives of people with hemophilia, immune disorders, cancer, inf... Date Added: 2009-06-24 08:59:52 |
| 487734c5.pdf Path: Wisconsin >> WILL >> 0090 Fall, 2009 Description: ... Date Added: 2009-06-24 09:00:04 |
| 4877333e.pdf Path: Wisconsin >> WILL >> 0090 Fall, 2009 Description: ... Date Added: 2009-06-24 09:00:40 |
| 487774d2.pdf Path: Wisconsin >> WILL >> 0109 Fall, 2009 Description: ... Date Added: 2009-06-24 09:01:32 |
| 487723e1.pdf Path: Wisconsin >> WILL >> 0086 Fall, 2009 Description: ... Date Added: 2009-06-24 09:03:39 |
| 487789d4.pdf Path: Wisconsin >> WILL >> 0115 Fall, 2009 Description: ... Date Added: 2009-06-24 09:06:56 |
| 3b9acd26.pdf Path: Wisconsin >> WILL >> 0002 Fall, 2009 Description: ... Date Added: 2009-06-24 09:07:19 |
| 3b9ace14.pdf Path: Wisconsin >> WILL >> 0002 Fall, 2009 Description: ... Date Added: 2009-06-24 09:08:04 |
| 3b9b3e13.pdf Path: Wisconsin >> WILL >> 0039 Fall, 2009 Description: ... Date Added: 2009-06-24 09:08:57 |
| 3b9b3ead.pdf Path: Wisconsin >> WILL >> 0039 Fall, 2009 Description: ... Date Added: 2009-06-24 09:09:17 |
| 1011.pdf Path: Wisconsin >> WILL >> 0055 Fall, 2009 Description: ... Date Added: 2009-06-24 09:10:41 |
| d67.pdf Path: Wisconsin >> WILL >> 0055 Fall, 2009 Description: ... Date Added: 2009-06-24 09:11:18 |
| d73.pdf Path: Wisconsin >> WILL >> 0055 Fall, 2009 Description: ... Date Added: 2009-06-24 09:11:20 |
| 48774ef4.pdf Path: Wisconsin >> WILL >> 0098 Fall, 2009 Description: ... Date Added: 2009-06-24 09:12:54 |
| 48774f32.pdf Path: Wisconsin >> WILL >> 0098 Fall, 2009 Description: ... Date Added: 2009-06-24 09:13:15 |
| 3b9b14ac.pdf Path: Wisconsin >> WILL >> 0015 Fall, 2009 Description: ... Date Added: 2009-06-24 09:15:53 |
| 3b9b33ad.pdf Path: Wisconsin >> WILL >> 0036 Fall, 2009 Description: ... Date Added: 2009-06-24 09:16:20 |
| 3b9b365a.pdf Path: Wisconsin >> WILL >> 0036 Fall, 2009 Description: ... Date Added: 2009-06-24 09:17:47 |
| 3b9b64d9.pdf Path: Wisconsin >> WILL >> 0049 Fall, 2009 Description: ... Date Added: 2009-06-24 09:18:49 |
| 3b9af69c.pdf Path: Wisconsin >> WILL >> 0009 Fall, 2009 Description: ... Date Added: 2009-06-24 09:19:42 |
| 3b9af710.pdf Path: Wisconsin >> WILL >> 0009 Fall, 2009 Description: ... Date Added: 2009-06-24 09:19:55 |
| 3b9afabb.pdf Path: Wisconsin >> WILL >> 0009 Fall, 2009 Description: ... Date Added: 2009-06-24 09:20:27 |
| 3b9af9b2.pdf Path: Wisconsin >> WILL >> 0024 Fall, 2009 Description: ... Date Added: 2009-06-24 09:20:42 |
| 3b9afd03.pdf Path: Wisconsin >> WILL >> 0024 Fall, 2009 Description: ... Date Added: 2009-06-24 09:21:46 |
| 3b9afd47.pdf Path: Wisconsin >> WILL >> 0024 Fall, 2009 Description: ... Date Added: 2009-06-24 09:21:52 |
| 4876ec00.pdf Path: Wisconsin >> WILL >> 0071 Fall, 2009 Description: ... Date Added: 2009-06-24 09:22:34 |
| 4876eca8.pdf Path: Wisconsin >> WILL >> 0071 Fall, 2009 Description: ... Date Added: 2009-06-24 09:23:03 |
| 4876eced.pdf Path: Wisconsin >> WILL >> 0071 Fall, 2009 Description: ... Date Added: 2009-06-24 09:23:15 |
| 3b9aca62.pdf Path: Wisconsin >> WILL >> 0001 Fall, 2009 Description: ... Date Added: 2009-06-24 09:23:52 |
| 3b9acbe5.pdf Path: Wisconsin >> WILL >> 0001 Fall, 2009 Description: ... Date Added: 2009-06-24 09:24:54 |
| 3b9acbf3.pdf Path: Wisconsin >> WILL >> 0001 Fall, 2009 Description: ... Date Added: 2009-06-24 09:24:57 |
| 48770b20.pdf Path: Wisconsin >> WILL >> 0079 Fall, 2009 Description: ... Date Added: 2009-06-24 09:25:45 |
| 48770bc8.pdf Path: Wisconsin >> WILL >> 0079 Fall, 2009 Description: ... Date Added: 2009-06-24 09:26:12 |
| 48770c13.pdf Path: Wisconsin >> WILL >> 0079 Fall, 2009 Description: ... Date Added: 2009-06-24 09:26:34 |
| 487785f5.pdf Path: Wisconsin >> WILL >> 0114 Fall, 2009 Description: ... Date Added: 2009-06-24 09:31:44 |
| section33.pdf Path: Ill. Chicago >> MATH >> 417 Fall, 2008 Description: Math 417 Section 33 Solutions 1. The derivatives of sin z and cos z are: d eiz - e-iz d sin z = dz dz 2i iz -iz ie + ie = 2i iz e + e-iz = 2 = cos z d d eiz + e-iz cos z = dz dz 2 iz -iz ie - ie = 2 iz e - e-iz =i 2 eiz - e-iz =- 2i = - sin z 2. Us... Date Added: 2009-06-24 09:32:00 |
| 3b9b40f6.pdf Path: Wisconsin >> WILL >> 0040 Fall, 2009 Description: ... Date Added: 2009-06-24 09:32:48 |
| 3b9b42ee.pdf Path: Wisconsin >> WILL >> 0040 Fall, 2009 Description: ... Date Added: 2009-06-24 09:33:23 |
| 3b9b43bb.pdf Path: Wisconsin >> WILL >> 0040 Fall, 2009 Description: ... Date Added: 2009-06-24 09:33:31 |
| 487701d0.pdf Path: Wisconsin >> WILL >> 0076 Fall, 2009 Description: ... Date Added: 2009-06-24 09:35:26 |
| 4877010d.pdf Path: Wisconsin >> WILL >> 0076 Fall, 2009 Description: ... Date Added: 2009-06-24 09:35:46 |
| 48776d0f.pdf Path: Wisconsin >> WILL >> 0107 Fall, 2009 Description: ... Date Added: 2009-06-24 09:35:57 |
| 487753aa.pdf Path: Wisconsin >> WILL >> 0099 Fall, 2009 Description: ... Date Added: 2009-06-24 09:37:05 |
| 3b9ada14.pdf Path: Wisconsin >> WILL >> 0016 Fall, 2009 Description: ... Date Added: 2009-06-24 09:37:54 |
| 3b9ada79.pdf Path: Wisconsin >> WILL >> 0016 Fall, 2009 Description: ... Date Added: 2009-06-24 09:37:57 |
| 3b9adab2.pdf Path: Wisconsin >> WILL >> 0016 Fall, 2009 Description: ... Date Added: 2009-06-24 09:38:02 |
| 3b9b3a0a.pdf Path: Wisconsin >> WILL >> 0037 Fall, 2009 Description: ... Date Added: 2009-06-24 09:38:47 |
| 126f.pdf Path: Wisconsin >> WILL >> 0056 Fall, 2009 Description: ... Date Added: 2009-06-24 09:41:44 |
| 131e.pdf Path: Wisconsin >> WILL >> 0056 Fall, 2009 Description: ... Date Added: 2009-06-24 09:41:50 |
| 3b9af307.pdf Path: Wisconsin >> WILL >> 0008 Fall, 2009 Description: ... Date Added: 2009-06-24 09:42:30 |
| 3b9b10ef.pdf Path: Wisconsin >> WILL >> 0027 Fall, 2009 Description: ... Date Added: 2009-06-24 09:43:19 |
| 48771b27.pdf Path: Wisconsin >> WILL >> 0084 Fall, 2009 Description: ... Date Added: 2009-06-24 09:44:29 |
| 48771e02.pdf Path: Wisconsin >> WILL >> 0084 Fall, 2009 Description: ... Date Added: 2009-06-24 09:45:17 |
| 48771ed7.pdf Path: Wisconsin >> WILL >> 0084 Fall, 2009 Description: ... Date Added: 2009-06-24 09:45:58 |
| 3b9b5f4e.pdf Path: Wisconsin >> WILL >> 0048 Fall, 2009 Description: ... Date Added: 2009-06-24 09:47:54 |
| 3b9b5f37.pdf Path: Wisconsin >> WILL >> 0048 Fall, 2009 Description: ... Date Added: 2009-06-24 09:48:04 |
| inl00z.txt Path: University of Illinois, Urbana Champaign >> ATMOS >> 20081130 Fall, 2009 Description: UPPER AIR CALCULATIONS AND PLOTTING (Ver 5.48.1-LINUX-X11) Current filename: /mnt/noaaport/nwstg/convert/08113012_upa.wxp Date: 1200Z 30 NOV 08 Searching for KINL. Searching the city database file for: KINL . Date:1200Z 30 NOV 08 Station: KINL... Date Added: 2009-06-24 09:48:18 |
| 2d9e.pdf Path: Wisconsin >> WILL >> 0064 Fall, 2009 Description: ... Date Added: 2009-06-24 09:48:23 |
| 2e97.pdf Path: Wisconsin >> WILL >> 0064 Fall, 2009 Description: ... Date Added: 2009-06-24 09:49:24 |
| 2ec8.pdf Path: Wisconsin >> WILL >> 0064 Fall, 2009 Description: ... Date Added: 2009-06-24 09:49:32 |
| 48773ab9.pdf Path: Wisconsin >> WILL >> 0092 Fall, 2009 Description: ... Date Added: 2009-06-24 09:50:33 |
| 3b9b5a02.pdf Path: Wisconsin >> WILL >> 0047 Fall, 2009 Description: ... Date Added: 2009-06-24 09:51:28 |
| 3b9b5a6a.pdf Path: Wisconsin >> WILL >> 0047 Fall, 2009 Description: ... Date Added: 2009-06-24 09:51:34 |
| 3b9b5b74.pdf Path: Wisconsin >> WILL >> 0047 Fall, 2009 Description: ... Date Added: 2009-06-24 09:52:26 |
| 3b9b5c2d.pdf Path: Wisconsin >> WILL >> 0047 Fall, 2009 Description: ... Date Added: 2009-06-24 09:52:46 |
| 48779ac9.pdf Path: Wisconsin >> WILL >> 0120 Fall, 2009 Description: ... Date Added: 2009-06-24 09:53:33 |
| 48779b4c.pdf Path: Wisconsin >> WILL >> 0120 Fall, 2009 Description: ... Date Added: 2009-06-24 09:53:50 |
| 48779bb3.pdf Path: Wisconsin >> WILL >> 0120 Fall, 2009 Description: ... Date Added: 2009-06-24 09:54:16 |
| 48779bdb.pdf Path: Wisconsin >> WILL >> 0120 Fall, 2009 Description: ... Date Added: 2009-06-24 09:54:22 |
| 487703ce.pdf Path: Wisconsin >> WILL >> 0077 Fall, 2009 Description: ... Date Added: 2009-06-24 09:54:52 |
| 3b9aed05.pdf Path: Wisconsin >> WILL >> 0007 Fall, 2009 Description: ... Date Added: 2009-06-24 09:57:03 |
| 3b9aedf1.pdf Path: Wisconsin >> WILL >> 0007 Fall, 2009 Description: ... Date Added: 2009-06-24 09:57:20 |
| 3b9af0b5.pdf Path: Wisconsin >> WILL >> 0007 Fall, 2009 Description: ... Date Added: 2009-06-24 09:57:37 |
| 15da.pdf Path: Wisconsin >> WILL >> 0057 Fall, 2009 Description: ... Date Added: 2009-06-24 10:00:16 |
| 17dc.pdf Path: Wisconsin >> WILL >> 0057 Fall, 2009 Description: ... Date Added: 2009-06-24 10:00:53 |
| 36dd.pdf Path: Wisconsin >> WILL >> 0067 Fall, 2009 Description: ... Date Added: 2009-06-24 10:03:15 |
| 39dc.pdf Path: Wisconsin >> WILL >> 0067 Fall, 2009 Description: ... Date Added: 2009-06-24 10:04:16 |
| 48771b86.pdf Path: Wisconsin >> WILL >> 0083 Fall, 2009 Description: ... Date Added: 2009-06-24 10:05:59 |
| 3b9adefd.pdf Path: Wisconsin >> WILL >> 0017 Fall, 2009 Description: ... Date Added: 2009-06-24 10:07:07 |
| 3b9adfcd.pdf Path: Wisconsin >> WILL >> 0017 Fall, 2009 Description: ... Date Added: 2009-06-24 10:07:45 |
| 487767b4.pdf Path: Wisconsin >> WILL >> 0105 Fall, 2009 Description: ... Date Added: 2009-06-24 10:11:56 |
| 3b9ae2cc.pdf Path: Wisconsin >> WILL >> 0018 Fall, 2009 Description: ... Date Added: 2009-06-24 10:12:32 |
| 3b9ae39a.pdf Path: Wisconsin >> WILL >> 0018 Fall, 2009 Description: ... Date Added: 2009-06-24 10:13:37 |
| 3b9b660e.pdf Path: Wisconsin >> WILL >> 0050 Fall, 2009 Description: ... Date Added: 2009-06-24 10:16:50 |
| 4877a049.pdf Path: Wisconsin >> WILL >> 0121 Fall, 2009 Description: ... Date Added: 2009-06-24 10:17:34 |
| 4877a083.pdf Path: Wisconsin >> WILL >> 0121 Fall, 2009 Description: ... Date Added: 2009-06-24 10:17:45 |
| 4876f8f4.pdf Path: Wisconsin >> WILL >> 0074 Fall, 2009 Description: ... Date Added: 2009-06-24 10:19:25 |
| 4876f88f.pdf Path: Wisconsin >> WILL >> 0074 Fall, 2009 Description: ... Date Added: 2009-06-24 10:20:07 |
| 3b9ade21.pdf Path: Wisconsin >> WILL >> 0006 Fall, 2009 Description: ... Date Added: 2009-06-24 10:22:11 |
| 3b9aeb40.pdf Path: Wisconsin >> WILL >> 0006 Fall, 2009 Description: ... Date Added: 2009-06-24 10:23:31 |
| 3b9aee42.pdf Path: Wisconsin >> WILL >> 0021 Fall, 2009 Description: ... Date Added: 2009-06-24 10:24:18 |
| 3b9aef28.pdf Path: Wisconsin >> WILL >> 0021 Fall, 2009 Description: ... Date Added: 2009-06-24 10:24:54 |
| 342e.pdf Path: Wisconsin >> WILL >> 0066 Fall, 2009 Description: ... Date Added: 2009-06-24 10:26:19 |
| 343b.pdf Path: Wisconsin >> WILL >> 0066 Fall, 2009 Description: ... Date Added: 2009-06-24 10:26:19 |
| 357d.pdf Path: Wisconsin >> WILL >> 0066 Fall, 2009 Description: ... Date Added: 2009-06-24 10:26:34 |
| 4877163e.pdf Path: Wisconsin >> WILL >> 0082 Fall, 2009 Description: ... Date Added: 2009-06-24 10:27:31 |
| 4877186e.pdf Path: Wisconsin >> WILL >> 0082 Fall, 2009 Description: ... Date Added: 2009-06-24 10:27:58 |
| 487741bb.pdf Path: Wisconsin >> WILL >> 0094 Fall, 2009 Description: ... Date Added: 2009-06-24 10:28:34 |
| 487742e0.pdf Path: Wisconsin >> WILL >> 0094 Fall, 2009 Description: ... Date Added: 2009-06-24 10:29:03 |
| 4877425a.pdf Path: Wisconsin >> WILL >> 0094 Fall, 2009 Description: ... Date Added: 2009-06-24 10:29:40 |
| 3b9b2fa2.pdf Path: Wisconsin >> WILL >> 0035 Fall, 2009 Description: ... Date Added: 2009-06-24 10:31:23 |
| 3b9b1a69.pdf Path: Wisconsin >> WILL >> 0029 Fall, 2009 Description: ... Date Added: 2009-06-24 10:32:59 |
| 3b9b1abd.pdf Path: Wisconsin >> WILL >> 0029 Fall, 2009 Description: ... Date Added: 2009-06-24 10:33:10 |
| 3b9b1c8d.pdf Path: Wisconsin >> WILL >> 0029 Fall, 2009 Description: ... Date Added: 2009-06-24 10:34:19 |
| 4876fc0a.pdf Path: Wisconsin >> WILL >> 0075 Fall, 2009 Description: ... Date Added: 2009-06-24 10:35:20 |
| 4876fc1f.pdf Path: Wisconsin >> WILL >> 0075 Fall, 2009 Description: ... Date Added: 2009-06-24 10:35:25 |
| 48775b78_x1a.pdf Path: Wisconsin >> WILL >> 0102 Fall, 2009 Description: ... Date Added: 2009-06-24 10:36:42 |
| 48775bbd.pdf Path: Wisconsin >> WILL >> 0102 Fall, 2009 Description: ... Date Added: 2009-06-24 10:37:04 |
| 3b9ae5f4.pdf Path: Wisconsin >> WILL >> 0019 Fall, 2009 Description: ... Date Added: 2009-06-24 10:37:53 |
| 3b9ae59a.pdf Path: Wisconsin >> WILL >> 0019 Fall, 2009 Description: ... Date Added: 2009-06-24 10:38:32 |
| 3b9b6a99.pdf Path: Wisconsin >> WILL >> 0051 Fall, 2009 Description: ... Date Added: 2009-06-24 10:41:16 |
| 3b9b6b41.pdf Path: Wisconsin >> WILL >> 0051 Fall, 2009 Description: ... Date Added: 2009-06-24 10:42:04 |
| 3b9b6bd4.pdf Path: Wisconsin >> WILL >> 0051 Fall, 2009 Description: ... Date Added: 2009-06-24 10:42:25 |
| 3b9b6be9.pdf Path: Wisconsin >> WILL >> 0051 Fall, 2009 Description: ... Date Added: 2009-06-24 10:42:27 |
| 3b9b6bed.pdf Path: Wisconsin >> WILL >> 0051 Fall, 2009 Description: ... Date Added: 2009-06-24 10:42:27 |
| 243f.pdf Path: Wisconsin >> WILL >> 0061 Fall, 2009 Description: ... Date Added: 2009-06-24 10:43:42 |
| 2373.pdf Path: Wisconsin >> WILL >> 0061 Fall, 2009 Description: ... Date Added: 2009-06-24 10:44:12 |
| 3b9adac2.pdf Path: Wisconsin >> WILL >> 0005 Fall, 2009 Description: ... Date Added: 2009-06-24 10:46:37 |
| syllabus.pdf Path: UMiami >> MATH >> 220 Fall, 2009 Description: Blank Page Math 220/317: Programming II/Data Structures Prof. Burt Rosenberg Ungar 523, x2575 Office hours: TBA. 1 MTH 220/317S (Fall, 1995) Time: Tu., Th. 3:054:20 P.M. Room: MM 306 Goals: This course will develop expertise with C programming in... Date Added: 2009-06-24 10:46:59 |
| 3b9ae86b.pdf Path: Wisconsin >> WILL >> 0020 Fall, 2009 Description: ... Date Added: 2009-06-24 10:48:16 |
| 3b9ae816.pdf Path: Wisconsin >> WILL >> 0020 Fall, 2009 Description: ... Date Added: 2009-06-24 10:48:29 |
| 3b9ae856.pdf Path: Wisconsin >> WILL >> 0020 Fall, 2009 Description: ... Date Added: 2009-06-24 10:48:36 |
| 3b9ae888.pdf Path: Wisconsin >> WILL >> 0020 Fall, 2009 Description: ... Date Added: 2009-06-24 10:48:43 |
| 3b9b262d.pdf Path: Wisconsin >> WILL >> 0032 Fall, 2009 Description: ... Date Added: 2009-06-24 10:50:07 |
| 3b9b269f.pdf Path: Wisconsin >> WILL >> 0032 Fall, 2009 Description: ... Date Added: 2009-06-24 10:50:16 |
| 3b9b52d7.pdf Path: Wisconsin >> WILL >> 0045 Fall, 2009 Description: ... Date Added: 2009-06-24 10:50:51 |
| 3b9b543c.pdf Path: Wisconsin >> WILL >> 0045 Fall, 2009 Description: ... Date Added: 2009-06-24 10:51:56 |
| 4877456e.pdf Path: Wisconsin >> WILL >> 0095 Fall, 2009 Description: ... Date Added: 2009-06-24 10:54:28 |
| 3b9aff4c.pdf Path: Wisconsin >> WILL >> 0011 Fall, 2009 Description: ... Date Added: 2009-06-24 10:55:18 |
| 3b9aff76.pdf Path: Wisconsin >> WILL >> 0011 Fall, 2009 Description: ... Date Added: 2009-06-24 10:55:28 |
| 3b9aff81.pdf Path: Wisconsin >> WILL >> 0011 Fall, 2009 Description: ... Date Added: 2009-06-24 10:55:29 |
| 3b9b00b5.pdf Path: Wisconsin >> WILL >> 0011 Fall, 2009 Description: ... Date Added: 2009-06-24 10:55:39 |
| bj3ch19_solutions.doc Path: FIU >> COP >> 2210 Fall, 2008 Description: Chapter 19 Review Exercise Solutions R19.1 Streams access sequences of bytes. Readers and writers access sequences of characters. R19.2 You need to open a RandomAccessFile to open a file for both reading and writing. For example, RandomAccessFile f ... Date Added: 2009-06-24 10:56:49 |
| 487715b1.pdf Path: Wisconsin >> WILL >> 0081 Fall, 2009 Description: ... Date Added: 2009-06-24 10:57:45 |
| 3b9b15ef.pdf Path: Wisconsin >> WILL >> 0028 Fall, 2009 Description: ... Date Added: 2009-06-24 10:58:47 |
| 3b9b170b.pdf Path: Wisconsin >> WILL >> 0028 Fall, 2009 Description: ... Date Added: 2009-06-24 10:59:41 |
| 48772f1e.pdf Path: Wisconsin >> WILL >> 0089 Fall, 2009 Description: ... Date Added: 2009-06-24 11:00:09 |
| 48772fd7.pdf Path: Wisconsin >> WILL >> 0089 Fall, 2009 Description: ... Date Added: 2009-06-24 11:00:50 |
| 48772fef.pdf Path: Wisconsin >> WILL >> 0089 Fall, 2009 Description: ... Date Added: 2009-06-24 11:00:55 |
| 487730f5.pdf Path: Wisconsin >> WILL >> 0089 Fall, 2009 Description: ... Date Added: 2009-06-24 11:01:13 |
| 4876f0f1.pdf Path: Wisconsin >> WILL >> 0072 Fall, 2009 Description: ... Date Added: 2009-06-24 11:02:24 |
| 48775ebb.pdf Path: Wisconsin >> WILL >> 0103 Fall, 2009 Description: ... Date Added: 2009-06-24 11:03:30 |
| 48775f0a_x1a.pdf Path: Wisconsin >> WILL >> 0103 Fall, 2009 Description: ... Date Added: 2009-06-24 11:03:57 |
| 3a57.pdf Path: Wisconsin >> WILL >> 0068 Fall, 2009 Description: ... Date Added: 2009-06-24 11:04:26 |
| 3a84.pdf Path: Wisconsin >> WILL >> 0068 Fall, 2009 Description: ... Date Added: 2009-06-24 11:04:31 |
| 3aa6.pdf Path: Wisconsin >> WILL >> 0068 Fall, 2009 Description: ... Date Added: 2009-06-24 11:04:36 |
| 487783d1.pdf Path: Wisconsin >> WILL >> 0113 Fall, 2009 Description: ... Date Added: 2009-06-24 11:10:27 |
| 4877829d.pdf Path: Wisconsin >> WILL >> 0113 Fall, 2009 Description: ... Date Added: 2009-06-24 11:11:06 |
| 3b9b28c9.pdf Path: Wisconsin >> WILL >> 0033 Fall, 2009 Description: ... Date Added: 2009-06-24 11:13:25 |
| 3b9b4f59.pdf Path: Wisconsin >> WILL >> 0044 Fall, 2009 Description: ... Date Added: 2009-06-24 11:13:48 |
| 3b9b50e0.pdf Path: Wisconsin >> WILL >> 0044 Fall, 2009 Description: ... Date Added: 2009-06-24 11:14:30 |
| 3b9b509c.pdf Path: Wisconsin >> WILL >> 0044 Fall, 2009 Description: ... Date Added: 2009-06-24 11:15:03 |
| 3b9b01d9.pdf Path: Wisconsin >> WILL >> 0012 Fall, 2009 Description: ... Date Added: 2009-06-24 11:15:20 |
| 3b9b0262.pdf Path: Wisconsin >> WILL >> 0012 Fall, 2009 Description: ... Date Added: 2009-06-24 11:15:53 |
| 3b9b039f.pdf Path: Wisconsin >> WILL >> 0012 Fall, 2009 Description: ... Date Added: 2009-06-24 11:16:19 |
| 48777ad7.pdf Path: Wisconsin >> WILL >> 0110 Fall, 2009 Description: ... Date Added: 2009-06-24 11:17:22 |
| 487778be.pdf Path: Wisconsin >> WILL >> 0110 Fall, 2009 Description: ... Date Added: 2009-06-24 11:17:50 |
| 487778cc.pdf Path: Wisconsin >> WILL >> 0110 Fall, 2009 Description: ... Date Added: 2009-06-24 11:17:53 |
| 3b9ad6ef.pdf Path: Wisconsin >> WILL >> 0004 Fall, 2009 Description: ... Date Added: 2009-06-24 11:18:45 |
| 3b9ad737.pdf Path: Wisconsin >> WILL >> 0004 Fall, 2009 Description: ... Date Added: 2009-06-24 11:19:49 |
| 3b9ad746.pdf Path: Wisconsin >> WILL >> 0004 Fall, 2009 Description: ... Date Added: 2009-06-24 11:19:52 |
| 3b9af96c.pdf Path: Wisconsin >> WILL >> 0023 Fall, 2009 Description: ... Date Added: 2009-06-24 11:21:02 |
| 48774a22.pdf Path: Wisconsin >> WILL >> 0096 Fall, 2009 Description: ... Date Added: 2009-06-24 11:21:48 |
| 48774a26.pdf Path: Wisconsin >> WILL >> 0096 Fall, 2009 Description: ... Date Added: 2009-06-24 11:21:48 |
| 613syl.pdf Path: Oregon >> SOC >> 613 Fall, 2008 Description: Sociology 613 Winter 2008 Prof. Val Burris 730 PLC 346-5001 vburris@uoregon.edu Social Network Analysis Below is a preliminary list of the required readings for each week. With the exception of Week 2, these readings deal with methods or concepts, ... Date Added: 2009-06-24 11:21:51 |
| 48774ad4.pdf Path: Wisconsin >> WILL >> 0096 Fall, 2009 Description: ... Date Added: 2009-06-24 11:22:12 |
| 48774b0b.pdf Path: Wisconsin >> WILL >> 0096 Fall, 2009 Description: ... Date Added: 2009-06-24 11:22:20 |
| 48770e9e.pdf Path: Wisconsin >> WILL >> 0080 Fall, 2009 Description: ... Date Added: 2009-06-24 11:23:12 |
| 48770fa3.pdf Path: Wisconsin >> WILL >> 0080 Fall, 2009 Description: ... Date Added: 2009-06-24 11:24:04 |
| 6f8.pdf Path: Wisconsin >> WILL >> 0053 Fall, 2009 Description: ... Date Added: 2009-06-24 11:25:28 |
| 48772b07.pdf Path: Wisconsin >> WILL >> 0088 Fall, 2009 Description: ... Date Added: 2009-06-24 11:26:41 |
| HW_2.pdf Path: SUNY Stony Brook >> PHY >> 114 Spring, 2008 Description: Phy114: Electromagnetism, Waves and Radiation for the Sports Science Homework Problems Set #2: Due Wednesday, February 11, 2009 Note: Students are encouraged to work together and discuss the problems. However, each student must arrive at her/his own ... Date Added: 2009-06-24 11:27:44 |
| 48772c31.pdf Path: Wisconsin >> WILL >> 0088 Fall, 2009 Description: ... Date Added: 2009-06-24 11:27:48 |
| 4876f6d7.pdf Path: Wisconsin >> WILL >> 0073 Fall, 2009 Description: ... Date Added: 2009-06-24 11:29:25 |
| 3b9b4b6e.pdf Path: Wisconsin >> WILL >> 0043 Fall, 2009 Description: ... Date Added: 2009-06-24 11:29:58 |
| 3b9b4b99.pdf Path: Wisconsin >> WILL >> 0043 Fall, 2009 Description: ... Date Added: 2009-06-24 11:30:11 |
| 3b9b4c96.pdf Path: Wisconsin >> WILL >> 0043 Fall, 2009 Description: ... Date Added: 2009-06-24 11:31:05 |
| 2ad9.pdf Path: Wisconsin >> WILL >> 0063 Fall, 2009 Description: ... Date Added: 2009-06-24 11:32:01 |
| 487755fb.pdf Path: Wisconsin >> WILL >> 0100 Fall, 2009 Description: ... Date Added: 2009-06-24 11:33:27 |
| 487757b8.pdf Path: Wisconsin >> WILL >> 0100 Fall, 2009 Description: ... Date Added: 2009-06-24 11:33:49 |
| 3b9b1d36.pdf Path: Wisconsin >> WILL >> 0030 Fall, 2009 Description: ... Date Added: 2009-06-24 11:34:04 |
| 3b9b1fd7.pdf Path: Wisconsin >> WILL >> 0030 Fall, 2009 Description: ... Date Added: 2009-06-24 11:35:20 |
| 48774b97.pdf Path: Wisconsin >> WILL >> 0097 Fall, 2009 Description: ... Date Added: 2009-06-24 11:35:52 |
| 3b9b0aa0.pdf Path: Wisconsin >> WILL >> 0013 Fall, 2009 Description: ... Date Added: 2009-06-24 11:38:21 |
| 3b9b3bc6.pdf Path: Wisconsin >> WILL >> 0038 Fall, 2009 Description: ... Date Added: 2009-06-24 11:40:30 |
| 487729fb.pdf Path: Wisconsin >> WILL >> 0087 Fall, 2009 Description: ... Date Added: 2009-06-24 11:42:55 |
| 48777f36.pdf Path: Wisconsin >> WILL >> 0112 Fall, 2009 Description: ... Date Added: 2009-06-24 11:44:07 |
| 48777f38.pdf Path: Wisconsin >> WILL >> 0112 Fall, 2009 Description: ... Date Added: 2009-06-24 11:44:07 |
| 3b9ad0e3.pdf Path: Wisconsin >> WILL >> 0003 Fall, 2009 Description: ... Date Added: 2009-06-24 11:44:33 |
| 3b9ad40e.pdf Path: Wisconsin >> WILL >> 0003 Fall, 2009 Description: ... Date Added: 2009-06-24 11:46:09 |
| 3b9ad114.pdf Path: Wisconsin >> WILL >> 0003 Fall, 2009 Description: ... Date Added: 2009-06-24 11:46:21 |
| 3b9af3ff.pdf Path: Wisconsin >> WILL >> 0022 Fall, 2009 Description: ... Date Added: 2009-06-24 11:46:45 |
| car2002ch8.pdf Path: Columbia >> RW >> 187 Fall, 2009 Description: Chapter 8 Research and Systematic Observation he United States leads the world in research on climate and other global environmental changes, spending approximately $1.7 billion annually on its focused climate change research programs. This contribu... Date Added: 2009-06-24 11:46:52 |
| 95f.pdf Path: Wisconsin >> WILL >> 0054 Fall, 2009 Description: ... Date Added: 2009-06-24 11:48:24 |
| YHL027W.t2k.str2-logo.pdf Path: UCSC >> YHL >> 027 Fall, 2009 Description: YHL027W.t2k STR2 3 2 1 C Y C Y CH T T Z SHSTSS ZSSC S Q S C CSH S S ZSSC H S T A B S T T Z S S H B T T G S H H H H T H H SZXB C H G T G H S G G C XZXBXHGXHSHXTXXXXXXXTTHXXTBS X X X X X X X X X X X X X X X X X X X X XXXXXX 1 10 20 30 40 T 3 2 ... Date Added: 2009-06-24 11:52:05 |
| angualar_momentum_inclass_prblm-1-PHY141F05.pdf Path: Mercer >> PHY >> 141 Spring, 2006 Description: Angular Momentum A Dung Beetle of mass 5.0 g sits on a bar of mass 260 g and length of 42 cm. The bug initially sits at a point halfway between the center and the edge of the bar. The bug then crawls to the edge of the bar. The bar is rotating ... Date Added: 2009-06-24 11:53:18 |
| hw3soln.pdf Path: Bethel VA >> MATH >> 442 Fall, 2009 Description: Math 442/542 Winter 2009 Homework 3 Solution 1. For the Revised Simplex we first need to fix some representation of the problem (with equality constraints!) which we will use to get the data (A, b and c) in each step. max -2x1 s.t. 5x1 3x1 -x2 +2x2 ... Date Added: 2009-06-24 11:53:48 |
| intrev.pdf Path: SWCCD >> MATH >> 251 Fall, 2009 Description: ... Date Added: 2009-06-24 11:54:06 |
| Court observation.doc Path: Uni. Westminster >> AAJ >> 1209 Fall, 2009 Description: Andrew Johnson Sharon Weeks Holman (P) v. Dustin W. Holman (D) Utah State 3rd District Court Judge John Paul Kennedy Bench Trial Case #: 044901159 Parties: Sharon Weeks Holman (P) and Dustin W. Holman (D) Facts: On August 9, 2005 Dustin Holman and Sh... Date Added: 2009-06-24 11:55:31 |
| YMR173W-A.t2k.alpha-logo.pdf Path: UCSC >> YMR >> 173 Fall, 2009 Description: YMR173W-A.t2k ALPHA 2 1 C AAAE A E XXXXXXXXXXBBBX X X X EE E A B B B A E E E E B EEE H E E H H H H H X X X X X HHHXIIXXIIXXHHH I I X X X X X X X X I HHHHHHHHH I I I H H X X C E XX S B H H X H H H H H X X X X X X H B E H H H H X ... Date Added: 2009-06-24 11:57:53 |
| YMR105C.t2k.CB_burial_14_7-logo.pdf Path: UCSC >> YMR >> 105 Fall, 2009 Description: YMR105C.t2k CB_BURIAL_14_7 4 3 2 1 AA X 1 10 20 30 40 A 4 3 2 1 D E F G F D E B A D E B B E F D E G E F G F D E B BABADE ABA X X X C CDCCEDE CF D B C D X X X X 51 60 70 80 90 A B 4 3 2 1 D E F G F E F D E F D F G F E F D ... Date Added: 2009-06-24 11:59:09 |
| YMR108W.t2k.dssp-ebghstl-logo.pdf Path: UCSC >> YMR >> 108 Fall, 2009 Description: YMR108W.t2k EBGHSTL 3 2 1 CC X CCCE S T S S C E E S GGHC E E C E C E G S S B X XXXEXXXXCX X X X X X X C CCC EE TT HH X X H C E C SS ESSE CS C E E HHHHCHHHTTCEEESEBTTETTEECESTESES S SS G S S T E E E S T S H XXXXXXX G TCC H X T C X S S T ... Date Added: 2009-06-24 11:59:44 |
| ECE1000Sp05_HW5solnp3.pdf Path: Utah >> ECE >> 1000 Fall, 2008 Description: ... Date Added: 2009-06-24 12:03:14 |
| 635_413 Class 11 Sum 07.ppt Path: Johns Hopkins >> IST >> 413 Fall, 2009 Description: Introduction to Multimedia and Real-time Applications on the Internet 635.413.31 Summer 2007 The Internet: Technology and Applications: Class #11 1 Introduction Why are we talking about Real-Time & MM Applications? These applications are a huge ... Date Added: 2009-06-24 12:07:43 |
| Assignment03.pdf Path: USC >> M >> 218 Spring, 2009 Description: Math 218 Homework #3 Suppose that for the first midterm I gave a test that consisted of 10 true-false questions, and that I used a grading scale where 60% is a D, 70% a C, 80% a B, and 90% and above an A. Also assume that due to an unfortunate harm... Date Added: 2009-06-24 12:08:21 |
| week13.pdf Path: Sveriges lantbruksuniversitet >> MATH >> 154 Fall, 2009 Description: ... Date Added: 2009-06-24 12:10:25 |
| homework7.pdf Path: ASU >> STAT >> 473 Fall, 2009 Description: D G|SS5\"i 4@ u s x q @ { ` c ` c X @ u s qx uq8 t q AAw8pGH8labubaAw885HGkabu` q 1p Aw8EHc5HchHyi4 q HGkt @ u 8 @ @q @ 8 x w 8x uq8 8 u y u q p u q 8 ` 8 @ u q c u @ q @ t sD x y x X 8 t x s x q 8 { q t H`@H`vzdc q gw8AGzdHuw@... Date Added: 2009-06-24 12:22:40 |
| section13.pdf Path: ASU >> STAT >> 371 Fall, 2009 Description: 13. Continuity Exercise 13.1. In each part, give an example of a function f : R R with the indicated property: (a) f is discontinuous everywhere; (b) f is continuous at only one point. Exercise 13.2. Dene a sequence (xn ) inductively by 2 if n = 1 ... Date Added: 2009-06-24 12:23:00 |
| Quiz 5_correction.doc Path: Tennessee >> STAT >> 201 Fall, 2009 Description: Stat 201: Quiz 5 October 28th 2002/ Correction A. We suppose that x is a random variable selected from a sample which has a normal distribution with mean =10 and standard deviation =1 1. Write the formula for the probability curve of x Answer: Opt... Date Added: 2009-06-24 12:24:05 |
| Test3_practice.pdf Path: Tennessee >> STAT >> 201 Fall, 2009 Description: TotalIncome 12854 46361 34921 16198 62964 33567 4349 18382 23438 30104 31198 58533 21596 29015 368 54033 65627 17424 19948 13359 35247 11540 19669 24804 27484 26992 24731 24150 29360 34815 40755 58657 39440 51313 26110 3243 25742 44286 1283 32964 392... Date Added: 2009-06-24 12:24:06 |
| Test1_correction.pdf Path: Tennessee >> STAT >> 201 Fall, 2009 Description: Name:- 14 points 5. The table below shows how the outcomes of plans built by Phoenix (a system that fights simulated forest fires) are dependent on windspeed and RTK (the ratio of \"thinking time\" for the planner to \"burning time\" for the fire in the... Date Added: 2009-06-24 12:24:17 |
| Eco212_syllabus.pdf Path: UMiami >> ECO >> 212 Spring, 2008 Description: Prof. Christopher Cotton Spring 2009 Eco 212 Introductory Macroeconomics Prof. Christopher Cotton Office: 523F Jenkins Email: cotton<at>miami.edu (email is the best way to get a hold of me. If you want to leave me a voice message, you may c... Date Added: 2009-06-24 12:42:09 |
| immune.pdf Path: George Mason >> BIO >> 104 Fall, 2009 Description: Immune system. One of the more complex systems we\'re looking at. An immune response (a response to a pathogen) can be of two types: (pathogen - disease causing organism) 1) Non specific. Anything foreign is attacked. 2) Specific. The immune system at... Date Added: 2009-06-24 12:42:35 |
| bone.pdf Path: Great Lakes >> BIO >> 228 Fall, 2009 Description: LAB: BONES, JOINTS AND COMMON MIEDICAL APPLICATIONS I. LIVE BONE AND HISTOLOGY ID Split Bone: Diaphysis, epiphysis, medullary cavity, cancellous (spongy) bone, trabeculae, compact bone, ephyphiseal line/plate and periosteum (Fig 7.2, 7.3, 7.4 and 7.5... Date Added: 2009-06-24 12:45:39 |
| Homework_01a.doc Path: UGA >> CS >> 6730 Fall, 2002 Description: Maciej Janik Homework 1 Operating System paper summary Title: The structure of the THE-Multiprogramming System Authors: Edsger W. Dijkstra 1. What is the problem that the authors are trying to solve? They were going to build an operating system that... Date Added: 2009-06-24 13:03:15 |
| intr03w.doc Path: ECCD >> STAT >> 5504 Fall, 2009 Description: STOCHASTIC PROCESS AND TIME SERIES ANALYSIS (STAT 5504) Instructor: Chul Gyu Park 4215 Herzberg Lab. Phone: 520-2600 (ext. 1911). Email: cgpark@math.carleton.ca. http:/www.math.carleton.ca/~cgpark Office Hour: 9:00 10:30 (Mon) and 9:00 10:30 (Thu) ... Date Added: 2009-06-24 13:04:04 |
| midterm.pdf Path: Washington >> AMATH >> 351 Fall, 2008 Description: Exam I AMATH351 Spring 2003 Bernard Deconinck 1. (20 points) For the following equations, write down the form of the particular solution, using the method of undetermined coecients. You do not have to nd the value of the coecients. a) y y = ex (2x2 ... Date Added: 2009-06-24 13:04:53 |
| worksheet09.pdf Path: Glendale Community College >> BIO >> 202 Fall, 2008 Description: E X E R C I S E 9 Renal System Physiology O B J E C T I V E S 1. To define the following terms: glomerulus, glomerular capsule, renal corpuscle, renal tubule, nephron, proximal convoluted tubule, loop of Henle, and distal convoluted tubule. ... Date Added: 2009-06-24 13:05:41 |
| chem329_fall2003_ps5_key_complete.pdf Path: Wisconsin >> CHEM >> 329 Fall, 2008 Description: ... Date Added: 2009-06-24 13:05:48 |
| Bonus_Quiz_5.pdf Path: Harford CC >> BIO >> 204 Fall, 2009 Description: Name: BIO 204 Bonus Quiz #5 1. Mechanical digestion occurs in the? a. small intestine b. mouth c. esophagus d. large intestine e. both a & b 2. List 2 functions of the lining of the digestive tract: 1. 2. 3. The layer of the GI tract that is resp... Date Added: 2009-06-24 13:07:55 |
| Quiz10B.pdf Path: Harford CC >> BIO >> 204 Fall, 2009 Description: Name: BIO 104 Quiz #10 1. T or F Internal respiration involves the exchange of gasses between tissue cells and systemic capillaries. Epinephrine will constrict bronchioles. 2. 3. T or F Which of the following supplies arterial blood to the lungs f... Date Added: 2009-06-24 13:07:59 |
| YJR102C.t2k.w0.5-logo.pdf Path: UCSC >> YJR >> 102 Fall, 2009 Description: YJR102C.t2k w0.5 5 4 3 2 1 F S A L L A I S V W F S X XXX K P X Y FPPFFT F Y H L W V XX XXXXXXXXXX V V I LS Y A A S V E W E I A I K Y Q LLS Q E K R D A S N P L S X XXX L E T X S A XXXXXXXX A S E R K A A Q E K R D L I W F Y L S ... Date Added: 2009-06-24 13:08:47 |
| Projects152_F08.pdf Path: Central Mich. >> MARCI >> 152 Fall, 2009 Description: Project (9pts) Choose one of the following projects. The deadline for submission is December 2nd. Early or electronic submissions are encouraged, you\'ll get immediate feedback if you send it electronically. All projects must be word processed (unless... Date Added: 2009-06-24 13:09:02 |
| 04.Protists.pdf Path: Cuyamaca College >> BIO >> 210 Fall, 2008 Description: Bio 210: Lecture 4, Protists Th 06 Feb 03 1 News Bio 210 website: http:/members.cox.net/bio210/ http:/members.cox.net/bio210/ Lecture notes, handouts, schedule, etc. etc. Exam 1 next Tu 11 Feb Diversity Archae... Date Added: 2009-06-24 13:11:04 |
| modelsim_sci.ps Path: Mississippi State >> EE >> 4713 Fall, 2009 Description: #%-12345X@PJL JOB @PJL ENTER LANGUAGE=POSTSCRIPT %!PS-Adobe-3.0 %Title: Microsoft PowerPoint - modelsim_sci.htm %Creator: Windows NT 4.0 %CreationDate: 12:43 2/14/2001 %Pages: (atend) %BoundingBox: 11 13 601 780 %LanguageLevel: 2 %DocumentNeededFonts... Date Added: 2009-06-24 13:14:10 |
| spim_exam.ps Path: Mississippi State >> EE >> 4713 Fall, 2009 Description: #%-12345X@PJL JOB @PJL ENTER LANGUAGE=POSTSCRIPT %!PS-Adobe-3.0 %Title: Microsoft PowerPoint - spim_exam.htm %Creator: Windows NT 4.0 %CreationDate: 8:30 1/25/2001 %Pages: (atend) %BoundingBox: 11 13 601 780 %LanguageLevel: 2 %DocumentNeededFonts: (a... Date Added: 2009-06-24 13:14:12 |
| YNL071W.t2k.str2-logo.pdf Path: UCSC >> YNL >> 071 Fall, 2009 Description: YNL071W.t2k STR2 5 4 3 2 1 C Z CCC A S C S Z C S Z Y S S S T Z A Q T A Y S T Q T T S M T H T S M M M Z Z S P P S S QCQ XXXXXXXXXXXXXXXXXX Z CCCZAAYAZ YZAZ ZQ CCYCYACCCC C Y C XX C H C H H X X X X H X A C S E Q S XXXXXTTTSXX XZZTXTCCZZXXX ... Date Added: 2009-06-24 13:16:30 |
| intro.pdf Path: Ohio State >> STAT >> 833 Fall, 2008 Description: Statistics 833 - Autumn 2007 Stat 833 Introduction and Overview Note: Some of the slides to be used throughout the quarter are courtesy of Dr. E.A. Thompson. 1 Statistics 833 - Autumn 2007 Topics 2 Statistics 833 - Autumn 2007 Statistical Gene... Date Added: 2009-06-24 13:17:59 |
| fig7_7b.ps Path: Rose-Hulman >> DAY >> 461 Fall, 2009 Description: %! %BoundingBox: 2 0 205 206 gsave /inch { 72 mul } def /invinch { 72 div } def /imline 512 string def /drawimage { 256 256 8 [256 0 0 -256 0 256] { currentfile imline readhexstring pop } image } def 0.030000 inch 0.000000 inch translate 2.820467 inc... Date Added: 2009-06-24 13:19:54 |
| YKL067W.t2k.CB_burial_14_7-logo.pdf Path: UCSC >> YKL >> 067 Fall, 2009 Description: YKL067W.t2k CB_BURIAL_14_7 2 1 AAAA C X B BBBBAAX X C C C D D D C D E X X X X B B D D D A C D D B E F D F D F E C C F B A C F C C E D F D E C C G E E E E G C D E B C F D D CADDBEEDEDCCDCDDCBCX A D E A E E D D D D D X X X X X X X XXDDB X X X X X X ... Date Added: 2009-06-24 13:26:09 |
| solutionHead.txt Path: Allan Hancock College >> MATHS >> 2030 Fall, 2009 Description: \\documentclass[12pt,a4]{article} \\usepackage{graphicx} \ ewcommand{\\pic}[2]{ \\bigskip\\centerline{\\includegraphics[width=#1 cm]{#2} \ ewcommand{\ pic}[2]{ \\bigskip\ ightline{\\includegraphics[width=#1 cm]{#2} \\input twmaLa.tex \\setlength{\\textwidth}{... Date Added: 2009-06-24 13:29:18 |
| grid-t3.txt Path: Old Dominion >> CS >> 895 Fall, 2008 Description: > winner=gp.evolve(5,100,gp.tournament,maxgen=100) 28 30 44 86 96 78 106 112 112 94 94 76 76 86 76 98 80 80 84 86 68 80 76 80 76 88 84 80 84 80 86 70 74 78 86 70 70 84 78 68 84 76 66 80 84 84 70 92 84 90 78 84 82 70 82 82 86 84 64 82 76 64 72 74 86 6... Date Added: 2009-06-24 13:30:58 |
| hw5.ps Path: UCSD >> ECE >> 161 Fall, 2008 Description: %!PS-Adobe-2.0 %Creator: dvips(k) 5.94a Copyright 2003 Radical Eye Software %Title: hw5.dvi %CreationDate: Thu May 03 15:08:38 2007 %Pages: 2 %PageOrder: Ascend %BoundingBox: 0 0 612 792 %DocumentFonts: CMBX10 CMR10 CMMI10 CMR7 CMMI7 CMR5 CMSY10 CMSY... Date Added: 2009-06-24 13:38:39 |
| Robotics_and_Intelligent_Systems_in_Support_of_Society.pdf Path: Vanderbilt >> HON >> 182 Fall, 2009 Description: T h e F u t u r e o f A I Robotics and Intelligent Systems in Support of Society Raj Reddy, Carnegie Mellon University O Several applications of robotics and intelligent systems could profoundly impact the well being of our society, transforming... Date Added: 2009-06-24 13:41:37 |
| types of galaxies.ppt Path: El Paso CC >> PHYSICS >> 123 Fall, 2009 Description: Galaxy Types Hubble Tuning Fork Elliptical Elliptical On the left of the diagram are the Elliptical galaxies Elliptical galaxies contain very little gas and dust, and the gas that is present is very hot and diffuse. Consequently, there is no cu... Date Added: 2009-06-24 13:43:55 |
| c1.ps Path: UCSC >> ENGR >> 007 Winter, 2009 Description: %!PS-Adobe-2.0 %Creator: dvips(k) 5.86 Copyright 1999 Radical Eye Software %Title: class1.prosper.dvi %Pages: 18 %PageOrder: Ascend %BoundingBox: 0 0 596 842 %DocumentFonts: Helvetica-BoldOblique Helvetica Helvetica-Oblique %+ Helvetica-Bold %EndComm... Date Added: 2009-06-24 13:45:28 |
| CHM130FinalExamPractice.pdf Path: Glendale Community College >> CHM >> 130 Fall, 2008 Description: CHM 130: Final Exam Practice Problems 1. Complete the following table: Isotope strontium-90 neon-19 iron-55 2. Consider Figures A-F below: A B C Mass number # of protons # of neutrons # of electrons D E F Indicate the figure represented as an... Date Added: 2009-06-24 13:46:48 |
| lab1_notes_install.pdf Path: Lake County >> ECE >> 435 Fall, 2009 Description: Spring 2008 B. Wah ECE 435 Lab 1: Installation and Configuration of Fedora Core 8 B. W. Wah Department of ECE, UIUC 01/15/2008 Course Organization Course material Books: textbook, classic reference books Lab assignment Slides and extra impl... Date Added: 2009-06-24 13:51:45 |
| Road Map final!.ppt Path: Texas >> E >> 603 Fall, 2008 Description: R oadMap BeccaL.Ticker Nature in of G etting Acquainte dwith Nature At the smallest age, I spent the majority of my time in the outdoors. Even my regular sucking-thumb activity was performed outside. I am not quite sure when I first became closely... Date Added: 2009-06-24 14:01:34 |
| MKM801Assignment_winter_2003.doc Path: CSU Fullerton >> MKM >> 806 Fall, 2009 Description: MKM801 Assignment Winter 031 Action Research MKM 801 Winter 2003 Assignments Calculation of the Final Mark As the semester proceeds, you will be asked to complete multiple learning tasks. The following graded assignments form the basis of your fina... Date Added: 2009-06-24 14:01:39 |
| intravfinale.doc Path: Neumont >> A >> 1166 Fall, 2009 Description: IFT1166 - Session Automne, Intra Mohamed Lokbani IFT1166 - INTRA Nom:_| Signature:_| Prnom(s):_| Code perm:_| Date:20 Octobre 1999 Dure: 2 heures (de 18h30: 20h:30) Local: 1360 Directives: Il vous est permis d\'utiliser un livre de votre choix. L... Date Added: 2009-06-24 14:04:12 |
| Syllabus202.rtf Path: Coppin >> MATH >> 202 Fall, 2009 Description: D. S. Smith MATH 202: Calculus II COPPIN STATE UNIVERSITY Department of Mathematics and Computer Science 2500 W. North Avenue Baltimore, Maryland 21216-3698 Page 1 MATH 202 COURSE SYLLABUS for CALCULUS II CATALOG DESCRIPTION 4 CREDITS Different... Date Added: 2009-06-24 14:05:43 |
| YGL252C.t2k.w0.5-logo.pdf Path: UCSC >> YGL >> 252 Fall, 2009 Description: YGL252C.t2k w0.5 5 4 3 2 1 E L X 1 10 20 30 40 T 5 4 3 2 1 E S E T S E XXX T 51 60 70 80 90 H 5 4 3 2 1 T T S H T S G H E VGS T K G L I V I SG XXXXXXXXXXX XXXXIXXXLXXXXXXXXXXVXXXX X L R A L I V I L I AT A R A N F S A S ... Date Added: 2009-06-24 14:07:28 |
| LCP_DCP_F08a_T14_V3.2.pdf Path: USC >> CSCI >> 577 Fall, 2009 Description: Life Cycle Plan (LCP) The Virtual Assistant Living and Education Program Team #14 Swetha Suryanarayanan Kartik Sethi Bharat Mehndiratta Nikita Valechha Project Manager / Feasibility Analyst Plan and Control Engineer / Prototyper Prototyper / Requi... Date Added: 2009-06-24 14:09:38 |
| retouch.pdf Path: Austin CC >> ART >> 131 Fall, 2009 Description: ADOBE PHOTOSHOP 4.0 FUNDAMENTALS Retouching In this lesson, youll retouch a scanned photograph, making typical corrections needed for a digitized image. Adobe Photoshop contains retouching tools that let you burn, dodge, saturate, and even clone are... Date Added: 2009-06-24 14:09:50 |
| T0347.t06.near-backbone-11-logo.pdf Path: UCSC >> T >> 0347 Fall, 2009 Description: T0347.t06 near-backbone-11 3 2 1 AAA B BD B D D BBBDI D D A D E E C C E C XXXXXXXE E A AAB A J E K F H B C C K H G B H H G A G E K G E G E G F X X X X X X X X X X X D J DIDKDDK B BJABJ A E X CJCIBAID H E X I I J H D E G X XXXXX G I G G ... Date Added: 2009-06-24 14:13:15 |
| ww69.doc Path: Clemson >> ECE >> 496 Fall, 2009 Description: Abstract: So far in the project we have discussed possibilities, came up with a plan for the semester, visited vendors, and ordered parts. Summary: The first two weeks we discussed different possibilities for building the gyrobot, funding the project... Date Added: 2009-06-24 14:14:08 |
| ECE210Lecture46.pdf Path: Lake County >> ECE >> 210 Fall, 2009 Description: ECE 210/211 Lecture 46 Tue., April 20, 2009 Reading Assignment for Wednesday, April 22: Review for Exam and Study Chapters 7 10. Homework Assignment: HW12: Chapter 9, nos. 14, 15, 16; Chapter 10, nos. 2, 4, 8, 9, 11 (due today). Exam 3: Covers Chap... Date Added: 2009-06-24 14:16:50 |
| ReviewTestTechniques.pdf Path: Delta MI >> MTH >> 162 Fall, 2009 Description: MTH 162 Review for Test 1 - Integration Techniques & Improper Integrals This test was given before the CAS calculator was required. Numerical integration was not included on this test. 1. Describe the technique you would use to integrate each of th... Date Added: 2009-06-24 14:25:30 |
| ReviewTest1Ans.pdf Path: Delta MI >> MTH >> 151 Fall, 2009 Description: ... Date Added: 2009-06-24 14:25:57 |
| 06866-related_literature.txt Path: Berkeley >> KAP >> 1979 Fall, 2009 Description: Bibliography Knowledge, Attitudes, and Practice of Contraception in Taiwan: Fifth Province-Wide Fertility Survey (KAP V), 1979 As of 2005-03-15, ICPSR has no data-related publications for ICPSR study 6866. If you publish a work or know of other wo... Date Added: 2009-06-24 14:31:59 |
| PS11.pdf Path: Lake County >> ECE >> 313 Fall, 2009 Description: University of Illinois Spring 2008 ECE 313: Problem Set 11 Many Random Variables This Problem Set contains six problems Due: Reading: Noncredit Exercises: Reminder: Wednesday April 16 at the beginning of class. Ross Chapter 6 Chapter 6: Problems 1,... Date Added: 2009-06-24 14:41:03 |
| HW13.pdf Path: Lake County >> ECE >> 313 Fall, 2009 Description: University of Illinois Spring 2008 ECE 313: Solutions to Problem Set 13 1 1 1 1. (a) fX 2 (v) = fX ( v) + fX (- v) = exp(-v/2 2 ) + exp(-v/2 2 ) 2 v 2 v 2 1 1 1 v (v) 2 -1 1 1 = exp - 2 = exp(-v) where = 2 and = . 1 2 2 2 2 2v 1 1 H... Date Added: 2009-06-24 14:41:06 |
| Lighting Log Manuel.xls Path: Berkeley >> ARCH >> 245 Fall, 2008 Description: Space Light Source Activity Qualitative Ratings bright dim adequate inadequate Il 0.1 Wurster 5th floor Studio West (Sunset) West window but Ground Floor blocked by Apartment another apartment Choas Room in East Tall Window Durant Hall East Asia... Date Added: 2009-06-24 14:44:38 |
| Lab9-InheritanceAns.doc Path: CSU Fullerton >> SYS >> 466 Fall, 2009 Description: SYS466 Winter 2007 Lab 9 worth 0.5%: Class Diagram Given the following class diagram re-draw it by drawing the relationships (association, composition). Determine the inheritance and draw the inheritance. Exercise 1: This class diagram shows data t... Date Added: 2009-06-24 14:44:53 |
| Complement.pdf Path: Illinois Tech >> MATH >> 481 Fall, 2009 Description: Math 481/542: (Introduction to) Stochastic Processes Instructor: Prof. Tomasz R. Bielecki Supplement on Conditional Expectations and Filtrations Consider probability space (, P ). For simplicity, let be nite. A partition of is a family of subsets ... Date Added: 2009-06-24 14:48:03 |
| attachment-0001.doc Path: Oregon State >> ENGR >> 20080401 Fall, 2009 Description: Getting Out of Debt Presented by Do you own a credit card? Have student loans? Come learn how to get out of debt! MU 208 from 1 2 pm Thursday, April 3rd Average credit card debt owed by college students: $2,700 10% owed more than $7,000! Dont ... Date Added: 2009-06-24 14:51:33 |
| attachment.doc Path: Oregon State >> ENGR >> 20080401 Fall, 2009 Description: Getting Out of Debt Presented by Do you own a credit card? Have student loans? Come learn how to get out of debt! MU 208 from 1 2 pm Thursday, April 3rd Average credit card debt owed by college students: $2,700 10% owed more than $7,000! Dont ... Date Added: 2009-06-24 14:52:45 |
| matlbadistubancech4.pdf Path: Western Michigan >> ECE >> 371 Fall, 2009 Description: Disturbance Response for K=100 0.012 0.01 0.008 y(t) 0.006 0.004 0.002 0 0 0.5 1 Time (sec) Disturbance Response for K=20 0.05 0.04 0.03 y(t) 0.02 0.01 0 1.5 2 2.5 0 0.5 1 Time (sec) 1.5 2 2.5 ... Date Added: 2009-06-24 14:54:19 |
| Hw9_F08.pdf Path: UCSB >> GEOG >> 210 Fall, 2009 Description: Homework 9 Geog210a Due: December 12, 2008 Problems from text: 12.6.3, 12.6.4, 12.6.10 (solve using Gaussian elimination by hand), 12.6.11 DV Problems: 1. Solve these systems of linear equation using Gaussian elimination. Please solve these by han... Date Added: 2009-06-24 14:56:49 |
| IST220CHAP07.ppt Path: Penn State >> IST >> 220 Fall, 2008 Description: vti_encoding:SR|utf8-nl vti_timelastmodified:TR|24 Oct 2001 22:40:26 -0000 vti_extenderversion:SR|5.0.2.2623 vti_author:SR|CT146\\gwc2 vti_modifiedby:SR|CT146\\gwc2 vti_timecreated:TR|24 Oct 2001 22:40:26 -0000 vti_cacheddtm:TX|24 Oct 2001 22:40:26 -00... Date Added: 2009-06-24 15:02:28 |
| week_11_notes.pdf Path: San Diego State >> DESIGN >> 496 Fall, 2009 Description: ... Date Added: 2009-06-24 15:12:59 |
| lect07.ps Path: Maryland >> CMSC >> 212 Fall, 2005 Description: %!PS-Adobe-3.0 %Title: Microsoft PowerPoint - lect07.shortened %Creator: PScript5.dll Version 5.2.2 %CreationDate: 9/29/2005 6:53:1 %For: Owner %BoundingBox: (atend) %Pages: (atend) %Orientation: Portrait %PageOrder: Special %DocumentNeededResources:... Date Added: 2009-06-24 15:14:11 |
| week_11_notes.pdf Path: San Diego State >> PROVENCIO >> 496 Fall, 2009 Description: ... Date Added: 2009-06-24 15:15:48 |
| chapter8b.pdf Path: Colorado State >> ECE >> 461 Fall, 2008 Description: ... Date Added: 2009-06-24 15:17:35 |
| HW2-f07.pdf Path: Lake County >> ECE >> 541 Fall, 2009 Description: ECE/CS 441: COMPUTER SYSTEMS ANALYSIS Homework #2 Due Thursday September 20, 2007 The goals of this exercise are for you to become familiar with the mechanics of modeling using Mbius and analysis of systems using Fault Trees. Completing this exercise... Date Added: 2009-06-24 15:18:39 |
| lecture-notes-13.pdf Path: Lake County >> ECE >> 462 Fall, 2009 Description: ... Date Added: 2009-06-24 15:18:55 |
| LZ71.pdf Path: Lake County >> ECE >> 563 Fall, 2009 Description: ... Date Added: 2009-06-24 15:19:07 |
| MAT-105-fall-2003-exam-2a.pdf Path: E. Kentucky >> MATH >> 105 Fall, 2009 Description: MAT 105 Fall 2003 Exam 2A PLEASE WRITE YOU NAME ONLY ON THE BACK OF THIS TEST. Before you begin, make sure you have a complete exam. There are 7 problems. Skip around and completely work as many problems as possible. You must show all work and comm... Date Added: 2009-06-24 15:21:41 |
| f05-fin.pdf Path: SUNY Stony Brook >> MAT >> 127 Summer, 2008 Description: Final exam MAT 127 Last Name , First Name I.D.# Lecture# Question 1 2 3 4 5 6 7 8 Total: Points 10 20 30 50 20 40 10 20 200 Score Stop! Do Not Open This Exam Booklet Until You Are Told to Do So! Exam Rules: No Calculators. No Books. No Notes... Date Added: 2009-06-24 15:24:39 |
| Presentation.ppt Path: Penn State >> STN >> 112 Fall, 2009 Description: The Gateway at MICA Baltimore, Maryland The Pennsylvania State University Todd Newswanger Architectural Engineering Mechanical Option, Spring 2007 Presentation Outline Background Information Existing Conditions Design Objectives Proposed Me... Date Added: 2009-06-24 15:28:45 |
| hw1.doc Path: New Mexico >> MATH >> 123 Fall, 2008 Description: Name_ MATH 123TRIGONOMETRY HOMEWORK IDue Date (Monday, June 11, 2007) Q.NO TOTAL SCORE 1 2 3 4 5 6 7 8 9 10 TOTAL 10 10 10 10 10 10 10 10 10 10 100 Show all the required work of how you get your answer. 1 1. Show that the following points are ... Date Added: 2009-06-24 15:29:41 |
| 123hw5.pdf Path: SUNY Stony Brook >> MAT >> 123 Summer, 2008 Description: HOMEWORK 5 Due Date 11/22/05 For Recitation 04 : MAT 123 Problem 1 Find the domain of the function log2 (x + 1) + 1. Problem 2 Graph the function f (x) = 3x+1 4. Problem 3 State whether the following are true or false : (i)The graph of rationa... Date Added: 2009-06-24 15:29:46 |
| hw6.pdf Path: Paul Quinn >> MAT >> 328 Fall, 2009 Description: Math 328 Homework 6 due on Thursday 3/17/05 Problem 1. Find the (formal) solution of the ut = 4uxx u(0, t) = 1, ux (, t) = 0 u(x, 0) = x heat equation 0 < x < , t > 0 t>0 0<x< Problem 2. Show that the (formal) solution of the heat equation 0... Date Added: 2009-06-24 15:31:22 |
| lgmice.ppt Path: Western Washington >> BIOL >> 321 Fall, 2008 Description: Troubling News in Genetics? Genetics and Behavior Reverse Genetic Analysis Pheromones .Small volatile chemical signals, function in communication between animals, act much like hormones in influencing physiology and development. General Odor Rec... Date Added: 2009-06-24 15:31:54 |
| PSet4.pdf Path: National Taiwan University >> AST >> 871 Fall, 2009 Description: Astronomy 871, Autumn 2008, Problem Set 4 Due Wednesday Nov 12 Problem 1: Using Table II from Panagia 1973 [AJ, 78, 929], and noting that what he calls NL is our Q(H0), and the values of the Case B and effective recombination coefficients for H0 give... Date Added: 2009-06-24 15:32:59 |
| hw2.pdf Path: National Taiwan University >> AST >> 162 Fall, 2009 Description: Astronomy 162 Winter Quarter 2006 Homework #2 Due in class Monday, January 30 Instructions This handout is just a worksheet: homework answers must be turned in on the bubble sheets provided. You can pickup additional bubble sheets during class. Usin... Date Added: 2009-06-24 15:33:02 |
| luminosity-temp-size.pdf Path: Case Western Reserve University >> AST >> 202 Fall, 2009 Description: Luminosity, Temperature, and Size Part I: Luminosity, Temperature. and Size 53 ,.i Imagine you are comparing the ability of electric hot plates of different sizes and temperatures to fully cook two identical large pots of spaghetti. Note that all ... Date Added: 2009-06-24 15:33:40 |
| mid_07.pdf Path: CUNY Baruch >> MAT >> 328 Fall, 2009 Description: Math 328 Midterm Exam March 20, 2007 The exam has 5 problems, each worth 20 points. Return your work on Thursday 5/22 at the start of lecture. Solutions must be complete and clear, showing all the steps along the way. Neatness counts! You can use... Date Added: 2009-06-24 15:42:44 |
| EDPL 702 3rd analytic exercise.doc Path: Maryland >> EDPL >> 702 Fall, 2009 Description: September 20, 2004 EDPL 702 Advanced Seminar in Research Methods for Education Leaders Quantitative Approaches to Policy Analysis 3rd Analytic Exercise* (Due Monday April 11, 2005) Youre area superintendent is still interested in having you pursue an... Date Added: 2009-06-24 15:45:47 |
| T0501.t06.pb-logo.pdf Path: UCSC >> T >> 0501 Fall, 2009 Description: T0501.t06 pb 6 5 4 3 2 1 MLTKVIAQAHIDHFTKWFERADKIVIVSHVSPDGDAIGSSLGLYHFLDSQDKIVNVIVPNAFPDFLKWMPGSKDILLYDRYQEFADKLIMEADVICCLDF 1 10 20 30 40 50 60 70 80 90 M 6 5 4 3 2 1 BD FDFK M M NOPA D FIB FK M DGH M P BD D FK NALKRIDEMSDIVAASPGRKIMIDHHLYPE... Date Added: 2009-06-24 15:47:20 |
| ps5.pdf Path: University of Toronto >> MAT >> 247 Fall, 2009 Description: MAT 247S - Problem Set 5 Due Thursday March 12 Questions 3, 4, 5, 9b), 9c) and 10b) will be marked. 1. Let V be a finite-dimensional vector space over a field F and let T L(V ). Let x be a nonzero vector in V and let W be the T -cyclic subspace gene... Date Added: 2009-06-24 15:47:52 |
| quizsol.pdf Path: NSC Henderson >> MAT >> 124 Fall, 2009 Description: Quiz Solutions These are suggested solutions. Other solutions may be possible. Quiz 1 1. Write {x| 4 < x < 4} in interval notation, and graph the interval on a number line. (R.1, 12) Answer: Interval notation: (4, 4). [Graph of number line showing ... Date Added: 2009-06-24 15:48:04 |
| Klich.pdf Path: National Taiwan University >> HISTORY >> 534 Fall, 2009 Description: ... Date Added: 2009-06-24 15:52:57 |
| Silverblatt.pdf Path: National Taiwan University >> HISTORY >> 533 Fall, 2009 Description: ... Date Added: 2009-06-24 15:53:00 |
| errata5.ps Path: MIT >> PUBLIC >> 1803 Fall, 2009 Description: %!PS-Adobe-2.0 %Creator: dvipsk 5.66a Copyright 1986-97 Radical Eye Software (www.radicaleye.com) %Title: errata5.dvi %Pages: 2 %PageOrder: Ascend %BoundingBox: 0 0 612 792 %DocumentFonts: cmbx10 cmr10 cmti10 cmmi10 cmex10 cmsy7 cmr7 cmmi7 %+ cmtt10 ... Date Added: 2009-06-24 15:56:29 |
| Chemistry_437_Sylabus.pdf Path: Virgin Islands >> CHEM >> 437 Fall, 2009 Description: Chemistry 437/537 Biological and Medicinal Chemistry Spring 2009 (CRN 26851) Medicinal chemists in industry and academia must interact with a wide variety of researchers, including biologists, biochemists, pharmacologists, and clinicians. The objec... Date Added: 2009-06-24 15:57:56 |
| YJL046W.t2k.dssp-ebghstl-logo.pdf Path: UCSC >> YJL >> 046 Fall, 2009 Description: YJL046W.t2k EBGHSTL 3 2 1 CEEE S X E HHH EC GT ECCCCECCCCSTGGXX SS S X X E S B S T X X X X X X T EE C S X X S E C T C C S C S X X X HH 1 10 20 30 40 E 3 2 1 E H H T T C C TEESSSHHH T S T E T S E X X X X X X CCCC S C HT C TSTS H... Date Added: 2009-06-24 16:03:24 |
| YJL025W.t2k.dssp-ehl2-logo.pdf Path: UCSC >> YJL >> 025 Fall, 2009 Description: YJL025W.t2k DSSP-EHL2 2 1 C CC 1 E E E E E X X X X X X X X X CCECE CE E CCCCCCCCC X C E H X X X X X X H C X X X X X H H E H E X E C X C C CXECEXXCHHXHH C C C C C C C CXE C E E E E E E H X X X X X X X X X X C CEE C X CC X X C E X X... Date Added: 2009-06-24 16:03:28 |
| overview.pdf Path: Allan Hancock College >> INFT >> 042 Fall, 2009 Description: Subject Overview Alexander Zangerl az@bond.edu.au Subject Overview p.1/12 INFT335 IntTech3 Subject Outline instances Subject Content What, Where and When Lectures Tutorials/Labs Feedback How youll get your marks Subject Overview p.2/12 S... Date Added: 2009-06-24 16:04:26 |
| YJL099W.t2k.stride-ebghtl-logo.pdf Path: UCSC >> YJL >> 099 Fall, 2009 Description: YJL099W.t2k EBGHTL 3 2 1 C X T THC H E E X 10 20 30 40 T 3 2 1 H H H H T T X X H T T H E T H C C T HHHHHCTEECGEGC E CCCEC C C H C E G T T H G H G H E E C H C E G T T T X X XXTXXXHHHXXEXCXGGXXXTH X X X X X X X X X X X X X X X X X X X X ... Date Added: 2009-06-24 16:04:33 |
| inclass0327.pdf Path: ASU >> MAT >> 343 Fall, 2009 Description: Homework and Computer Lab Exercises for March 27 Due at the end of class. You will need to do this assignment with MATLAB. The goal today is to t linear and quadratic curves to some simple datasets. Introduction Let S be a symmetric matrix. Since S ... Date Added: 2009-06-24 16:07:25 |
| shortestPathAlgorithm.ps Path: North Texas >> CSCE >> 1040 Fall, 2008 Description: %!PS-Adobe-3.0 %BoundingBox: 38 24 574 768 %Title: Enscript Output %For: Phil Sweany %Creator: GNU enscript 1.6.3 %CreationDate: Tue Apr 15 14:42:27 2008 %Orientation: Portrait %Pages: (atend) %DocumentMedia: letter 612 792 0 () () %DocumentNeededRes... Date Added: 2009-06-24 16:09:59 |
| ps8Sol.pdf Path: Rutgers >> CS >> 171 Fall, 2009 Description: Problem Session 8 1. Suppose that A, B, and n other people line up in random order. What is the expected number of people between A and B? Solution: Let X be a random variable denoting the number of people between A and B. Let Xi be an indicator ran... Date Added: 2009-06-24 16:10:00 |
| 99a1247_2.pdf Path: Wisconsin >> LAW >> 670 Fall, 2009 Description: 1999 2000 LEGISLATURE LRBa1247/2 MJL:kmg:jf ASSEMBLY AMENDMENT 1, TO 1999 ASSEMBLY BILL 670 February 8, 2000 Offered by Representative HOVEN. 1 2 3 4 5 6 7 8 At the locations indicated, amend the bill as follows: 1. Page 2, line 10: delete l... Date Added: 2009-06-24 16:14:37 |
| Robson Co Business Card.pdf Path: BYU >> IT >> 548 Fall, 2009 Description: PLASTIC INJECTION MOLDING PRODUCT/MOLD DESIGN TOOLING SENSOR DIVISION Christopher A. Robson THE ROBSON CO., INC. Christopher A. Robson THE ROBSON CO., INC. President 227 HA... Date Added: 2009-06-24 16:22:14 |
| syllabus.ps Path: Stevens >> CS >> 601 Fall, 2009 Description: %!PS-Adobe-2.0 %Creator: dvips(k) 5.86 Copyright 1999 Radical Eye Software %Title: syllabus.dvi %Pages: 2 %PageOrder: Ascend %BoundingBox: 0 0 612 792 %EndComments %DVIPSWebPage: (www.radicaleye.com) %DVIPSCommandLine: dvips syllabus -o %DVIPSParamet... Date Added: 2009-06-24 16:24:02 |
|
|
Get Started With Course Hero Today!
Get study guides, join study groups, and more!
Sign up in seconds with your Facebook account!
Course Hero is a Facebook Application Partner.
Click below to sign-up for FREE.
Our Social Learning Network was built to provide students and key learning partners like professors a platform to share, meet and collaborate while accelerating their comprehension of course-related theories and concepts. We are committed to providing you immediate access to a growing wealth of study materials and an unparalleled academic network of students, professors and other key partners. Why do you care? Because you want the best grade possible and at times need a 24/7 resource that’s responsive to your needs. |
|
What People Are Saying About Course Hero
|
|||
|
|||
|
Explore the benefits of joining Course Hero's social learning network.
|
|||
![]() |
Get millions of study materials now!Need lecture notes for a missed class or want insightful explanation of the theories and concepts you learn in class? Look no further, Course Hero’s Study Materials empowers you to find a broad and deep set of materials that can help you right now!
Click below to sign-up for FREE.
|
||
![]() |
Get over 200,000 textbook solutions now!Having difficulty with your homework and need documents that are relevant for your Textbook? Don't be frustrated. Course Hero's Textbook Help presents you study materials from many college courses.
Click below to sign-up for FREE.
|
||
![]() |
Meet over 300,000 students and your fellow classmates now!Want to meet your current classmates or those that took the class last year? Don’t worry or have anxiety. Course Hero’s Study Groups gives you the seamless opportunity to develop both anonymous or direct relationships with those classmates whom you want to meet and get help from right now!
Click below to sign-up for FREE.
|
||


