Course Solutions And Notes - hw06a04-solutions 0d
| sd2_bus_plan3.doc Path: Mississippi State >> ECE >> 4522 Fall, 2009 Description: vti_encoding:SR|utf8-nl vti_timelastmodified:TR|01 Nov 2004 22:29:19 -0000 vti_extenderversion:SR|4.0.2.7802 vti_backlinkinfo:VX|deliverables.html vti_filesize:IR|71680 vti_title:SR|7 vti_cacheddtm:TX|01 Nov 2004 22:29:19 -0000 vti_cachedlinkinfo:VX|... Date Added: 2009-06-24 04:26:47 |
| Dilbert.pdf Path: MSOE >> EM >> 765 Fall, 2009 Description: ~ :.J LLJ3,-z c:t. LLJ (\'., U) .- :,z:>!: oLLJ >-uc!)c:t. - 1-1 ZLLJ~:> LLJZ IO :I:OLLJ r-LLJ 30.-c:t. \'OUI\'.oo!puAS .In.~ p.\"un 1:001: -eolhIh ~ I LLJ c:t. U)~LLJLLJLLJ LLJZoU):I: c:t.1-ILLJ<\" LLJ U)\' =IOZ ~LLJ~ .-c:t.U)LLJc:t. 1-1\' - U... Date Added: 2009-06-24 04:29:26 |
| LEC 8 PHY 231 Spring 09 oscillations1.ppt Path: S. Connecticut >> PHY >> 231 Summer, 2008 Description: Plotting the linear position of an object undergoing a rotation Plotting the linear position of an object undergoing a rotation Amplitude and period x The amplitude is the magnitude of the maximum displacement (measure from a zero for di... Date Added: 2009-06-24 04:30:16 |
| 2008_Week_4_Powerpoint_Slides.pdf Path: Allan Hancock College >> GEOM >> 451624 Fall, 2009 Description: Topic 4 Organisational Structure and People Management Compiled by A/Prof Gary J. Hunter 2008 Page 79 A Global View of the Subject Topic 1 Subject Introduction and Organizational Context of GIS Topic 2 Strategic Planning and the Business Case Top... Date Added: 2009-06-24 04:31:07 |
| lec10_simple_and_compound_interest.pdf Path: Michigan State University >> MATH >> 106 Fall, 2009 Description: Simple Interest: With r = the annual interest rate, the simple interest on a principal P for t years is I = P rt and the future value FV is F V = P (1 + rt). Instead of using years, time could be measured in months, or days. The quantity r would be t... Date Added: 2009-06-24 04:31:18 |
| TP_u06_20.ppt Path: UF >> CHEM >> 4412 Fall, 2009 Description: Consider a diatomic molecule with a ground electronic state well desscribed by a Morse potential with e = 1000 cm-1 and exe = 10 cm1 . What is the frequency of the origin of the IR fundamental absorption of this molecule? 0% 0% 0% 0% 0% a) b) c) d) ... Date Added: 2009-06-24 04:31:29 |
| A History of Conjoint.pdf Path: UPenn >> MARKETING >> 004 Fall, 2009 Description: ... Date Added: 2009-06-24 04:32:24 |
| The Minimal Rank Correlation - 1986.pdf Path: UPenn >> MARKETING >> 001 Fall, 2009 Description: ... Date Added: 2009-06-24 04:32:28 |
| T0448.t06.w0.5-logo.pdf Path: UCSC >> T >> 0448 Fall, 2009 Description: T0448.t06 w0.5 5 4 3 2 1 M IA M I V K G G L AM A I SN G H VS F K RP A WL G D S I T AN N G LA T V HY H D IL A A DW D V E R SD N L G I S G S T I G SR Y D A M A V RY Q A I P E D AD F I A V F G GV N D Y G R D QP 1 10 20 30 40 50 60 70 80 90 H 5 4 3 2 1 ... Date Added: 2009-06-24 04:34:12 |
| week01.pdf Path: Acton School of Business >> PHYS >> 533 Fall, 2009 Description: Basic properties of bulk materials August 13, 2002 These first several weeks we will give an overview of some of the key ideas in solid state physics. Before we can understand why systems act differently at the nm scale than in bulk, it is necessar... Date Added: 2009-06-24 04:35:29 |
| week14_lectures.pdf Path: Acton School of Business >> PHYS >> 533 Fall, 2009 Description: The story so far: Devices based on ferromagnetism have found tremendous utility in technology. Ferromagnetism at the nm scale is increasingly important, and physical effects (e.g. superparamagnetism) not usually seen in large devices will become re... Date Added: 2009-06-24 04:35:31 |
| asgn4s.ps Path: Case Western >> ASGN >> 341 Fall, 2009 Description: %!PS-Adobe-3.0 %Title: Microsoft Word - asgn4s.doc %Creator: PSCRIPT.DRV Version 4.0 %CreationDate: 04/28/98 07:56:01 %BoundingBox: 16 9 597 784 %Pages: (atend) %PageOrder: Special %Requirements: %DocumentNeededFonts: (atend) %DocumentSuppliedFonts: ... Date Added: 2009-06-24 04:41:32 |
| proj4.pdf Path: Portland >> CS >> 515 Fall, 2008 Description: Spring \'09: CS415/515 Advanced Parallel Programming Prof. Jingke Li(FAB 120-06, li@cs.pdx.edu); Classes: TTh noon-1:50pm @ FAB150; Office Hours: TTh 10-11am. 5/21/09 Programming Project #4 (Due Thursday, 6/04/09 @ noon, - Firm Deadline!) This proje... Date Added: 2009-06-24 04:41:36 |
| UNHM.pdf Path: New Hampshire >> PDFS >> 0506 Fall, 2009 Description: UNIVERSITY OF NEW H AMPSHIRE AT M ANCHESTER Robert E. Jolley, Interim Dean Peter Haebler, Associate Dean Bachelor of Arts Business Communication Arts English History Humanities Psychology Bachelor of Science Computer Information Systems Electrical En... Date Added: 2009-06-24 04:42:15 |
| devgenetics_sheet1.pdf Path: N.C. State >> BIO >> 183 Fall, 2008 Description: How Are Morphogenesis and Cell Differentiation Controlled During Embryonic Development? 1. Name 4 animals that are widely used for research in the field of developmental genetics. 2. Regarding cytosolic factors: Indicate how (and where) they are gen... Date Added: 2009-06-24 04:42:45 |
| Review_Sections1to5.doc Path: Lycoming >> MATH >> 106 Fall, 2009 Description: ... Date Added: 2009-06-24 04:42:56 |
| hw5s.pdf Path: Oregon >> MATH >> 261 Fall, 2008 Description: Ch. 5 x2 -1 x+1 = limx1 (x - 1) = 0. 2 x3 -8 (ii) limx2 x-2 = limx2 (x-2)(x +2x+4) = limx2 (x2 + 2x + 4) = 12. x-2 3 (iii) limx3 x -8 = 19 = 19. x-2 1 n -y n (iv) limxy x x-y = limxy (xn-1 +xn-2 y+ +x2 y n-3 +xy n-2 +y n-1 ) ny n-1 . 1. (i) limx1 ... Date Added: 2009-06-24 04:43:34 |
| MATH_1106_Topic_Schedule_Fall_08.pdf Path: Kennesaw >> MATH >> 1106 Fall, 2008 Description: MATH 1106 Fall, 2008 Sections 02, 04, 06 APPROXIMATE Topic Schedule . Date Estimated section coverage Class Overhead Estimated Homework due date 8/18 8/20 8/25 8/27 9/1 9/3 9/8 9/10 9/15 1 2 3 4 5 6 7 8 9/17 9/22 9/24 9/29 10/1 10/6 9 10 11 12 1... Date Added: 2009-06-24 04:43:41 |
| math 1106 test 3 answer key-fall 08.pdf Path: Kennesaw >> MATH >> 1106 Fall, 2008 Description: Math 1106 Test 3 fall 08 Answer Key Cross Reference This cross reference will match the question numbers in the answer key to test versions 1 & 2. v.1 v.2 1 2 3 4 5 8 13 19 22 11 17 12 21 2 13 14 10 24 25 23 6 7 8 9 v.1 v.2 7 3 20 10 4 5 15 3 9 v.1 v... Date Added: 2009-06-24 04:43:47 |
| dccp.07f.hw.doc Path: Delaware >> CIS >> 856 Fall, 2009 Description: UNIVERSITY OF DELAWARE DEPARTMENT OF COMPUTER & INFORMATION SCIENCES CISC 856 TCP/IP and Upper Layer Protocols Homework Datagram Congestion Control Protocol (DCCP) Ke Li (kli@cis.udel.edu) Due Date: Thursday, December 6, 2007 Question 1. Write Yes/... Date Added: 2009-06-24 04:44:31 |
| DawkinsBlindWatchmaker.pdf Path: Dartmouth >> M >> 102 Fall, 2009 Description: ... Date Added: 2009-06-24 04:44:40 |
| 990617.ps Path: Stanford >> MEET >> 990617 Fall, 2009 Description: %!PS-Adobe-3.0 %Title: Microsoft PowerPoint - 990617 %Creator: Windows NT 4.0 %CreationDate: 23:53 6/16/1999 %Pages: (atend) %BoundingBox: 17 17 775 595 %LanguageLevel: 2 %DocumentNeededFonts: (atend) %DocumentSuppliedFonts: (atend) %EndComments % %B... Date Added: 2009-06-24 04:44:50 |
| A Fitness Unit (Lesson 8 of 9).pdf Path: Purdue >> ICS >> 429 Fall, 2009 Description: Purdue Lesson Plan Form Teachers Name: Travis Stoutenborough and Andy Walford Resource: Physical Best Activities Packet (Survivor Fitness Challenge) Unit: Fitness Skill taught: Cardiovascular Endurance, Muscular Strength/Endurance, Flexibility, Body ... Date Added: 2009-06-24 04:45:35 |
| set5.pdf Path: Neumont >> PHY >> 3700 Fall, 2009 Description: xv v s v svvi cg vi v p9uvn\"ulVhhpF{B l yV decxV$i\"$`F{iVdVvpf2eg{hg gutVsyr` iwt~f0$i3BF0grFVdegchpechv p 0q wwd0u d d ihggh$B` $vhF... Date Added: 2009-06-24 04:45:53 |
| ee483_Lecture_05_012903z9h.pdf Path: USC >> ENGR >> 483 Fall, 2009 Description: ... Date Added: 2009-06-24 04:46:03 |
| lab3Sample.ppt Path: Temple >> TUA >> 07476 Fall, 2009 Description: CIS 55 In Class Sample Karen Chen Lab Section 016 Friday, February 09, 2007 Animate Schemes Line one Line two Line three Karen Chen - Sec 016 Customer Animation Line one Line two Line three Karen Chen - Sec 016 Add a Sound Karen Chen -... Date Added: 2009-06-24 04:48:28 |
| AOC110305.pdf Path: University of Hawaii - Hilo >> MIN >> 0506 Fall, 2009 Description: Accreditation Oversight Committee November 3, 2005 Present:Jan Lubin, Diane Caulfield, Janet Garcia, Chris Ann Moore Excused: Cynthia Smith, Sheryl Legaspi, Linda Ching, Sharon Ota Meeting began 1:10pm Old: Minutes from the October meeting were appro... Date Added: 2009-06-24 04:51:37 |
| rpd.pdf Path: UCSD >> NEU >> 200 Fall, 2008 Description: Neuron, Vol. 26, 703714, June, 2000, Copyright 2000 by Cell Press Attention Increases Sensitivity of V4 Neurons John H. Reynolds,* Tatiana Pasternak, and Robert Desimone* * Laboratory of Neuropsychology National Institute of Mental Health National ... Date Added: 2009-06-24 04:54:53 |
| Available_Titles.xls Path: Maple Springs >> ARTS >> 3600 Fall, 2009 Description: Title: Subtitle You: Staying Young You Can Run but You Can\'t Hide: Star of Dog the Bounty Hunter World of Hockey Uncle John\'s Triumphant Bathroom Reader The Year of Living Biblically Contributor Roizen, Michael F. (AU) > ISBN 9780743292566 Publish... Date Added: 2009-06-24 04:55:10 |
| new pictures.ppt Path: Uni. Westminster >> MEH >> 0717 Fall, 2009 Description: ... Date Added: 2009-06-24 04:58:01 |
| 09topic3.pdf Path: W. Alabama >> ECE >> 710 Fall, 2009 Description: Topic 3. Pseudo-random Sequence/Number Generators 1 2 3 4 5 6 One-time-pad and Design Principles of Stream Ciphers Filter Function Generators Combinatorial Function Generators Clock-control Generators and Shrinking Generators Blum-Blum Generators K... Date Added: 2009-06-24 04:58:04 |
| Lecture 9.doc Path: Mercer >> CSC >> 205 Fall, 2009 Description: Lectures 9 Case Study: Drawable Shapes In this short lecture (due to Quiz 1), we\'ll do a recap on the design of the shape class hierarchy, and review key Java classes that are used in graphics programming, such as Graphics and Color (from the java.aw... Date Added: 2009-06-24 05:00:35 |
| Computing as a Discipline.pdf Path: Mercer >> CSC >> 204 Fall, 2009 Description: REPORT COMPUTING AS A DISCIPLINE The final report of the Task Force on the Core of Computer Science presents a new intellectual framework for the discipline of computing and a new basis for computing curricula. This report has been endorsed and appr... Date Added: 2009-06-24 05:00:36 |
| Association and Correlation-Model III.doc Path: Mercer >> SCI >> 105 Fall, 2009 Description: Association and Correlation In-Class Exercise Worksheet Model III Team Name: _ Participants: _ The table in the attached Excel file (model3.xls) provides information on life expectancies for a sample of 22 countries. It also lists the number of telev... Date Added: 2009-06-24 05:00:56 |
| DimAn.pdf Path: Duke >> CE >> 245 Fall, 2008 Description: CE 245 Pollutant Transport Systems Dimensional Analysis, Dynamic Similitude, Modeling Dimensional analysis - method for reducing the number of independent physical variables of fluid flow phenomena, as a function of as many dimensionless groupings of... Date Added: 2009-06-24 05:02:48 |
| hw.pdf Path: Michigan State University >> MTH >> 415 Fall, 2008 Description: 1. Problems on change of bases (1) Consider the vector space R2 and with bases S = [e1 ]S = 1 0 , [e2 ]S = S 0 1 , S U = [u1 ]S = 1 1 3 1 , [u2 ]S = S 1 -1 . S Let T : R2 R2 be a linear transformation given by [T (u1 )]S = 1 3 , S [T (u2 )]... Date Added: 2009-06-24 05:03:09 |
| both.txt Path: Berkeley >> ASTRO >> 00020082 Fall, 2009 Description: 1e-05 1e-05 1 1 61135.6 66354.2 0.0356164 0.00769136 66354.2 66903.3 0.0226091 0.00730521 66903.3 67466.1 0.0256493 0.00783564 67466.1 71950.8 0.0223661 0.00717918 71950.8 72377 0.028436 0.0094071 72377 72748.1 0.0329036 0.0108022 72748.1 94650 0.032... Date Added: 2009-06-24 05:03:21 |
| hadas-summary.pdf Path: Michigan State University >> CSE >> 914 Fall, 2008 Description: ux}kl|4t|tz}irl~i}w}tkyk|}zrmlr\"fG`A#p}d m ~ i k x io s w i k x m iz q m k xzw ~ x x kwz y ~ k x kwo ~ x m i ~kw k x y i ~ ~ i k x kz k y mo k |komlktw4w|p{|z%l|nlz{}ur}olikW|t{jxilk|o3n`wp|{tylQrmQ}imlkx{|}o|}urm }ix7rn%|t{lk... Date Added: 2009-06-24 05:03:36 |
| mi26.txt Path: Michigan >> PUMS >> 1990 Fall, 2009 Description: STATE: 26 PUMA: 00100 MSA/PMSA: 9999 TYPE OF AREA: OUTSIDE MSA/PMSA NAME POPULATION ST COU MCD PLACE TRACT MSA/PMSA Dickinson County 26831 26 043 9999 Gogebic C... Date Added: 2009-06-24 05:03:56 |
| websites2.doc Path: N. Georgia >> CSCI >> 3641 Fall, 2009 Description: Websites: http:/www.everythingpreschool.com/alphabet/A/more.htm This website has a lot of unique ideas, such as ways to help teach the alphabet with examples of snacks, activities, and coloring pages. http:/www.lessonplanz.com/Grades_K-2/ This websit... Date Added: 2009-06-24 05:04:27 |
| MidReview2.pdf Path: Oregon >> MATH >> 433 Fall, 2008 Description: Review 2 Richard Koch May 9, 2005 1 Curves Here are the key facts you\'ll need for calculations: If (t) is a curve, then its length from t0 to t is s(t) = t t0 | (t)| dt If (u) is parameterized by arc length, then , T, N, B can be computed usin... Date Added: 2009-06-24 05:05:54 |
| blt6060_quiz2.pdf Path: Neumont >> BLT >> 6060 Fall, 2009 Description: Quiz 2 1 Quiz 2 cours 3 et 4 1. Formulez des hypothses correspondant aux critres ci-dessous : a) Variables (2) : niveau de confort avec les technologies vitesse d\'apprentissage d\'une nouvelle base de donnes Type d\'hypothse : simple, directionnell... Date Added: 2009-06-24 05:06:34 |
| CPS.xls Path: Iowa State >> ECON >> 371 Fall, 2008 Description: ahe 34.62 19.23 13.74 19.23 19.23 38.46 33.65 9.62 8 19.23 9.13 19.23 23.08 13.46 15.38 9.62 26.15 17.44 8.41 8.13 26.44 6.22 13.94 5.77 48.08 28.85 9.62 12.6 13.5 14.42 21.15 23.08 2.34 12.98 47.16 4.18 18.75 13.94 14.42 24.04 19.23 17.71 42.79 15 7... Date Added: 2009-06-24 05:08:19 |
| Activity 3b.xls Path: Idaho >> OCON >> 0938 Fall, 2009 Description: Student Loan Re-Payment 6/15/2009 Loan amount Length of Loan (years) Rate Monthly payment Total Cost Stafford Subsidized Stafford Unsubsidized $12,000.00 $8,000.00 $9.75 $12.00 $0.07 $0.05 $140.57 $16,447.14 $75.61 $10,887.37 1 Put the correct ... Date Added: 2009-06-24 05:09:43 |
| 18-InternetProtocols.pdf Path: UT Arlington >> EE >> 5360 Fall, 2008 Description: DATA AND COMPUTER COMMUNICATIONS Chapter 18 Internet Protocols Eighth Edition by William Stallings PDUS and Fragmentation 1 Phases of Connection Oriented Transfer TCP/IP Concepts 2 The Internet as a Network k Fragmentation Example 3 I... Date Added: 2009-06-24 05:11:01 |
| hw1_instructions.pdf Path: Ill. Chicago >> CS >> 422 Fall, 2008 Description: CS 422 User Interface Design Spring 2004 HW Assignment 1 - Development Tool Analysis Due: Friday 21 January at 5:00. Overall Assignment For this assignment you are to investigate and evaluate at least four different development tools for the develo... Date Added: 2009-06-24 05:11:11 |
| hw7.pdf Path: Concordia Chicago >> MATH >> 277 Fall, 2008 Description: Homework 7: Due Tuesday, November 28 Required Problems Problem 1: Let L = {R} where R is a binary relation symbol. a. Show that the class of all connected graphs is not a weak elementary class in the language L. (A graph (V, E) is connected if whenev... Date Added: 2009-06-24 05:13:54 |
| che132a-rec-5.pdf Path: UCSB >> CHE >> 132 Fall, 2009 Description: ... Date Added: 2009-06-24 05:15:03 |
| Average F scores.pdf Path: East Los Angeles College >> BP >> 306 Fall, 2009 Description: Average F scores 0.850 0.800 0.750 0.700 0.650 0.600 0.550 0.500 0 2 4 6 8 10 12 14 16 18 Original Code Double Per point 1 d2^2 over d1^2 d2 over d1^2 F score ... Date Added: 2009-06-24 05:16:05 |
| discreterv.pdf Path: RIT >> M >> 351 Fall, 2009 Description: _ _ _ _ _ _ _ Discrete Random Variables _ Consider the experiment of tossing two coins S = {(H,H),(H,T),(T,H),(T,T)} Suppose we are more interested in counting \"the number of heads in the two tosses\". Call this number X. Note that X could be ei... Date Added: 2009-06-24 05:16:10 |
| extra_normal_soln.pdf Path: RIT >> M >> 351 Fall, 2009 Description: Solutions to Additional Questions on Normal Distributions 1. . EPA fuel economy estimates for automobile models tested recently predicted a mean of 24.8 mpg and a standard deviation of 6.2 mpg for highway driving. Assuming that the mileages are norma... Date Added: 2009-06-24 05:16:11 |
| t2982s.pdf Path: RIT >> M >> 351 Fall, 2009 Description: SMAM 351 98-2 PROBABILITY AND STATISTICS I Page 1 TEST 2 Solution NOTE 1: WRITE YOUR SOLUTIONS CLEARLY AND IN COMPLETE SENTENCES. NOTE 2: SHOW ALL THE WORK AND JUSTIFY YOUR ANSWERS FOR FULL CREDIT. JUST A \"RIGHT ANSWER\" WITHOUT EXPLANTION WILL NO... Date Added: 2009-06-24 05:16:17 |
| t2982soln.pdf Path: RIT >> M >> 351 Fall, 2009 Description: SMAM 351 98-2 PROBABILITY AND STATISTICS I Page 1 TEST 2 Solution NOTE 1: WRITE YOUR SOLUTIONS CLEARLY AND IN COMPLETE SENTENCES. NOTE 2: SHOW ALL THE WORK AND JUSTIFY YOUR ANSWERS FOR FULL CREDIT. JUST A \"RIGHT ANSWER\" WITHOUT EXPLANTION WILL NO... Date Added: 2009-06-24 05:16:17 |
| lec14.ps Path: Purdue >> CS >> 352 Spring, 2008 Description: %!PS-Adobe-3.0 %BoundingBox: (atend) %Pages: (atend) %PageOrder: (atend) %DocumentFonts: (atend) %Creator: Frame 5.0 %DocumentData: Clean7Bit %EndComments %BeginProlog % % Frame ps_prolog 5.0, for use with Frame 5.0 products % This ps_prolog file is ... Date Added: 2009-06-24 05:16:36 |
| Problem Set 8, sp 09 mw97.doc Path: NHMCCD >> CHEM >> 1419 Fall, 2008 Description: Chem1419 Chapter 7. LoomisPrice Problem set 8 Spring 2009 7.13 (a,d,e), 7.14, 7.15 (b,c,e,f), 7.16 (a,d,e), 7.20 (a,d,e,f), 7.28 (a,c), 7.37, 7.38, 7.52, 7.58, 7.61 Chapter 8. 8.10 (a,b), 8.12, 8.16, 8.20, 8.22, 8.48, 8.52 Chapter 10. 10.26, 1... Date Added: 2009-06-24 05:17:00 |
| Solutions and Dilutions.xls Path: NHMCCD >> BITC >> 2411 Fall, 2008 Description: Solution/Dilution Worksheet How much KCl do you need to make up 900 mL of a 150 mM solution? (A) Formula: step 1: wt (g) = FW (g/mol) * conc (mol/L) * vol (L) Calculate FW if it is not given: K Cl KCl 39.10 g/mol 35.45 g/mol 74.55 g/mol You can als... Date Added: 2009-06-24 05:17:01 |
| evans_ch2.pdf Path: University of Alaska Fairbanks >> ECON >> 227 Fall, 2009 Description: ... Date Added: 2009-06-24 05:17:33 |
| hw1backupbyEldawy.txt Path: Wisconsin >> CS >> 766 Fall, 2008 Description: 60H W 1.007031667 1.659796667 1.101058333 0.871173333 0.299896667 -1.111291667 0.271363333 0.895176667 -0.860443333 1.262426667 -1.261465 0.315291667 -0.601781667 1.03136 -0.594733333 -0.326436667 -0.249003333 -2.02075 0.0531 -2.164126667 -1.24608833... Date Added: 2009-06-24 05:18:09 |
| 140ex2samB.pdf Path: Penn State >> MATH >> 140 Fall, 2008 Description: MATH 140 1. Find the linearization of f (x) = a) L(x) = -x - 1 b) L(x) = -x + 1 1 1 c) L(x) = - x + 2 2 d) L(x) = -x + e) L(x) = x + 1 1 2 1 at a = 0. x-1 EXAM II SAMPLE B 5. Find the number c that satisfies the conclusion of the Mean Value 1 Theore... Date Added: 2009-06-24 05:19:17 |
| 210C.doc Path: Texas >> CH >> 210 Fall, 2009 Description: vti_encoding:SR|utf8-nl vti_timelastmodified:TR|04 Jun 2009 15:35:33 -0000 vti_extenderversion:SR|12.0.0.6211 vti_author:SR|RANDY\\Conrad vti_modifiedby:SR|CBITS-CD59D62DF\\Conrad vti_timecreated:TR|09 Aug 2005 17:09:36 -0000 vti_title:SR|CH 210C vti_a... Date Added: 2009-06-24 05:19:45 |
| 35-Causal Layered Analysis.doc Path: Penn State >> NC >> 5014 Fall, 2009 Description: The Millennium Project Futures Research Methodology-V3.0 CAUSAL LAYERED ANALYSIS: AN INTEGRATIVE AND TRANSFORMATIVE THEORY AND METHOD by Sohail Inayatullah1 I. History of the Method II. Description of the Method III. Applications IV. Strengths an... Date Added: 2009-06-24 05:21:10 |
| CSI_16_Division_Format.pdf Path: Washington >> ARCH >> 478 Fall, 2008 Description: CSI 16 Division Format Product Divisions 0 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 Contract and Bid information Scope of Work and Procedures Site Construction Concrete Masonry Metals Wood and Plastics Thermal and Moisture Protection Doors and Windows ... Date Added: 2009-06-24 05:21:49 |
| ass3.pdf Path: Contra Costa College >> COEN >> 352 Fall, 2009 Description: COEN 352/1 CC Assignment 3 August 7, 2006 Due: August 14,15,16, 2006 1. Example code for an adjacency-list graph has been posted on the web along with a Windows application to draw the graph nodes. Complete the functions: SimpleGraph<T>:insertEdge( ... Date Added: 2009-06-24 05:22:32 |
| Management Compelling Models.doc Path: Wisc Stevens Point >> EDUCATION >> 381 Fall, 2009 Description: Classroom Management Systems Dubuque Management System: This is a highly consistent, immediate, predictable and structured educational environment to teach social and academic skills. The Dubuque management system is typically used in special educati... Date Added: 2009-06-24 05:23:52 |
| GEOG584Assignment9_Memo1.pdf Path: Penn State >> BMS >> 584 Fall, 2009 Description: INTEROFFICE MEMORANDUM TO: FROM: SUBJECT: DATE: PATRICK KENNELLY BRAD SHIREY RESPONSE TO PROJECT CHARTER MEMO SEPTEMBER 17, 2007 After my review of your suggestions regarding my proposed project charter I am writing this response to inform you of th... Date Added: 2009-06-24 05:24:43 |
| sl11.pdf Path: Georgia Tech >> PHYS >> 6124 Fall, 2008 Description: ... Date Added: 2009-06-24 05:25:08 |
| Ch02.ppt Path: CSU Chico >> CH >> 111 Fall, 2009 Description: Data and Expressions Chapter 2 2007 Pearson Addison-Wesley. All rights reserved Data and Expressions Let\'s explore some other fundamental programming concepts Chapter 2 focuses on: character strings primitive data the declaration and u... Date Added: 2009-06-24 05:25:15 |
| key3.doc Path: Old Dominion >> CS >> 488 Fall, 2008 Description: Key HW 3. Thanks to Joel Carter. His work has been used, modified and/or comments added to build this key. 2.3.2 Syntax directed translation scheme for translating postfix to infix notation expr {print(`(\')} expr expr {print(`(\')} expr expr {print... Date Added: 2009-06-24 05:25:36 |
| Test1sg.doc Path: Bowling Green >> TEST >> 1101 Fall, 2009 Description: MATH 1101 Introduction to Mathematical Modeling 2006 Spring Semester Test 1 Study Guide Show your work! 1. (15 pts) Refer to the chart below that depicts the wolf population in Yellowstone National Park (YNP), the Greater Yellowstone Area (GYA), and ... Date Added: 2009-06-24 05:26:08 |
| lab27.pdf Path: TCU >> MAN >> 10161 Fall, 2009 Description: IMPORTANT: remember to reduce the voltage to zero and to turn the power off before you connect the wires to another lamp. The neon lamp will not conduct electricity until you reach about 50 V, make several readings around this value, and then increas... Date Added: 2009-06-24 05:29:38 |
| MATH1902.pdf Path: Allan Hancock College >> MATH >> 1902 Fall, 2009 Description: THE UNIVERSITY OF SYDNEY Semester 1, 2009 Information Sheet for MATH1902 Linear Algebra (Advanced) Web Site It is important that you check the Junior Mathematics web site regularly. It may be found by following links from the University of Sydney fro... Date Added: 2009-06-24 05:30:29 |
| M2063_sol9.pdf Path: Allan Hancock College >> MATH >> 2063 Fall, 2009 Description: ... Date Added: 2009-06-24 05:30:55 |
| Devon.doc Path: IUPUI >> N >> 361 Fall, 2009 Description: Devon The Hovitar Installation will go as Follows. you will also need the Hovitar airport which will make your avator accesible to you around your home and even your car. all steps are voice activated and thanx to the world wide web your possibili... Date Added: 2009-06-24 05:31:09 |
| detailed_log.txt Path: Southern Oregon >> CASA >> 20080606 Fall, 2009 Description: 2008-04-09 15:38:05 CDT - BEGIN (3 h Fcst, 2008-04-09.00:00Z, spc2, spc2_3600x2688_2) 2008-04-09 15:38:08 CDT - Generating terrain, soil, and vegetation files 2008-04-09 15:38:42 CDT - Processing satellite data 2008-04-09 15:38:43 CDT - Processing ba... Date Added: 2009-06-24 05:31:12 |
| katakana_quiz2_guide.pdf Path: Rose-Hulman >> JP >> 112 Fall, 2009 Description: For 2 (Monday, Dec. 10) Section 1: Translation (Katakana English) e.g., table Section 2: Dictation e.g., You\'ll hear: You\'ll write For sections 1 and 2, review the following words: a. Household or personal items b. Place related words: c. Music... Date Added: 2009-06-24 05:32:39 |
| sec2.pdf Path: Furman >> MATH >> 151 Fall, 2009 Description: 8.2Infinite series Mark Woodard Furman University Fall 2007 Mark Woodard (Furman University) 8.2Infinite series Fall 2007 1 / 15 Outline 1 2 3 4 5 6 7 Some problems to set the stage The proper definition The geometric series Telescoping series... Date Added: 2009-06-24 05:33:06 |
| ece754_lec2_inclass.pdf Path: George Mason >> ECE >> 754 Spring, 2009 Description: ... Date Added: 2009-06-24 05:34:12 |
| HW12DA.pdf Path: University of Illinois, Urbana Champaign >> MATH >> 213 Fall, 2008 Description: ... Date Added: 2009-06-24 05:34:33 |
| h9.pdf Path: University of Illinois, Urbana Champaign >> EE >> 467 Fall, 2009 Description: EE 467 Handout # 9 GAUSSIAN RANDOM VARIABLES The Gaussian Probability Density Function This is the most important pdf for this course. It also called a normal pdf. 2 1 - (x-m) fX (x) = e 22 . 2 Fall 1999 October 13, 1999 It can be shown this f X ... Date Added: 2009-06-24 05:34:45 |
| ho-lec2.pdf Path: New Mexico >> CS >> 361 Fall, 2009 Description: x S C4 B D 6 R4 A C D C y vwu ts q rp E S4 X \' X V # $ H U$ ! $ H \'U$ G d ! \'I 2$ \'! # G ! G U$ U$ # V \" V I # H I \'G !) H $ $ ! E G h CS B S4 DR@ C@ Q T1 4 ) \'II& U$ # H ! b Pb b ... Date Added: 2009-06-24 05:35:12 |
| Ch03.ppt Path: GA Southern >> CPTR >> 405 Fall, 2009 Description: Chapter 3 Describing Syntax and Semantics ISBN 0-321-33025-0 Chapter 3 Topics Introduction The General Problem of Describing Syntax Formal Methods of Describing Syntax Attribute Grammars Describing the Meanings of Programs: Dynamic Seman... Date Added: 2009-06-24 05:35:43 |
| PP04-NP1-sol.xls Path: RPI >> ECSE >> 6640 Spring, 2009 Description: PP04 HW NP1 (1) SAMPLING RATE Horizontal IEEEa A C G K M Z IEEEc 301 301 301 300 300 301 100 100 97.4 100 97.4 100 KODADd KODAKe 381.5 127 300.8 100.3 300.5 100 300 100 300.5 100 300.8 100.8 Vertical IEEEa IEEEc KODADd KODAKe 302.5 100.6 379.5 126.3 ... Date Added: 2009-06-24 05:37:01 |
| hw1010s2006.pdf Path: Purdue >> STAT >> 514 Fall, 2008 Description: Assignment 10 (Do not need to hand in, but it is required for the final exam) 1. A textile mill has a large number of looms. Each loom is supposed to provide the same output of cloth per minute. To investigate this assumption, five looms are chosen a... Date Added: 2009-06-24 05:37:18 |
| test.txt Path: Clarkson >> CS >> 444 Fall, 2009 Description: $d dthis is a file i want to import. I will then export it after being imported. fileimporttestoverthefilenamesize \"-Fthis is a file i want to import. I will then export it after being imported. importtestoverthefilenamesize ... Date Added: 2009-06-24 05:37:52 |
| Soc 200 Mini-Quiz #1.pdf Path: CSU Northridge >> TPH >> 53095 Fall, 2009 Description: Fall 2005 Haugen, Soc 200 Mini-Quiz #1 5 points, October 5, 2005 Student Name (print): _ANSWER KEY_ Please circle the best answer for each question (1point each) 1. The belief that women are equal to men and that all humans deserve equal rights is... Date Added: 2009-06-24 05:38:05 |
| Lecture12.pdf Path: Colorado >> MCDB >> 3500 Fall, 2008 Description: MCDB 3500 Lecture #12 2/18/02 Figures: 11.54, 10.32, 10.30, 10.33, 11.52, 10.36 (1st Ed.: 11.52, 10.32, 10.30, 10.33, 11.50, 10.36) Eukaryotic Transcription Polymerases -complex with many subunits -Evolutionary relationship to prokaryotic core polym... Date Added: 2009-06-24 05:38:08 |
| Unit 60.pdf Path: Toledo >> MET >> 1110 Spring, 2008 Description: ... Date Added: 2009-06-24 05:39:40 |
| 08Multioral3a.xls Path: Mt. Marty >> DB >> 2561 Fall, 2009 Description: 0deb16e45f807fa5fee3aaab2ab6a735d51ecca3.xls INPUT D1 D [mg] 400 tau [h] 4 n 4 t1/2abs[h]0.50 Vd [L] 11 CL [L/h] 3.5 F 1.00 D2 600.0 6 4.0 0.50 6 3.5 1.0 D3 500.0 5 4.0 0.50 9 3.5 1.0 70000 60000 50000 40000 30000 20000 10000 0 0 2 4 6 8 10 12 14 16... Date Added: 2009-06-24 05:40:45 |
| Ch03.ppt Path: Kent State >> BUSINESS >> 24163 Fall, 2009 Description: Ethics and Social Responsibility CHAPTER THREE Copyright 2005 by South-Western, a division of Thomson Learning. All rights reserved 1 CHAPTER THREE Ethics and the Nature of Management Jobs Ethics: the set of moral principles or values that define... Date Added: 2009-06-24 05:41:15 |
| exam2a.doc Path: Purdue >> CE >> 399 Spring, 2008 Description: Name: _ Recitation # or time: _ Exam 2, CE399 February , 2007 1 Chapter 7: \"Gathering, Evaluating, and Documenting Information\" 1. Describe the important components of MLA documentation. (5pts) 2. Chapter 7: Identify a red flag that would give yo... Date Added: 2009-06-24 05:41:27 |
| hwguidelines.pdf Path: Arizona >> MATH >> 109 Fall, 2008 Description: Homework Guidelines Contrary to popular myth, effective communication in words and complete sentences is as much an integral part to doing mathematics as the use of symbols and equations is to solving algebraic problems. Throughout the textbook, you ... Date Added: 2009-06-24 05:41:31 |
| Week 1, Introduction.ppt Path: Uni. Worcester >> CS >> 502 Fall, 2008 Description: CS-502 CS-3013 (Summer 2007) Introduction 1 Outline for Today Logistics and Details of this Course Introductions Discussion What is an Operating System? Introduction to Co... Date Added: 2009-06-24 05:42:24 |
| People.txt Path: Illinois Tech >> CS >> 115 Fall, 2009 Description: John Doe 1234 5.8 James Doe1 2345 6.0 Mary Dow2 5678 5.5 Helen Dow3 7891 5.4 Maria Dow4 2781 5.6 George Dow5 6723 6.1 Frank Dow6 2987 5.3 Anita Dow7 1934 5.4 Dave Dow8 2671 5.8 Shara Dow9 3128 5.9 Sylvester Dow10 7895 5.3 Salvador Do11 4537 6.1... Date Added: 2009-06-24 05:42:35 |
| msy_2001.ppt Path: UMass (Amherst) >> Z >> 348 Fall, 2009 Description: Maximum Sustainable Yield: An Application of Population Ecology to Resource Management `surplus\' production & Amount Harvested Lecture Goals Describe the rationale behind MSY Discuss ways that MSY can be implemented List and describe factors that... Date Added: 2009-06-24 05:43:19 |
| 201hmwk6sp05.pdf Path: Purdue >> PSY >> 201 Fall, 2008 Description: Psy 201 Homework 6 (Due 4.1.05) Instructions: For this homework, you will be answering questions to problems from chapters 13 and 14 in the text. You don\'t need to rewrite each question; just put the question number next to your answer. You may use a... Date Added: 2009-06-24 05:43:54 |
| Lecture08Transp.pdf Path: Stanford >> ECON >> 155 Fall, 2009 Description: ... Date Added: 2009-06-24 05:48:21 |
| Lecture11Transp.pdf Path: Stanford >> ECON >> 155 Fall, 2009 Description: ... Date Added: 2009-06-24 05:48:22 |
| spec_wt_bg.txt Path: Berkeley >> ASTRO >> 00350311 Fall, 2009 Description: # tmin tmax 0.0944740 5.55856 [ksec] ;instrument XRT ;exposure 948.25129 ;xunit kev ;bintype counts 0.000000 0.010000 0.000000 0.000000 0.010000 0.020000 0.000000 0.000000 0.020000 0.030000 0.000000 0.000000 0.030000 0.040000 0.000000 0... Date Added: 2009-06-24 05:50:11 |
| appendix8_1.doc Path: CSU LA >> UNIV >> 006 Fall, 2009 Description: Appendix 8.1. Outdoor Non-smoking Areas 1. 2. 3. 4. 5. 6. 7. 8. East quad entrance to basement of King Hall. Outside play area at Anna Bing Arnold Children\'s Center. Outside seating areas and patios associated with The Golden Eagle building. Area ... Date Added: 2009-06-24 05:50:17 |
| dlec06.pdf Path: BU >> MA >> 572 Fall, 2009 Description: MA 572 Introduction to Mathematical Finance Lecture #6 Paolo Guasoni guasoni@bu.edu Boston University c 2004 by Paolo Guasoni p. 1/5 Introducing the Risk-Free Asset We now consider the case where a risk-free asset is present. To write convenien... Date Added: 2009-06-24 05:50:41 |
| 2006629_r01o_05338.pdf Path: Stanford >> PARS >> 1033 Fall, 2009 Description: Case 2:05-cv-00338-KSH-PS Document 75 Filed 06/29/2006 Page 1 of 2 NOT FOR PUBLICATION UNITED STATES DISTRICT COURT DISTRICT OF NEW JERSEY _ : IN RE PHARMOS SECURITIES : Civil Action No. 05-338 LITIGATION : : __: : SERLE, : : Plaintiff, : Civil A... Date Added: 2009-06-24 05:51:12 |
| assignment5.pdf Path: ASU >> CSE >> 320 Fall, 2008 Description: Assignment 5 Date Assigned: Thursday, October 25th, 2007. Date Due: Thursday, November 1st, 2007. Number of problems: 4, Total points: 100. NOTE The following problems can be solved with the synthesis software and without utilizing the actual FPGA H... Date Added: 2009-06-24 05:51:44 |
| HW20_W04.pdf Path: Carleton >> CHEM >> 234 Fall, 2009 Description: Homework 20-due 3-5-04 in class Read the handout I gave you in class today. Read 26-1, 26-4 Problems (4th edition): 34b,c,d; 35b; 37b; 41a,b; 47a,b,g,j; 49 Problems (3rd edition): 29b,c,d; 30b; 32b; 36a,b; 42a,b,g,j; 44 ... Date Added: 2009-06-24 05:52:19 |
| ch4_blog.pdf Path: Rose-Hulman >> JP >> 212 Fall, 2009 Description: topic: o Freely write about any kind of rules you know. What kinds of rules did you have to follow when you were a little child at home or when you were a high school student? Which rules you didn\'t like? Do you have any interesting stories that ... Date Added: 2009-06-24 05:52:27 |
| Presentations.pdf Path: CSU Long Beach >> MKTG >> 470 Fall, 2009 Description: MKTG470 Team Presentations A few notes about your upcoming presentations. The team presentations are meant to be important so please follow some basic guidelines: 1. Be prepared. Rehearse, rehearse, rehearse! [Notes are fine, but please avoid readin... Date Added: 2009-06-24 05:53:08 |
| appendixA.pdf Path: East Los Angeles College >> COMP >> 102 Fall, 2009 Description: Data Structures and Information Systems Part 1: Data Structures Ullrich Hustadt Appendix A: Program design Topics Traditional development life cycle Object-oriented design Noun and verb analysis Class acceptance/rejection criteria p.1 Tradit... Date Added: 2009-06-24 05:53:54 |
| Solution2.pdf Path: Michigan State University >> ME >> 477 Fall, 2008 Description: ME477: Manufacturing Processes Fall 2005 Homework #2 MCQ 10.2 (a) 10.4 (a) 10.6 (d) 10.9 (b) Problems 10.7 Velocity at base v = (2gh)0.5 = (2 x 981 x 25)0.5 = 221.5 cm/s Assuming volumetric continuity, area at base A = (1000 cm/s)/(221.5 cm/s) = 4.5... Date Added: 2009-06-24 05:57:20 |
| Ch11Ex03DtftDifferenceEq.pdf Path: E. Kentucky >> COMMON >> 360 Fall, 2009 Description: ... Date Added: 2009-06-24 05:57:27 |
| akue83001_full.pdf Path: Maryville MO >> AKUE >> 83001 Fall, 2009 Description: ... Date Added: 2009-06-24 05:57:47 |
| xx1s.pdf Path: Purdue >> STAT >> 520 Fall, 2008 Description: STAT 520 EXAM 1 SPRING 2005 1. Consider an ARMA(2,2) process (1-1.4B+.49B 2 )zt = (1-5B+6B 2 )at with E[a2 ] = 1. t (6 pts.) (10 pts.) (12 pts.) (6 pts.) (4 pts.) (10 pts.) (10 pts.) (a) Calculate 1 and 2 . (b) Obtain a non-recursive expression fo... Date Added: 2009-06-24 05:59:48 |
| io.pdf Path: Virginia Tech >> CS >> 2704 Summer, 2002 Description: a bit about Streams A stream is an abstract representation of an input or output device. abstract portable across machines Java has no built in input/output statement. Java I/O has 2 kinds of streams: byte streams-can be used for integer, floats... Date Added: 2009-06-24 06:01:02 |
| R_INTRO_PART_III.txt Path: Bowling Green >> M >> 758 Fall, 2009 Description: - R INTRODUCTION PART III - In this session, we\'ll get some experience creating and manipulating matrices in R. Also, we will be introduced to the notion of a data frame which is a basic way of representing data in R. Also we\'ll create our first... Date Added: 2009-06-24 06:01:13 |
| lec10.pdf Path: UPenn >> CSE >> 115 Fall, 2009 Description: CSE115 Lec10 Today\'s Goals (pic) Test 1 (Fri., Oct. 6) 11:00am - 11:50am in Moore 216 Understand the properties of local variables Learn how to use global variables Check List Practice Problems Do before the next recitation Discussion in the ... Date Added: 2009-06-24 06:03:07 |
| four.pdf Path: Oregon >> ARCH >> 484 Fall, 2008 Description: ... Date Added: 2009-06-24 06:03:49 |
| CGT_May21.pdf Path: Penn State >> KAC >> 416 Fall, 2009 Description: Firm Dynamics, Job Turnover, and Wage Distributions in an Open Economy (First draft) A. Kerem Coar, Nezih Guner and James Tybout1 s Pennsylvania State U., U. Carlos III de Madrid, and Pennsylvania State U. and NBER May 22, 2009 1 Without implicat... Date Added: 2009-06-24 06:04:18 |
| YOR221C.t2k.stride-ebghtl-logo.pdf Path: UCSC >> YOR >> 221 Fall, 2009 Description: YOR221C.t2k EBGHTL 3 2 1 C X C E TEHHH H E H E C E X X X X H X X X X X X C H H H H HXHHH E X X H E C X X X X X X X X X EEHHEECHHHH T T H H T C T C T EE T C T C E E E T H T T T H T E T H C T C T X X X X X X X X X X X X X X X X X X X X X X ... Date Added: 2009-06-24 06:05:33 |
| 19460307.TXT Path: Penn State >> BUB >> 1946 Fall, 2009 Description: Sheet1 STATE COLLEGE, PENNSYLVANIA DAILY WEATHER SUMMARY - Latest Complete Day [Midnight - Midnight LT] -03/07/46 High Temperature Low Temperature Mean Temperature Rain or Liquid Equivalent Snow and/or Ice Pellets Snow Depth : : : 63 Rank (1=Warm... Date Added: 2009-06-24 06:07:20 |
| Quiz4 with answers.pdf Path: Cal Poly >> ECON >> 339 Fall, 2009 Description: California Polytechnic State University Economics 339: Econometrics Winter 2008 My name is: _Eric Fisher_ Quiz 4 This quiz is open everything. Here is some output from Eviews: Dependent Variable: TESTSCR Method: Least Squares Date: 03/10/08 Time: 09... Date Added: 2009-06-24 06:08:14 |
| assignment3.ps Path: Carnegie Mellon >> ASSIGNMENT >> 10702 Fall, 2009 Description: %!PS-Adobe-2.0 %Creator: dvips(k) 5.86 Copyright 1999 Radical Eye Software %Title: assignment3.dvi %Pages: 5 %PageOrder: Ascend %BoundingBox: 0 0 612 792 %EndComments %DVIPSWebPage: (www.radicaleye.com) %DVIPSCommandLine: dvips -o assignment3.ps -D60... Date Added: 2009-06-24 06:09:14 |
| prob3.txt Path: Carnegie Mellon >> CS >> 10702 Fall, 2009 Description: 7.378 12.10 1 11.464 0.02 0 -1.321 7.80 0 16.559 8.24 1 7.033 11.80 1 9.408 6.18 1 0.320 19.88 0 5.806 14.86 1 0.008 6.26 0 10.319 5.58 1 -0.842 11.03 0 7.283 14.80 1 10.787 5.96 1 -1.... Date Added: 2009-06-24 06:09:20 |
| hawking_radiation_thumb.ps Path: Southern Oregon >> LEC >> 025 Fall, 2009 Description: %!PS-Adobe-2.0 %Title: hawking_radiation_thumb.ps %Creator: fig2dev Version 3.2 Patchlevel 3d %CreationDate: Sun Jan 23 21:40:27 2005 %For: zzdjeffe@occ (jeffery david) %Orientation: Portrait %Pages: 1 %BoundingBox: 0 0 612 792 %BeginSetup %IncludeFe... Date Added: 2009-06-24 06:09:26 |
| Hype.doc Path: MIT >> FINA >> 515 Fall, 2009 Description: Derivatives and Risk Management Survey Cutting through the hype Asia Risk, June 2001, 28-30 As Asia\'s financial executives become more sophisticated, they are also becoming more skeptical of the risk management industry, and more selective in their c... Date Added: 2009-06-24 06:09:49 |
| hw8.pdf Path: Columbia >> E >> 3801 Fall, 2009 Description: Signals And Systems HW#8 Solutions ... Date Added: 2009-06-24 06:10:09 |
| dss_radec.txt Path: Berkeley >> ASTRO >> 00292934 Fall, 2009 Description: #ra dec rmag drmag 301.760265 10.697943 19.943 0.160 301.950343 10.697351 19.665 0.132 301.844984 10.697757 19.239 0.090 301.629444 10.698536 19.850 0.167 301.702607 10.698325 18.696 0.058 301.694907 10.698345 18.949 0.073 301.686274 10.698389 18.997... Date Added: 2009-06-24 06:10:27 |
| Garon and Mochizuki - Negotiating Social Contracts.pdf Path: Columbia >> APD >> 2117 Fall, 2009 Description: ... Date Added: 2009-06-24 06:12:58 |
| Lec18PRS.pdf Path: WVU >> MATH >> 121 Fall, 2008 Description: Section 9.2: Polygons Dr. Fred Butler Math 121 Fall 2004 Polygons A polygon is a closed figure in a plane determined by three or more straight line segments. Below are pictured some examples of polygons. Polygons cont\'d. The straight line segmen... Date Added: 2009-06-24 06:13:10 |
| 4356marketingplan.doc Path: Michigan State University >> WEB >> 4000 Fall, 2009 Description: AGRISCIENCE AND NATURAL RESOURCES EDUCATION CURRICULUM (4000) Curriculum Area: BUSINESS MANAGEMENT AND MARKETING (4350) UNIT: AGRICUTURAL MARKETING, SALES, TRADE AND ADVERTISING Mr. Christensen __ _ (4356) Topic: Marketing Plan _ _ TOPIC OBJECTIVES: ... Date Added: 2009-06-24 06:13:36 |
| 19760511.TXT Path: Penn State >> BUB >> 1976 Fall, 2009 Description: Sheet1 STATE COLLEGE, PENNSYLVANIA DAILY WEATHER SUMMARY - Latest Complete Day [1200 UT - 1200 UT] -05/11/76 High Temperature Low Temperature Mean Temperature Rain or Liquid Equivalent Snow and/or Ice Pellets Snow Depth : : : 79 Rank (1=Warmest, ... Date Added: 2009-06-24 06:14:14 |
| brigetteHquiz.doc Path: North Texas >> CECS >> 4100 Fall, 2008 Description: Terms of the Rainforest 1. What is a primate from Madagascar, whose most unique features are its one long finger and giant eyes? a) Lizard b) aye-aye c) monkey 2. The ecological community complete with plants, animals, and its physical environment (... Date Added: 2009-06-24 06:14:32 |
| relations.ps Path: East Los Angeles College >> CS >> 1021 Fall, 2009 Description: %!PS-Adobe-2.0 %Creator: dvips(k) 5.92b Copyright 2002 Radical Eye Software %Title: root-tp.dvi %Pages: 14 0 %PageOrder: Ascend %Orientation: Landscape %BoundingBox: 0 0 596 842 %DocumentFonts: Helvetica-Bold Helvetica-Oblique Helvetica Symbol %+ Tim... Date Added: 2009-06-24 06:14:49 |
| R08-US.pdf Path: Michigan >> PERSONAL >> 340 Fall, 2009 Description: Econ 340 Fall Term 2006 Review Questions Alan Deardorff U.S. Policies and Institutions Page 1 of 4 Review Questions Lecture 8 U.S. Trade Policies and Institutions Part 1: Multiple Choice Select the best answer of those given. 1. Which of the fol... Date Added: 2009-06-24 06:15:00 |
| 505em_7.pdf Path: University of Illinois, Urbana Champaign >> PHYS >> 505 Fall, 2008 Description: 505 Set 7 Due: 4/5/05 Problem 1. TEM wave. Consider a waveguide which consists of an inner solid conducting cylinder of radius a and an outer cylindrical conductor of inner radius b, where a < b. Assume the conductors are perfect, and that the wave... Date Added: 2009-06-24 06:16:39 |
| hw02.pdf Path: Penn State >> M >> 528 Fall, 2009 Description: Math 528, HWA2 due on Fri, Jan.30. Bredon: IV-4 problem 3 (p.177), IV-10 problem 12 (p.207). 1 ... Date Added: 2009-06-24 06:16:52 |
| q07.pdf Path: Penn State >> M >> 220 Fall, 2009 Description: Math 220 Quiz 7. Your name: Find a basis for ColA and NulA 1 5 A = 0 0 0 0 0 0 1 4 0 0 0 3 0 1 0 0 5 0 0 0 0 1 4 0 0 0 1 3 0 0 0 5 0 0 0 1 0 4 0 0 0 1 0 0 3 0 5 0 0 0 1 0 4 0 0 0 0 1 Therefore a basis for ColA is 0 ... Date Added: 2009-06-24 06:17:01 |
| 0613postdoc.pdf Path: UNC >> HR >> 20474 Fall, 2009 Description: May 15, 2003 TO: FROM: Deans, Directors and Department Heads Robert N. Shelton Provost and Executive Vice Chancellor Tony G. Waldrop Vice Chancellor for Research and Economic Development RE: Policies Applicable to Postdoctoral Fellows Last year ... Date Added: 2009-06-24 06:17:23 |
| Assignment5.pdf Path: UNC >> INLS >> 490 Fall, 2008 Description: Assignment # 5 (10 points) Due Thursday, June 4, end of day 1. Download the file, PersonAddressArrayDemo.java from the class website. 2. In the PersonAddressArrayDemo class, provide the Java code to implement the \"TODO\" comments. Note: this Demo cla... Date Added: 2009-06-24 06:17:34 |
| Proj2Des.doc Path: Michigan >> EECS >> 486 Fall, 2009 Description: EECS 486 Object Oriented Software Development Project 2 Design Document Description Possible Points: 100 Assigned Date: Due Date: 03NO00 20NO00 The objective of the Project 2 Design Document is to fully describe the implementation of the system prio... Date Added: 2009-06-24 06:17:54 |
| Chapter01.pdf Path: Virginia Tech >> CS >> 1054 Fall, 2008 Description: Objects First with Java A Practical Introduction using BlueJ David J. Barnes Michael Klling 1.0 Course Contents Introduction to object-oriented programming. . with a strong software engineering foundation. . aimed at producing and maintaining la... Date Added: 2009-06-24 06:19:24 |
| sm9_125.pdf Path: Iowa State >> ME >> 332 Fall, 2009 Description: Excerpts from this work may be reproduced by instructors for distribution on a not-for-profit basis for testing or instructional purposes only to students enrolled in courses for which the textbook has been adopted. Any other reproduction or translat... Date Added: 2009-06-24 06:19:47 |
| fibonacci.xls Path: UF >> PROJECT >> 5155 Fall, 2009 Description: the number in the function unit column means the cycle when the function unit is been used by the instruction the number in the Instruction Queue, Reservation Station, Load/Store Buffer, RoB means the cycle number when the instruction will stay in th... Date Added: 2009-06-24 06:20:48 |
| Ni09_P72.pdf Path: Washington University in St. Louis >> FL >> 2300 Fall, 2009 Description: 2007 Pearson Education, Inc., Upper Saddle River, NJ. All rights reserved. This material is protected under all copyright laws as they currently exist. No portion of this material may be reproduced, in any form or by any means, without permission in... Date Added: 2009-06-24 06:21:22 |
| atypical-6.pdf Path: Allan Hancock College >> IMS >> 3470 Fall, 2009 Description: Topic Overview IMS3470 Human-computer interaction DESIGNING FOR ATYPICAL and DIVERSE USERS/ ENVIRONMENTS Diverse Users Visual Hearing Mobility Cognitive and memory Accessibility Diverse Environments Wet, dirty, sterile Limited display area ... Date Added: 2009-06-24 06:23:07 |
| sol3.ps Path: Stanford >> CS >> 347 Fall, 2009 Description: %!PS-Adobe-2.0 %Creator: dvips(k) 5.85 Copyright 1999 Radical Eye Software %Title: sol3.dvi %Pages: 2 %PageOrder: Ascend %BoundingBox: 0 0 596 842 %DocumentFonts: Times-Bold Times-Roman CMMI10 CMR10 CMSY10 Courier %+ CMEX10 %EndComments %DVIPSWebPage... Date Added: 2009-06-24 06:24:56 |
| day8.pdf Path: Cal Poly >> STAT >> 221 Fall, 2009 Description: Stat 221 - Day 8 Measures of Center Three graphical displays for quantitative data: dotplot, stemplot, histogram Three important aspects of a distribution are shape, center, and spread. Common shapes are symmetric, skewed to the right, and skewed ... Date Added: 2009-06-24 06:25:17 |
| Coverletter.pdf Path: Penn State >> JPS >> 5040 Fall, 2009 Description: Justin Solinsky 129 Waring Drive Downingtown PA, 19335 Justin.Solinsky@gmail.com February 17, 2009 Dear Sir or Madam, I am currently a junior in Aerospace Engineering at Pennsylvania State University Main Campus. I was informed of Lockheed Martin\'s ... Date Added: 2009-06-24 06:27:24 |
| f05t3vb.pdf Path: Texas A&M University, Corpus Christi >> FACULTY >> 1470 Fall, 2009 Description: ... Date Added: 2009-06-24 06:29:35 |
| SouthAsiaRice.xls Path: Texas A&M University, Corpus Christi >> FACULTY >> 1470 Fall, 2009 Description: South Asia and Rice Smooth prod Year Pop Area Production Prod Smooth per capita Yield 1986 1025429 56046217 124142637 1987 1048362 53231197 118495340 1988 1071350 56293801 140288528 1989 1094296 56900587 147421345 # 127.4 1990 1117134 57544064 1492... Date Added: 2009-06-24 06:29:41 |
| chap10.ppt Path: Miami Dade >> COP >> 2825 Fall, 2008 Description: Web Server Administration Chapter 10 Securing the Web Environment Overview Identify threats and vulnerabilities Secure data transmission Secure the operating system Secure server applications Overview Authenticate Web users Use a firewall... Date Added: 2009-06-24 06:29:52 |
| CuttingStock.doc Path: Georgia Tech >> ISYE >> 6669 Fall, 2008 Description: . 2. Lagragian Methods and Decomposition In this chapter we consider linear programming problems having a very large number of constraints, and/or a very large number of variables. In many cases such models can be decomposed into a sequence of probl... Date Added: 2009-06-24 06:30:29 |
| jhinson_hw1.doc Path: UCCS >> CS >> 526 Fall, 2009 Description: Jeff Hinson CS526 Spring 2009 HW #1 (Part 2): Akamai Video Questions 1. Why akamai need to locate the data center /server almost on each ISP in Asian city such Hong Kong? Why not share a data center among a few connected ISPs? Akamai locates server... Date Added: 2009-06-24 06:31:50 |
| RE200DG.ppt Path: Benjamin Franklin Institute of Technology >> MY >> 4300 Fall, 2009 Description: 20.0 Distributed Generation Also known as \"Distributed Resources\" Frank R. Leslie, B. S. E. E., M. S. Space Technology, LS IEEE 4/7/2009, Rev. 1.9 fleslie @fit.edu; (321) 674-7377 www.fit.edu/~fleslie In Other News . . . Stimulus Act of 2009 provid... Date Added: 2009-06-24 06:32:30 |
| Syllabus971.pdf Path: George Mason >> IT >> 971 Spring, 2008 Description: Syllabus for Probability Theory IT 971 1. Sets and Functions 1.1 Basics 1.2 Set Operations and Closure 1.3 5 -Fields and Borel Sets 1.4 Probability Spaces 1.4.1 Axioms 1.5 Probability Measures and Distribution Functions 2. Random Variables 2.1 Indepe... Date Added: 2009-06-24 06:34:48 |
| LA-Communication.pdf Path: Middlesex CC >> ID >> 3828 Fall, 2009 Description: LIBERAL ARTS - COMMUNICATION Liberal Ar ts Communications - Associate in Ar ts (A.A.) Degree - LACOM.AA Questions? Contact Assistant Professor Nadine Heller, department chair, at 732.906.2589 or NHeller@middlesexcc.edu. Below are required courses fo... Date Added: 2009-06-24 06:36:27 |
| Physics.pdf Path: Middlesex CC >> ID >> 3828 Fall, 2009 Description: Physics CHEMISTRY/PHYSICS DEPARTMENT Associate in Science (A.S.) Degree This program parallels the first two years of baccalaureate degree programs in physics related fields. The major prepares graduates to transfer to a four-year college or univers... Date Added: 2009-06-24 06:36:31 |
| hw2.pdf Path: TN Tech >> ECON >> 3610 Fall, 2009 Description: Homework Set 2 ECON3610 Principles of Statistics Summer, 2007 Isbell name 1. Write out the probability distribution of the number of heads on 3 tosses of a fair coin. Find the mean and standard deviation of the number of heads. 2. The following tab... Date Added: 2009-06-24 06:38:40 |
| syllabus.doc Path: Texas State >> CS >> 1428 Fall, 2008 Description: C.S. 1428 TIME: Summer I 2009 Section .0501 02:00p.m. - 03:40p.m. M-F DERR 240 INSTRUCTOR: Becky Reichenau OFFICE: Nueces 260 CS DEPT: Nueces 247 CS Department Phone: 245-3409 E-MAIL: br02@txstate.edu (You can expect a reply to your e-mail if you... Date Added: 2009-06-24 06:39:11 |
| rehearse2.pdf Path: East Los Angeles College >> MS >> 107 Fall, 2009 Description: x g dc { B@ o sYc { bYpFddx S@I nm&BYp%!TFbFdYYFt { bSgdpsd@ E c E Ct 8CjECX8c @C c cE q w Ct 8C jEC X 8 c c @ I i VE C c p 6 u WYSuRIQ SCSbS8}GStPab9Dx 6 u B@ g 6 u p dV 4!m( e Q It IE I A i 8V C ... Date Added: 2009-06-24 06:47:43 |
| mips_summary.pdf Path: Allan Hancock College >> CS >> 1721 Fall, 2009 Description: The MIPS Info Sheet MIPS Instructions Arithmetic/Logic sub Rdest, Rsrc1, Src2 Subtract (with overflow) Put the difference of the integers from register Rsrc1 and Src2 into register Rdest. xor Rdest, Rsrc1, Src2 XOR Put the logical XOR of the integer... Date Added: 2009-06-24 06:51:30 |
| HOWTO.ps Path: Duke >> X >> 196 Fall, 2009 Description: %!PS-Adobe-2.0 %Creator: dvips(k) 5.86d Copyright 1999 Radical Eye Software %Title: /tmp/@20369.dvi %Pages: 52 %PageOrder: Ascend %BoundingBox: 0 0 596 842 %DocumentFonts: Helvetica-Bold Times-Roman Times-Italic Courier %+ Times-Bold Helvetica-BoldOb... Date Added: 2009-06-24 06:52:55 |
| aaai99.pdf Path: Iowa State >> CS >> 673 Fall, 2009 Description: Distributed Knowledge Networks Vasant Honavar Artificial Intelligence Research Laboratory Department of Computer Science Iowa State University, Ames, IA, U.S.A. honavar@cs.iastate.edu www.cs.iastate.edu/~honavar/aigroup.html Background and Motivati... Date Added: 2009-06-24 06:53:18 |
| energy_8.pdf Path: City College SF >> CHEM >> 101 Fall, 2009 Description: SECTION 8: THE CONSERVATION OF ENERGY We have now seen two fundamentally different ways to change the energy of a system. One of these is work: the system can do work (thereby lowering its energy) or the surroundings can do the work (increasing the e... Date Added: 2009-06-24 06:54:35 |
| finalmaplist.pdf Path: Harding >> HIST >> 201 Fall, 2009 Description: HIST 201: Map identifications Below are listed all of the map identifications you will need for the final map test. Use the Cold War World, Cold War Europe, U.S. & Middle East Maps, and modern Europe and World Countries 1.U.S. 13. Czechoslovakia 25. ... Date Added: 2009-06-24 06:59:14 |
| 028a.pdf Path: Amarillo College >> ADOR >> 0304 Fall, 2009 Description: APPRAISAL REVIEW BOARD ADMINISTRATION - 2003/2004 CAD SURVEY CAD NAME TOTAL PARCELS 58,435 80,513 57,990 27,054 17,739 4,725 36,764 29,297 9,416 34,529 57,039 9,412 27,922 138,146 557,698 13,236 14,464 20,552 57,762 175,583 141,322 18,372 4,625 11,93... Date Added: 2009-06-24 07:00:03 |
| pub2573FarmPonds2.pdf Path: LSU >> NR >> 2614 Fall, 2009 Description: MANAGEMENT OF RECREATIONAL AND FARM PONDS IN LOUISIANA 1 2 FARM PONDS A farm pond or recreational pond can serve many purposes: a source of food, an aesthetic enhancement to property, a sportfishing opportunity, a swimming area, wildlife habitat... Date Added: 2009-06-24 07:06:10 |
| THE_FUTURE_OF_COMPUTING.DOC Path: N. Illinois >> Z >> 115953 Fall, 2009 Description: THE FUTURE OF COMPUTING: INTERNET 2.0 Introduction The advent of a platform to meet the needs of a demanding marketplace and the emergent technology that has evolved to such a high degree has arrived. It has been realized that the advocacy of high... Date Added: 2009-06-24 07:06:55 |
| hw2.pdf Path: UF >> COP >> 4600 Summer, 2008 Description: W z f u f } r q q f g q k t fq f UstU\'AhsGettxG~tAlvY~wbsUlsv r f r s zt r t rq t rvt t fq f v r f r s z u b b f r xU#wxAxG|UsVUxxYV|wbswlstxhUuwxGBUwUGx5 b tt mqt t b tvt f t rq f q r s X b fq fv t u f u b tv f f u t... Date Added: 2009-06-24 07:08:26 |
| 151T1R.pdf Path: Bellevue College >> MATH >> 151 Fall, 2009 Description: Math& 151 Test 1 Review [0.2] Lines 1. Find the slope of the secant line passing through (2, f(2) and (2+h, f(2+h), where f (x) = 1- x 2 . 2. Find the shortest distance between (x -1) + (y - 2) = 4 and (x - 8) + (y -11) = 49 . 2 2 2 2 3. Find the... Date Added: 2009-06-24 07:14:56 |
| 151T1R.pdf Path: Whatcom Community College >> MATH >> 151 Fall, 2009 Description: Math& 151 Test 1 Review [0.2] Lines 1. Find the slope of the secant line passing through (2, f(2) and (2+h, f(2+h), where f (x) = 1- x 2 . 2. Find the shortest distance between (x -1) + (y - 2) = 4 and (x - 8) + (y -11) = 49 . 2 2 2 2 3. Find the... Date Added: 2009-06-24 07:15:10 |
| cs360Bankers.doc Path: Lynchburg College >> CS >> 360 Fall, 2009 Description: CS360 Operating Systems Programming Project #2 Dijkstra\'s Banker\'s Algorithm Write a program that uses Dijkstra\'s Banker\'s Algorithm to allocate resources. The program should read from standard input using cin. The file contains entries of the fol... Date Added: 2009-06-24 07:16:19 |
| p1290807s.pdf Path: Caltech >> PH >> 129 Fall, 2009 Description: ph129b PS 7 solutions Sean Tulin(revised by C. Park) (minor revision 080306 fcp) March 6, 2008 Problem 27: Quaternion Group The quaternion group has 8 elements {1, -1, i, -i, j, -j, k, -k}. From the multiplication rules, we can form the multiplicati... Date Added: 2009-06-24 07:21:51 |
| Outcomes263B.pdf Path: Bethel VA >> MATH >> 263 Fall, 2009 Description: Learning Objectives for MATH 263B 1. Express a definite integral as the limit of Riemann sums 2. Demonstrate the ability to determine indefinite and definite integrals, use definite integrals to find areas of planar regions, use the Fundamental Theo... Date Added: 2009-06-24 07:24:12 |
| Chapter8-ke.ppt Path: Allan Hancock College >> WEEK >> 12036 Fall, 2009 Description: #(D#Chapter8-ke.ppt#cpe]?#[#Llcb 5Ol mgb(#wzz~# Ww# =G#/# z #h#3?G|# #D g\" 0\\ #!~}HP#!M|g~? mgvZ\\:sK#do#Y#9G#R:]FeiA| \'K|)U#wQVf!+#A<(9#k# `l#I(S#z#9>E|#7BPp3# i}A#?CCgH\" 1I66?#A-Op#\'# #dOn?X 2Ei#0| #\"#{mX#Su#Y #j!#gwWq#Xu ]2o##b3#BKa#4 ! Tr<nnL2... Date Added: 2009-06-24 07:24:35 |
| nov6.pdf Path: Sveriges lantbruksuniversitet >> LING >> 220 Fall, 2009 Description: Tree structures from the Nov 6-8 tutorials: Question 3 a) Det the NP N zoo b) Qual always VP V try c) Deg so AP A witty d) VP V pass Qual perhaps e) Deg less g) Deg very i) Qual never AP A bleak AP A competent VP V surrender f) Det this h) De... Date Added: 2009-06-24 07:27:00 |
| P08024-SWMP.pdf Path: Cuyamaca College >> DOCS >> 090528 Fall, 2009 Description: County of San Diego S T O R M W A T E R I N T A K E FORM FOR DEVELOPMENT PROJECTS This form must be completed in its entirety and accompany applications for any of the discretionary or ministerial permits and approvals referenced in Sections 67.803(... Date Added: 2009-06-24 07:32:50 |
| L14372-VS.pdf Path: Cuyamaca College >> DOCS >> 090423 Fall, 2009 Description: ... Date Added: 2009-06-24 07:32:53 |
| P04059-SWMP.pdf Path: Cuyamaca College >> DOCS >> 081017 Fall, 2009 Description: ... Date Added: 2009-06-24 07:33:27 |
| distasio.pdf Path: Delta MI >> ENG >> 098 Fall, 2009 Description: ... Date Added: 2009-06-24 07:36:47 |
| s29.ppt Path: UNI >> FACULTY >> 061 Fall, 2009 Description: Session 29 More with Digital Sounds PA05 Feedback Assignment specific things: You were supposed to write a comment in the header block which included size information. I had really intended for you to have more than one image file (multiple chara... Date Added: 2009-06-24 07:37:51 |
| hw1.pdf Path: Washington >> MEBI >> 531 Fall, 2008 Description: MEDED 531 Assignment 1: due Monday October 13 1 Practice at Lisp The following are recommended exercises for you to do on your own, and then ask the instructor for clarification or help as needed. 1. Read the first three chapters of Graham, work as m... Date Added: 2009-06-24 07:38:49 |
| resumeguide.pdf Path: Springfield >> BC >> 81220 Fall, 2009 Description: The Rsum Student Guide Springfield College Career Center 263 Alden Street Lower Level, Beveridge Center (413) 748-3222 http:/www.spfldcol.edu/homepage/dept.nsf/career 1 The Rsum Table of Contents The Purpose of a Rsum . . . . . . . . . . . . . . .... Date Added: 2009-06-24 07:48:51 |
| eye1.pdf Path: Washington >> EE >> 420 Fall, 2009 Description: 2 0 =0 2 0 T 2T 2 0 =1 2 0 T 2T ... Date Added: 2009-06-24 07:49:08 |
| Montagu-Jenner.pdf Path: Canada College >> BIOL >> 675 Fall, 2009 Description: Smallpox-1 Montagu and Jenner: The Campaign Against Smallpox Christine L. Case and King-Thom. Chung. \"Montagu and Jenner,\" SIM News 47(2):58-60, 1997 he smallpox (variola) virus has killed more people than any other microorganism. The virus probably... Date Added: 2009-06-24 07:49:13 |
| 030609.pdf Path: Canada College >> BIOL >> 230 Fall, 2009 Description: Name_ Diffusion & Osmosis quiz 1. Hemolytic uremic syndrome (HUS) can be caused by birth control pills, pregnancy, E. coli bacteria, or pneumonia. The name of the disease, hemolytic, describes the lysis of red blood cells (RBCs). The name also includ... Date Added: 2009-06-24 07:49:36 |
| international strategy fall 2007.pptx Path: Oakland University >> MGT >> 435 Winter, 2008 Description: International Strategy Motives for Globalization Changes in the External Environment Multidomestic/Global Competition Types of International Strategy Entry Strategies Globalization The shift toward a more integrated and interdependent world economy.... Date Added: 2009-06-24 07:54:11 |
| CPR.pdf Path: University of Illinois, Urbana Champaign >> MSB >> 224 Fall, 2009 Description: Basic Life Support (CPR)-Recertification for Health Care Providers Partial List Agency Veterans Administration Hospital (Group recertification possible with advanced notice) Provena regional EMS (www.Provena regionalems.c om) Illini EMS (Group recer... Date Added: 2009-06-24 07:54:37 |
| lab_03_crystallization_ho.pdf Path: Orange Coast College >> CHEM >> 221 Fall, 2008 Description: 1 The Theory and Practice of Recrystallization I. Crystallization Basics Crystallization is a technique which chemists use to _ compounds. Crystallization is based on the principles of _. Solutes tend to be __soluble in hot solvents than they are ... Date Added: 2009-06-24 07:57:55 |
| hw28.pdf Path: Orange Coast College >> CS >> 170 Spring, 2008 Description: Homework 28 The Rabbit Hunt Due by noon on November 17 (Monday) This is a second \"loops and decisions\" capstone project. The scoring is a little different though, and you actually do have a chance to get some extra credit. When you complete the progr... Date Added: 2009-06-24 07:58:13 |
| Math121Fall03Syllabus.doc Path: University of South Dakota >> MATH >> 121 Fall, 2008 Description: Fall 2003, Survey of Calculus - Math 121 General Course Information Time / Location: Instructor: Office / Phone / E-mail: Office Hours: Prerequisite: Required Textbook: Reference book: 2:00 2:50pm M - TH / AS 106 Dr. Nan Jiang 325 Dakota Hall / 677-... Date Added: 2009-06-24 07:59:19 |
| math316S07Assignments.xls Path: University of South Dakota >> MATH >> 316 Fall, 2008 Description: Sheet1 vti_encoding:SR|utf8-nl vti_timelastmodified:TR|10 May 2007 20:30:32 -0000 vti_extenderversion:SR|4.0.2.3015 vti_filesize:IR|27136 vti_backlinkinfo:VX| vti_nexttolasttimemodified:TR|13 Apr 2007 17:58:13 -0000 vti_author:SR|njiang vti_timecreat... Date Added: 2009-06-24 07:59:51 |
| Spring05Math216HW.xls Path: University of South Dakota >> MATH >> 216 Fall, 2008 Description: Sheet1 vti_encoding:SR|utf8-nl vti_timelastmodified:TR|06 May 2005 17:54:52 -0000 vti_extenderversion:SR|4.0.2.3015 vti_author:SR|USDLOCAL\ jiang vti_timecreated:TR|04 Mar 2005 20:26:12 -0000 vti_lineageid:SR|{EC4DC296-E056-4EB0-AF28-14BAEA348CED} vt... Date Added: 2009-06-24 08:00:05 |
| Autonomic.pdf Path: El Paso CC >> BI >> 232 Fall, 2009 Description: Autonomic and Enteric Nervous Systems I. Review A. General Organization 1. CNS Brain Spinal cord 2. PNS cranial and spinal nerves Somatic NS Autonomic NS Enteric NS B. Somatic 1. Sensory receptors of skin: touch, pressure, temperature Proprioceptors... Date Added: 2009-06-24 08:03:29 |
| quiz1_ans.pdf Path: Tennessee >> MATH >> 152 Fall, 2009 Description: MATH 152 Quiz #1 01/25/2005 Section_ Name_ For each of the following two functions (questions #1 and #2) (1 point for each part): a) On the provided graph paper, sketch a graph of the function making sure to indicate any discontinuities using ope... Date Added: 2009-06-24 08:05:00 |
| pivot83.pdf Path: Tennessee >> MATH >> 123 Fall, 2009 Description: TI-83 prgm PIVOT This program carries out the pivot operation using \"fraction form\" arithmetic at the pivot element in column C and row R of the table of numbers stored in matrix [A]. Since the pivot operation for the \"simplex method\" chooses the piv... Date Added: 2009-06-24 08:05:15 |
| MICE0177.pdf Path: Illinois Tech >> MICE >> 0177 Fall, 2009 Description: MICE-NOTE-SIM-177 The study of emittance match condition in MICE lattice D. Huang a , D. Kaplan a , T. Roberts a a, b , K. Tilley c BCPS Department, Illinois Institute of Technology, Chicago, IL 60616, USA b Muons Inc, Batavia, IL 60510, USA c R... Date Added: 2009-06-24 08:08:28 |
| 12a-bookstoresurplus.pdf Path: Ohlone >> ORG >> 20070509 Fall, 2009 Description: Consent OHLONE COMMUNITY COLLEGE DISTRICT MEMORANDUM TO: FROM: DATE: SUBJECT: Board of Trustees Douglas Treadway May 9, 2007 Authorization for the Surplus of Personal Property Per Resolution No. 1/97-98 the District\'s Director of Purchasing/Contr... Date Added: 2009-06-24 08:17:04 |
| M120_3D_Dot_Prod.pdf Path: Bellevue College >> MATH >> 142 Fall, 2009 Description: Math 120 3D Dot Product 1 Math 120: DOT PRODUCT In the previous sections we looked at the meaning of vectors in two and three dimensions, but the only operations we used were addition and subtraction of vectors and multiplication by a scalar. So... Date Added: 2009-06-24 08:19:12 |
| m141A03Q4.pdf Path: Allan Hancock College >> M >> 141 Fall, 2009 Description: ... Date Added: 2009-06-24 08:19:20 |
| m141logarithms.pdf Path: Allan Hancock College >> M >> 141 Fall, 2009 Description: |{ iX ~ |{ ~ I |{ 7s ~ I |{ w ~ ~ u I |{ c |{ g ~ I |{ i ~ }|{ Sp ~ fc y uaexe$isxuIswe |W fc |$y g e s t X` v s v x X ` ttX r vX ~ { z g e ~ { z |{ ~ ~ |{ 7s ~ ua|{ w ~ |{ iX |{ ~ ~ ... Date Added: 2009-06-24 08:19:23 |
| Assignment4.pdf Path: Dixie State >> FIN >> 4400 Fall, 2009 Description: Assignment 4 Fin 4400, Spring 2009 Dixie State College of Utah Faculty: Dr. Munir Mahmud Due Date: 04/23/2009 You will do the following problems from your text book. These are the problems that you will find at the end of chapter 8 (beginning page 24... Date Added: 2009-06-24 08:20:52 |
| sampling_dist_145.pdf Path: Wisc La Crosse >> MATH >> 145 Fall, 2009 Description: Math 145 - Elementary Statistics Central Limit Theorem March 5, 2006 Parameter. A parameter is a numerical descriptive measure of a population. This quantity is usually unknown but it is constant at a given time. Examples: , 2 , , . Statistic. A... Date Added: 2009-06-24 08:21:34 |
| business_calc_HW_part7.pdf Path: Whatcom Community College >> MATH >> 148 Fall, 2009 Description: Math &148 Big List of Homework part 7. Read sections 9.1, 9.2, and 9.3. Then answer these questions: 1. Suppose Q(x, y) gives the number of widgets a company sells if the price of one of their widgets is x dollars/widget, and the price of a competit... Date Added: 2009-06-24 08:21:56 |
| quiz3key.pdf Path: Elmhurst >> MATH >> 151 Spring, 2009 Description: Math 151 Quiz 3 Name Key 1. Either find the indicated limit or show that it does not exist. If you determine that the limit does not exist, determine if it can be described by +, -, or neither of these. (a) lim t t3 2 +t+1 t 9+3+1 13 t2 + t + 1 ... Date Added: 2009-06-24 08:23:00 |
| quiz4inclass.pdf Path: Elmhurst >> MATH >> 341 Spring, 2009 Description: Math 341 Quiz #4 In-Class Part Name Show all work. Your answers must be fully justi.ed. 1. A tank holds 200 liters of pure water. The water is accidentally contaminated with 15 grams of a chemical. You may assume the chemical adds a negligible amou... Date Added: 2009-06-24 08:23:09 |
| phy251ch25quiz.pdf Path: MNSU >> PHY >> 161 Fall, 2009 Description: PHY 251 University Physics Reading Quiz on Chapter 25 Q1. Give 2 examples of conservative forces February 28, 2001 Name: _ Q2. In the chapter, what is the conventional reference configuration of charges taken to be? Q3. Define 1 Volt in terms of ... Date Added: 2009-06-24 08:23:58 |
| GatewayQuizAns.pdf Path: Southwestern Illinois >> MATH >> 203 Fall, 2009 Description: Answers to the practice Gateway Quiz 1. 2. 3. 4. 5. f \'( x) = 2 x 2 sec 2 x + 4 x tan x f \'( x ) = -6 x sin(3 x 2 ) sec2 ( x ) f \'( x) = 2 x f \'( x ) = 1 x 1 x 1 x x x cos + sin or x cos + sin 4 2 2 2 2 2 2 f \'( x) = cos 2 x - sin 2 x or cos 2 x ... Date Added: 2009-06-24 08:43:09 |
| asg4.pdf Path: National Taiwan University >> SOC >> 703 Fall, 2009 Description: Sociology 703 Advanced Single Equation Techniques ASSIGNMENT 4 Due Monday May 11th by 5:00 pm Bob Kaufman Spring 2009 You have decided to study the causes of state-level income inequality, measured by the gini coefficient of family income. (Note: T... Date Added: 2009-06-24 08:47:06 |
| modeling.pdf Path: Richmond >> MATH >> 211 Fall, 2008 Description: Modeling Data A standard problem in math or science is translating the measurements we make into an actual mathematical formula. Sometimes we have an underlying theory that tells us what form the function is going to take and we just need to determin... Date Added: 2009-06-24 08:48:00 |
| 511f02_topic2.pdf Path: Bethel VA >> MATH >> 411 Fall, 2009 Description: ... Date Added: 2009-06-24 08:49:17 |
| EML28.pdf Path: Université du Québec à Montréal >> R >> 26710 Fall, 2009 Description: CHELLE DE MOTIVATION DANS LES LOISIRS (EML-28) Luc G. Pelletier, Robert J. Vallerand, Marc R. Blais & Nathalie M. Brire, 1991 ATTITUDES FACE TES LOISIRS Indique les loisirs que tu pratiques le plus souvent, et auxquels tu feras rfrence tout au lon... Date Added: 2009-06-24 08:49:34 |
| 3b9b20b8.pdf Path: Wisconsin >> WILL >> 0031 Fall, 2009 Description: ... Date Added: 2009-06-24 08:51:42 |
| 3b9b21f1.pdf Path: Wisconsin >> WILL >> 0031 Fall, 2009 Description: ... Date Added: 2009-06-24 08:51:59 |
| 3b9b24a0.pdf Path: Wisconsin >> WILL >> 0031 Fall, 2009 Description: ... Date Added: 2009-06-24 08:52:23 |
| 4876e9b9.pdf Path: Wisconsin >> WILL >> 0070 Fall, 2009 Description: ... Date Added: 2009-06-24 08:55:29 |
| 4876e92c.pdf Path: Wisconsin >> WILL >> 0070 Fall, 2009 Description: ... Date Added: 2009-06-24 08:55:57 |
| 48775a8c.pdf Path: Wisconsin >> WILL >> 0101 Fall, 2009 Description: ... Date Added: 2009-06-24 08:56:56 |
| 48775a64.pdf Path: Wisconsin >> WILL >> 0101 Fall, 2009 Description: ... Date Added: 2009-06-24 08:57:09 |
| 487733d1.pdf Path: Wisconsin >> WILL >> 0090 Fall, 2009 Description: ... Date Added: 2009-06-24 08:59:47 |
| 487774fd.pdf Path: Wisconsin >> WILL >> 0109 Fall, 2009 Description: ... Date Added: 2009-06-24 09:01:39 |
| 4877248a.pdf Path: Wisconsin >> WILL >> 0086 Fall, 2009 Description: ... Date Added: 2009-06-24 09:05:11 |
| 487789a7.pdf Path: Wisconsin >> WILL >> 0115 Fall, 2009 Description: ... Date Added: 2009-06-24 09:06:46 |
| 3b9acdfe.pdf Path: Wisconsin >> WILL >> 0002 Fall, 2009 Description: ... Date Added: 2009-06-24 09:07:49 |
| 3b9ace9d.pdf Path: Wisconsin >> WILL >> 0002 Fall, 2009 Description: ... Date Added: 2009-06-24 09:08:03 |
| 3b9b3faf.pdf Path: Wisconsin >> WILL >> 0039 Fall, 2009 Description: ... Date Added: 2009-06-24 09:10:06 |
| 10b4.pdf Path: Wisconsin >> WILL >> 0055 Fall, 2009 Description: ... Date Added: 2009-06-24 09:10:13 |
| 10da.pdf Path: Wisconsin >> WILL >> 0055 Fall, 2009 Description: ... Date Added: 2009-06-24 09:10:20 |
| 103b.pdf Path: Wisconsin >> WILL >> 0055 Fall, 2009 Description: ... Date Added: 2009-06-24 09:10:31 |
| 48776a80.pdf Path: Wisconsin >> WILL >> 0106 Fall, 2009 Description: ... Date Added: 2009-06-24 09:12:10 |
| 48776ab1.pdf Path: Wisconsin >> WILL >> 0106 Fall, 2009 Description: ... Date Added: 2009-06-24 09:12:16 |
| 48774eaa.pdf Path: Wisconsin >> WILL >> 0098 Fall, 2009 Description: ... Date Added: 2009-06-24 09:12:40 |
| 48774f2b.pdf Path: Wisconsin >> WILL >> 0098 Fall, 2009 Description: ... Date Added: 2009-06-24 09:13:01 |
| 3b9b44d4.pdf Path: Wisconsin >> WILL >> 0041 Fall, 2009 Description: ... Date Added: 2009-06-24 09:13:28 |
| 3b9b45a1.pdf Path: Wisconsin >> WILL >> 0041 Fall, 2009 Description: ... Date Added: 2009-06-24 09:13:35 |
| 3b9b460a.pdf Path: Wisconsin >> WILL >> 0041 Fall, 2009 Description: ... Date Added: 2009-06-24 09:14:38 |
| 3b9b1e3d.pdf Path: Wisconsin >> WILL >> 0015 Fall, 2009 Description: ... Date Added: 2009-06-24 09:15:15 |
| 3b9b1efd.pdf Path: Wisconsin >> WILL >> 0015 Fall, 2009 Description: ... Date Added: 2009-06-24 09:15:27 |
| 3b9b33ea.pdf Path: Wisconsin >> WILL >> 0036 Fall, 2009 Description: ... Date Added: 2009-06-24 09:16:34 |
| 3b9b338c.pdf Path: Wisconsin >> WILL >> 0036 Fall, 2009 Description: ... Date Added: 2009-06-24 09:17:17 |
| 3b9b359c.pdf Path: Wisconsin >> WILL >> 0036 Fall, 2009 Description: ... Date Added: 2009-06-24 09:17:42 |
| 3b9afab0.pdf Path: Wisconsin >> WILL >> 0009 Fall, 2009 Description: ... Date Added: 2009-06-24 09:20:25 |
| 3b9afc3c.pdf Path: Wisconsin >> WILL >> 0024 Fall, 2009 Description: ... Date Added: 2009-06-24 09:21:30 |
| 4876ed7a.pdf Path: Wisconsin >> WILL >> 0071 Fall, 2009 Description: ... Date Added: 2009-06-24 09:23:27 |
| 3b9acb4e.pdf Path: Wisconsin >> WILL >> 0001 Fall, 2009 Description: ... Date Added: 2009-06-24 09:24:23 |
| 3b9acbae.pdf Path: Wisconsin >> WILL >> 0001 Fall, 2009 Description: ... Date Added: 2009-06-24 09:24:45 |
| 3b9acbd9.pdf Path: Wisconsin >> WILL >> 0001 Fall, 2009 Description: ... Date Added: 2009-06-24 09:24:52 |
| 3b9acc08.pdf Path: Wisconsin >> WILL >> 0001 Fall, 2009 Description: ... Date Added: 2009-06-24 09:25:01 |
| 48770b54.pdf Path: Wisconsin >> WILL >> 0079 Fall, 2009 Description: ... Date Added: 2009-06-24 09:25:57 |
| 48770c0c.pdf Path: Wisconsin >> WILL >> 0079 Fall, 2009 Description: ... Date Added: 2009-06-24 09:26:22 |
| 48770c3f.pdf Path: Wisconsin >> WILL >> 0079 Fall, 2009 Description: ... Date Added: 2009-06-24 09:26:28 |
| 487736a3.pdf Path: Wisconsin >> WILL >> 0091 Fall, 2009 Description: ... Date Added: 2009-06-24 09:26:36 |
| 487738ca.pdf Path: Wisconsin >> WILL >> 0091 Fall, 2009 Description: ... Date Added: 2009-06-24 09:27:19 |
| 320a.pdf Path: Wisconsin >> WILL >> 0065 Fall, 2009 Description: ... Date Added: 2009-06-24 09:29:17 |
| 487720f7.pdf Path: Wisconsin >> WILL >> 0085 Fall, 2009 Description: ... Date Added: 2009-06-24 09:29:51 |
| 487722d2.pdf Path: Wisconsin >> WILL >> 0085 Fall, 2009 Description: ... Date Added: 2009-06-24 09:30:23 |
| 487786bc.pdf Path: Wisconsin >> WILL >> 0114 Fall, 2009 Description: ... Date Added: 2009-06-24 09:31:50 |
| 3b9b41b1.pdf Path: Wisconsin >> WILL >> 0040 Fall, 2009 Description: ... Date Added: 2009-06-24 09:32:53 |
| 3b9b43c0.pdf Path: Wisconsin >> WILL >> 0040 Fall, 2009 Description: ... Date Added: 2009-06-24 09:33:32 |
| 4876ff27.pdf Path: Wisconsin >> WILL >> 0076 Fall, 2009 Description: ... Date Added: 2009-06-24 09:34:31 |
| 48776d76.pdf Path: Wisconsin >> WILL >> 0107 Fall, 2009 Description: ... Date Added: 2009-06-24 09:36:21 |
| 48776dbd.pdf Path: Wisconsin >> WILL >> 0107 Fall, 2009 Description: ... Date Added: 2009-06-24 09:36:30 |
| 487751e5.pdf Path: Wisconsin >> WILL >> 0099 Fall, 2009 Description: ... Date Added: 2009-06-24 09:36:42 |
| 3b9ad965.pdf Path: Wisconsin >> WILL >> 0016 Fall, 2009 Description: ... Date Added: 2009-06-24 09:37:43 |
| 3b9b38d2.pdf Path: Wisconsin >> WILL >> 0037 Fall, 2009 Description: ... Date Added: 2009-06-24 09:39:29 |
| 3b9b39d2.pdf Path: Wisconsin >> WILL >> 0037 Fall, 2009 Description: ... Date Added: 2009-06-24 09:39:46 |
| 3b9b376a.pdf Path: Wisconsin >> WILL >> 0037 Fall, 2009 Description: ... Date Added: 2009-06-24 09:39:56 |
| 11e0.pdf Path: Wisconsin >> WILL >> 0056 Fall, 2009 Description: ... Date Added: 2009-06-24 09:40:28 |
| 3b9af5ca.pdf Path: Wisconsin >> WILL >> 0008 Fall, 2009 Description: ... Date Added: 2009-06-24 09:42:15 |
| 48771e41.pdf Path: Wisconsin >> WILL >> 0084 Fall, 2009 Description: ... Date Added: 2009-06-24 09:45:37 |
| 48778fd6.pdf Path: Wisconsin >> WILL >> 0117 Fall, 2009 Description: ... Date Added: 2009-06-24 09:46:34 |
| 48778fdd.pdf Path: Wisconsin >> WILL >> 0117 Fall, 2009 Description: ... Date Added: 2009-06-24 09:46:35 |
| 3b9b5d86.pdf Path: Wisconsin >> WILL >> 0048 Fall, 2009 Description: ... Date Added: 2009-06-24 09:46:55 |
| 3b9b5e1f.pdf Path: Wisconsin >> WILL >> 0048 Fall, 2009 Description: ... Date Added: 2009-06-24 09:47:14 |
| 2e1d.pdf Path: Wisconsin >> WILL >> 0064 Fall, 2009 Description: ... Date Added: 2009-06-24 09:48:55 |
| 2ea0.pdf Path: Wisconsin >> WILL >> 0064 Fall, 2009 Description: ... Date Added: 2009-06-24 09:49:24 |
| 2ec7.pdf Path: Wisconsin >> WILL >> 0064 Fall, 2009 Description: ... Date Added: 2009-06-24 09:49:32 |
| 48773b36.pdf Path: Wisconsin >> WILL >> 0092 Fall, 2009 Description: ... Date Added: 2009-06-24 09:51:02 |
| 3b9b5b04.pdf Path: Wisconsin >> WILL >> 0047 Fall, 2009 Description: ... Date Added: 2009-06-24 09:52:04 |
| 48779a1f.pdf Path: Wisconsin >> WILL >> 0120 Fall, 2009 Description: ... Date Added: 2009-06-24 09:52:59 |
| 48779b8a.pdf Path: Wisconsin >> WILL >> 0120 Fall, 2009 Description: ... Date Added: 2009-06-24 09:53:54 |
| 48779b48.pdf Path: Wisconsin >> WILL >> 0120 Fall, 2009 Description: ... Date Added: 2009-06-24 09:54:03 |
| 48779b94.pdf Path: Wisconsin >> WILL >> 0120 Fall, 2009 Description: ... Date Added: 2009-06-24 09:54:11 |
| 487703a8.pdf Path: Wisconsin >> WILL >> 0077 Fall, 2009 Description: ... Date Added: 2009-06-24 09:54:44 |
| 487703e2.pdf Path: Wisconsin >> WILL >> 0077 Fall, 2009 Description: ... Date Added: 2009-06-24 09:54:55 |
| 487763cd.pdf Path: Wisconsin >> WILL >> 0104 Fall, 2009 Description: ... Date Added: 2009-06-24 09:56:27 |
| 3b9af0c1.pdf Path: Wisconsin >> WILL >> 0007 Fall, 2009 Description: ... Date Added: 2009-06-24 09:57:41 |
| 3b9af1d3.pdf Path: Wisconsin >> WILL >> 0007 Fall, 2009 Description: ... Date Added: 2009-06-24 09:58:02 |
| 3b9b0ec1.pdf Path: Wisconsin >> WILL >> 0026 Fall, 2009 Description: ... Date Added: 2009-06-24 09:59:23 |
| 3b9b0eee.pdf Path: Wisconsin >> WILL >> 0026 Fall, 2009 Description: ... Date Added: 2009-06-24 09:59:26 |
| 14e1.pdf Path: Wisconsin >> WILL >> 0057 Fall, 2009 Description: ... Date Added: 2009-06-24 09:59:58 |
| 16eb.pdf Path: Wisconsin >> WILL >> 0057 Fall, 2009 Description: ... Date Added: 2009-06-24 10:00:37 |
| 162f.pdf Path: Wisconsin >> WILL >> 0057 Fall, 2009 Description: ... Date Added: 2009-06-24 10:01:14 |
| 48777b6d.pdf Path: Wisconsin >> WILL >> 0111 Fall, 2009 Description: ... Date Added: 2009-06-24 10:01:46 |
| 38ab.pdf Path: Wisconsin >> WILL >> 0067 Fall, 2009 Description: ... Date Added: 2009-06-24 10:03:45 |
| 39e2.pdf Path: Wisconsin >> WILL >> 0067 Fall, 2009 Description: ... Date Added: 2009-06-24 10:04:18 |
| 48771b04.pdf Path: Wisconsin >> WILL >> 0083 Fall, 2009 Description: ... Date Added: 2009-06-24 10:05:41 |
| 48771b9f.pdf Path: Wisconsin >> WILL >> 0083 Fall, 2009 Description: ... Date Added: 2009-06-24 10:05:49 |
| 3b9b2d51.pdf Path: Wisconsin >> WILL >> 0034 Fall, 2009 Description: ... Date Added: 2009-06-24 10:09:23 |
| 48773de6.pdf Path: Wisconsin >> WILL >> 0093 Fall, 2009 Description: ... Date Added: 2009-06-24 10:10:12 |
| 48773e48.pdf Path: Wisconsin >> WILL >> 0093 Fall, 2009 Description: ... Date Added: 2009-06-24 10:10:38 |
| 487765c7.pdf Path: Wisconsin >> WILL >> 0105 Fall, 2009 Description: ... Date Added: 2009-06-24 10:11:23 |
| 3b9ae33d.pdf Path: Wisconsin >> WILL >> 0018 Fall, 2009 Description: ... Date Added: 2009-06-24 10:13:30 |
| 3b9b56e3.pdf Path: Wisconsin >> WILL >> 0046 Fall, 2009 Description: ... Date Added: 2009-06-24 10:14:00 |
| 3b9b66b8.pdf Path: Wisconsin >> WILL >> 0050 Fall, 2009 Description: ... Date Added: 2009-06-24 10:15:46 |
| 48779d5b.pdf Path: Wisconsin >> WILL >> 0121 Fall, 2009 Description: ... Date Added: 2009-06-24 10:17:51 |
| 48779e6b.pdf Path: Wisconsin >> WILL >> 0121 Fall, 2009 Description: ... Date Added: 2009-06-24 10:18:40 |
| 4876f9a7.pdf Path: Wisconsin >> WILL >> 0074 Fall, 2009 Description: ... Date Added: 2009-06-24 10:19:28 |
| 4876f9e1.pdf Path: Wisconsin >> WILL >> 0074 Fall, 2009 Description: ... Date Added: 2009-06-24 10:19:39 |
| 4876f86f.pdf Path: Wisconsin >> WILL >> 0074 Fall, 2009 Description: ... Date Added: 2009-06-24 10:20:05 |
| 1a95.pdf Path: Wisconsin >> WILL >> 0058 Fall, 2009 Description: ... Date Added: 2009-06-24 10:20:54 |
| 1b64.pdf Path: Wisconsin >> WILL >> 0058 Fall, 2009 Description: ... Date Added: 2009-06-24 10:21:38 |
| 1bd7.pdf Path: Wisconsin >> WILL >> 0058 Fall, 2009 Description: ... Date Added: 2009-06-24 10:21:56 |
| 3b9ae988.pdf Path: Wisconsin >> WILL >> 0006 Fall, 2009 Description: ... Date Added: 2009-06-24 10:22:48 |
| 3b9aee85.pdf Path: Wisconsin >> WILL >> 0021 Fall, 2009 Description: ... Date Added: 2009-06-24 10:24:25 |
| 3b9aeef3.pdf Path: Wisconsin >> WILL >> 0021 Fall, 2009 Description: ... Date Added: 2009-06-24 10:24:38 |
| 3b9aef48.pdf Path: Wisconsin >> WILL >> 0021 Fall, 2009 Description: ... Date Added: 2009-06-24 10:24:57 |
| 487716e7.pdf Path: Wisconsin >> WILL >> 0082 Fall, 2009 Description: ... Date Added: 2009-06-24 10:26:48 |
| 487740cb.pdf Path: Wisconsin >> WILL >> 0094 Fall, 2009 Description: ... Date Added: 2009-06-24 10:28:17 |
| 487743fc.pdf Path: Wisconsin >> WILL >> 0094 Fall, 2009 Description: ... Date Added: 2009-06-24 10:29:19 |
| 3b9afc9f.pdf Path: Wisconsin >> WILL >> 0010 Fall, 2009 Description: ... Date Added: 2009-06-24 10:30:13 |
| 3b9afcf1.pdf Path: Wisconsin >> WILL >> 0010 Fall, 2009 Description: ... Date Added: 2009-06-24 10:30:37 |
| 3b9b31c4.pdf Path: Wisconsin >> WILL >> 0035 Fall, 2009 Description: ... Date Added: 2009-06-24 10:32:07 |
| 3b9b1aa8.pdf Path: Wisconsin >> WILL >> 0029 Fall, 2009 Description: ... Date Added: 2009-06-24 10:33:06 |
| 4876fb0e.pdf Path: Wisconsin >> WILL >> 0075 Fall, 2009 Description: ... Date Added: 2009-06-24 10:34:25 |
| 48775b82.pdf Path: Wisconsin >> WILL >> 0102 Fall, 2009 Description: ... Date Added: 2009-06-24 10:36:44 |
| 3b9ae4f9.pdf Path: Wisconsin >> WILL >> 0019 Fall, 2009 Description: ... Date Added: 2009-06-24 10:37:36 |
| 3b9ae78e.pdf Path: Wisconsin >> WILL >> 0019 Fall, 2009 Description: ... Date Added: 2009-06-24 10:38:53 |
| 3e36.pdf Path: Wisconsin >> WILL >> 0069 Fall, 2009 Description: ... Date Added: 2009-06-24 10:39:46 |
| 3e53.pdf Path: Wisconsin >> WILL >> 0069 Fall, 2009 Description: ... Date Added: 2009-06-24 10:39:50 |
| 2262fall01test2 Path: LSU >> CHEM 2364 >> chem 2364 Spring, 2009 Description: 34 Chem 2262 October-22nd-2001 Test 2 Name:_ Last Name, First Name The exam has 6 printed pages of questions and 3 tables. Check now to make sure you have all 8 questions and 9 total pages. Put all answers on these sheets. The exam is worth a total ... Date Added: 2009-06-24 10:41:36 |
| 23e7.pdf Path: Wisconsin >> WILL >> 0061 Fall, 2009 Description: ... Date Added: 2009-06-24 10:42:50 |
| 24a6.pdf Path: Wisconsin >> WILL >> 0061 Fall, 2009 Description: ... Date Added: 2009-06-24 10:42:56 |
| 24fa.pdf Path: Wisconsin >> WILL >> 0061 Fall, 2009 Description: ... Date Added: 2009-06-24 10:43:12 |
| 3b9add4f.pdf Path: Wisconsin >> WILL >> 0005 Fall, 2009 Description: ... Date Added: 2009-06-24 10:47:11 |
| 3b9ae8f7.pdf Path: Wisconsin >> WILL >> 0020 Fall, 2009 Description: ... Date Added: 2009-06-24 10:47:57 |
| 3b9b543a.pdf Path: Wisconsin >> WILL >> 0045 Fall, 2009 Description: ... Date Added: 2009-06-24 10:51:55 |
| 487798ae.pdf Path: Wisconsin >> WILL >> 0119 Fall, 2009 Description: ... Date Added: 2009-06-24 10:52:56 |
| 487745d7.pdf Path: Wisconsin >> WILL >> 0095 Fall, 2009 Description: ... Date Added: 2009-06-24 10:53:27 |
| 487747cb.pdf Path: Wisconsin >> WILL >> 0095 Fall, 2009 Description: ... Date Added: 2009-06-24 10:54:01 |
| 3b9b004b.pdf Path: Wisconsin >> WILL >> 0011 Fall, 2009 Description: ... Date Added: 2009-06-24 10:55:52 |
| 487712df.pdf Path: Wisconsin >> WILL >> 0081 Fall, 2009 Description: ... Date Added: 2009-06-24 10:57:01 |
| 3b9b13af.pdf Path: Wisconsin >> WILL >> 0028 Fall, 2009 Description: ... Date Added: 2009-06-24 10:58:25 |
| 3b9b14e8.pdf Path: Wisconsin >> WILL >> 0028 Fall, 2009 Description: ... Date Added: 2009-06-24 10:58:40 |
| 3b9b141e.pdf Path: Wisconsin >> WILL >> 0028 Fall, 2009 Description: ... Date Added: 2009-06-24 10:59:22 |
| 48772fb4.pdf Path: Wisconsin >> WILL >> 0089 Fall, 2009 Description: ... Date Added: 2009-06-24 11:00:43 |
| 4876f081.pdf Path: Wisconsin >> WILL >> 0072 Fall, 2009 Description: ... Date Added: 2009-06-24 11:02:52 |
| 48775eb1_x1a.pdf Path: Wisconsin >> WILL >> 0103 Fall, 2009 Description: ... Date Added: 2009-06-24 11:03:26 |
| 3af8.pdf Path: Wisconsin >> WILL >> 0068 Fall, 2009 Description: ... Date Added: 2009-06-24 11:04:50 |
| 22c.pdf Path: Wisconsin >> WILL >> 0052 Fall, 2009 Description: ... Date Added: 2009-06-24 11:07:24 |
| 1f7d.pdf Path: Wisconsin >> WILL >> 0060 Fall, 2009 Description: ... Date Added: 2009-06-24 11:07:36 |
| 20ca.pdf Path: Wisconsin >> WILL >> 0060 Fall, 2009 Description: ... Date Added: 2009-06-24 11:08:18 |
| 20d0.pdf Path: Wisconsin >> WILL >> 0060 Fall, 2009 Description: ... Date Added: 2009-06-24 11:08:19 |
| 3b9b2b4f.pdf Path: Wisconsin >> WILL >> 0033 Fall, 2009 Description: ... Date Added: 2009-06-24 11:12:44 |
| 3b9b28bd.pdf Path: Wisconsin >> WILL >> 0033 Fall, 2009 Description: ... Date Added: 2009-06-24 11:13:21 |
| 3b9b4fb1.pdf Path: Wisconsin >> WILL >> 0044 Fall, 2009 Description: ... Date Added: 2009-06-24 11:14:02 |
| 3b9ad5de.pdf Path: Wisconsin >> WILL >> 0004 Fall, 2009 Description: ... Date Added: 2009-06-24 11:18:24 |
| 3b9af77a.pdf Path: Wisconsin >> WILL >> 0023 Fall, 2009 Description: ... Date Added: 2009-06-24 11:20:49 |
| 3b9af95f.pdf Path: Wisconsin >> WILL >> 0023 Fall, 2009 Description: ... Date Added: 2009-06-24 11:21:02 |
| 3b9af717.pdf Path: Wisconsin >> WILL >> 0023 Fall, 2009 Description: ... Date Added: 2009-06-24 11:21:14 |
| 48770f26.pdf Path: Wisconsin >> WILL >> 0080 Fall, 2009 Description: ... Date Added: 2009-06-24 11:23:49 |
| 48770fed.pdf Path: Wisconsin >> WILL >> 0080 Fall, 2009 Description: ... Date Added: 2009-06-24 11:24:18 |
| 4cd.pdf Path: Wisconsin >> WILL >> 0053 Fall, 2009 Description: ... Date Added: 2009-06-24 11:24:44 |
| 7df.pdf Path: Wisconsin >> WILL >> 0053 Fall, 2009 Description: ... Date Added: 2009-06-24 11:25:44 |
| 48772bc3.pdf Path: Wisconsin >> WILL >> 0088 Fall, 2009 Description: ... Date Added: 2009-06-24 11:27:17 |
| 4876f5be.pdf Path: Wisconsin >> WILL >> 0073 Fall, 2009 Description: ... Date Added: 2009-06-24 11:28:56 |
| 3b9b4c21.pdf Path: Wisconsin >> WILL >> 0043 Fall, 2009 Description: ... Date Added: 2009-06-24 11:30:51 |
| 3b9b4cf1.pdf Path: Wisconsin >> WILL >> 0043 Fall, 2009 Description: ... Date Added: 2009-06-24 11:31:20 |
| 3b9b4d1f.pdf Path: Wisconsin >> WILL >> 0043 Fall, 2009 Description: ... Date Added: 2009-06-24 11:31:27 |
| 2a8d.pdf Path: Wisconsin >> WILL >> 0063 Fall, 2009 Description: ... Date Added: 2009-06-24 11:31:39 |
| 2ac1.pdf Path: Wisconsin >> WILL >> 0063 Fall, 2009 Description: ... Date Added: 2009-06-24 11:31:56 |
| 2c9b.pdf Path: Wisconsin >> WILL >> 0063 Fall, 2009 Description: ... Date Added: 2009-06-24 11:33:08 |
| 487756cd.pdf Path: Wisconsin >> WILL >> 0100 Fall, 2009 Description: ... Date Added: 2009-06-24 11:33:36 |
| 3b9b1d69.pdf Path: Wisconsin >> WILL >> 0030 Fall, 2009 Description: ... Date Added: 2009-06-24 11:34:09 |
| 3b9b1d93.pdf Path: Wisconsin >> WILL >> 0030 Fall, 2009 Description: ... Date Added: 2009-06-24 11:34:12 |
| 3b9b1db9.pdf Path: Wisconsin >> WILL >> 0030 Fall, 2009 Description: ... Date Added: 2009-06-24 11:34:18 |
| 3b9b1f9c.pdf Path: Wisconsin >> WILL >> 0030 Fall, 2009 Description: ... Date Added: 2009-06-24 11:35:04 |
| 48776fa2.pdf Path: Wisconsin >> WILL >> 0108 Fall, 2009 Description: ... Date Added: 2009-06-24 11:37:14 |
| 3b9b0a2c.pdf Path: Wisconsin >> WILL >> 0013 Fall, 2009 Description: ... Date Added: 2009-06-24 11:37:54 |
| 3b9b0733.pdf Path: Wisconsin >> WILL >> 0013 Fall, 2009 Description: ... Date Added: 2009-06-24 11:38:59 |
| 3b9b0770.pdf Path: Wisconsin >> WILL >> 0013 Fall, 2009 Description: ... Date Added: 2009-06-24 11:39:04 |
| 3b9b0855.pdf Path: Wisconsin >> WILL >> 0013 Fall, 2009 Description: ... Date Added: 2009-06-24 11:39:20 |
| 3b9b3b97.pdf Path: Wisconsin >> WILL >> 0038 Fall, 2009 Description: ... Date Added: 2009-06-24 11:40:22 |
| HW_08.pdf Path: ASU >> FOUCH >> 419 Fall, 2009 Description: GLG419/598J: Geodynamics Professor Matt Fouch HOMEWORK #8 DUE: 11/02/2004 (75 points) Earthquake magnitudes 8-1. 8-2. 8-3. Compute the energy released from an mb=6.0 earthquake. How does this compare with the energy released from an mb=7.0 earthqua... Date Added: 2009-06-24 11:41:34 |
| 48772a89.pdf Path: Wisconsin >> WILL >> 0087 Fall, 2009 Description: ... Date Added: 2009-06-24 11:41:41 |
| 487727e4.pdf Path: Wisconsin >> WILL >> 0087 Fall, 2009 Description: ... Date Added: 2009-06-24 11:42:14 |
| 487729d3.pdf Path: Wisconsin >> WILL >> 0087 Fall, 2009 Description: ... Date Added: 2009-06-24 11:42:48 |
| 48777f6a.pdf Path: Wisconsin >> WILL >> 0112 Fall, 2009 Description: ... Date Added: 2009-06-24 11:43:58 |
| 48777fc1.pdf Path: Wisconsin >> WILL >> 0112 Fall, 2009 Description: ... Date Added: 2009-06-24 11:44:24 |
| 48777fd5.pdf Path: Wisconsin >> WILL >> 0112 Fall, 2009 Description: ... Date Added: 2009-06-24 11:44:27 |
| 3b9ad2d5.pdf Path: Wisconsin >> WILL >> 0003 Fall, 2009 Description: ... Date Added: 2009-06-24 11:45:20 |
| 3b9ad40f.pdf Path: Wisconsin >> WILL >> 0003 Fall, 2009 Description: ... Date Added: 2009-06-24 11:46:09 |
| 3b9af3e1.pdf Path: Wisconsin >> WILL >> 0022 Fall, 2009 Description: ... Date Added: 2009-06-24 11:46:40 |
| 3b9af3ee.pdf Path: Wisconsin >> WILL >> 0022 Fall, 2009 Description: ... Date Added: 2009-06-24 11:46:42 |
| 971.pdf Path: Wisconsin >> WILL >> 0054 Fall, 2009 Description: ... Date Added: 2009-06-24 11:48:37 |
| 3b9b4ac6.pdf Path: Wisconsin >> WILL >> 0042 Fall, 2009 Description: ... Date Added: 2009-06-24 11:49:59 |
| 3b9b4af1.pdf Path: Wisconsin >> WILL >> 0042 Fall, 2009 Description: ... Date Added: 2009-06-24 11:50:06 |
| 3b9b4b00.pdf Path: Wisconsin >> WILL >> 0042 Fall, 2009 Description: ... Date Added: 2009-06-24 11:50:09 |
| 3b9b48a0.pdf Path: Wisconsin >> WILL >> 0042 Fall, 2009 Description: ... Date Added: 2009-06-24 11:50:50 |
| exam1PracticeSolutions.pdf Path: SUNY Stony Brook >> PHY >> 122 Spring, 2008 Description: ~ p i i x| T c o x T v T x w u s i jw u o p i v s p6QR@xTv i R#7R6@IEYSeR#7@!T% 2 57 S 7 ! 5 $ $ D ! ! ! 2 $f $ U ! q p eGG)@!Ru0%R#7@!H6% ... Date Added: 2009-06-24 11:50:58 |
| notes19.pdf Path: Pima CC >> PHY >> 121 Fall, 2008 Description: Work and Energy The kinetic energy of an object of mass m and speed v is KE = 1 mv 2 2 The gravitational potential energy of an object at height h is PE = mgh The mechanical energy E of the object is the sum of the kinetic energy and the potential e... Date Added: 2009-06-24 11:51:25 |
| YHL007C.t04.dssp-ebghstl-logo.pdf Path: UCSC >> YHL >> 007 Fall, 2009 Description: YHL007C.t04 dssp-ebghstl 3 2 1 CC C T T B X T C H S T CEEHTTHHTES H HGTTGG S H C HCGCCETTSCHTT S T S S E T H T CSCGTXETEXTEEXSX C GSXTXS H G E T S E C C E C S E B G T S E E G B C S S S X X X X X X X X X X XXXXXXXXXCXCXHXSXBXXXEXSSSETEXXXSXC X X X ... Date Added: 2009-06-24 11:52:22 |
| L28.pdf Path: SUNY Stony Brook >> PHY >> 131 Fall, 2008 Description: Physics 131, Lecture 28 Abhay Deshpande Heat and Temperature ... Date Added: 2009-06-24 11:53:03 |
| 5.4prac.pdf Path: SWCCD >> MATH >> 244 Fall, 2009 Description: \" \" ! \" ! \" ! ! \" # # # # # # # $ $ $ $ $ $ $ # $ \' ( ) ! % % \' ( ) ! $ + % \' ( ) ! + # !, ( #! - . / ) 0 ! 1&-2 $ $ $ $ % ! ! ! ! 3 33 3 34 33 333 3 333 5 ... Date Added: 2009-06-24 11:53:30 |
| mips_summary.pdf Path: Allan Hancock College >> CS >> 1021 Fall, 2009 Description: The MIPS Info Sheet MIPS Instructions Arithmetic/Logic sub Rdest, Rsrc1, Src2 Subtract (with overflow) Put the difference of the integers from register Rsrc1 and Src2 into register Rdest. xor Rdest, Rsrc1, Src2 XOR Put the logical XOR of the integer... Date Added: 2009-06-24 11:53:56 |
| hw_1.pdf Path: Sinclair CC >> DEV >> 108 Fall, 2009 Description: DEV 108 HW #1 Whole Numbers, Expressions & Simple Equations Name _ Date _ Class_ Directions: Read and evaluate each problem. Show your work on a separate sheet of paper and attach it to the back of this one. You must show your work to get credit. ... Date Added: 2009-06-24 11:55:02 |
| phy232_lec7.pdf Path: Tennessee >> PHY >> 232 Fall, 2009 Description: ... Date Added: 2009-06-24 11:57:49 |
| CHP_6_C.pdf Path: Cincinnati >> ENFD >> 382 Fall, 2008 Description: The Second Law of Thermodynamics and Thermal Energy Reservoirs 6-1C Water is not a fuel; thus the claim is false. 6-2C Transferring 5 kWh of heat to an electric resistance wire and producing 5 kWh of electricity. 6-3C An electric resistance heater wh... Date Added: 2009-06-24 11:58:05 |
| YMR196W.t2k.dssp-ehl2-logo.pdf Path: UCSC >> YMR >> 196 Fall, 2009 Description: YMR196W.t2k DSSP-EHL2 2 1 CC X C H C C C H X X X X X X X H H H C C C X X C C X C X X X X X X X X X X HH CCHHHHC H C H C C C C C C C C C C H H X X HHHHHH CC X X X X X H H X X C X CX C X C C X X CCXC C X X E E E H X X X X X X X X X X X... Date Added: 2009-06-24 11:59:12 |
| YMR192W.t2k.dssp-ehl2-logo.pdf Path: UCSC >> YMR >> 192 Fall, 2009 Description: YMR192W.t2k DSSP-EHL2 2 1 CC 1 C C E E H H E E C E H H X X X X X X X X X X X X X X X X X X 10 20 30 40 T 2 1 E T H H T C C C C C C C H H H C H H H H H H H H H H X X X X X X X X X X X X X X X X X X X X X X CC C CCCCCCCCCCC X X X CCCCCCC... Date Added: 2009-06-24 11:59:14 |
| YMR167W.t2k.CB_burial_14_7-logo.pdf Path: UCSC >> YMR >> 167 Fall, 2009 Description: YMR167W.t2k CB_BURIAL_14_7 2 1 10 20 30 40 A 2 1 B D B D A E D E F G F E G F E F E D F E F B A E D B D D B E D F D E B A AB B F BA C E A C C CB D D C X A B D D D X X X X X X D C E E E D E D F XXX D B X X C C C BDCC CCEEC EE E E... Date Added: 2009-06-24 11:59:35 |
| YMR146C.t2k.str2-logo.pdf Path: UCSC >> YMR >> 146 Fall, 2009 Description: YMR146C.t2k STR2 5 4 3 2 1 CC 1 10 20 30 40 Z Y 5 4 3 2 1 T S Z Y A Z T S Z A Z T S Z A Z T S Z E Y Z Y Z T CCCS Z M ZSS TCYZZYCC TCZZZM Z STTZYC Y T Z A YX CS MYYXSXCXXYYY C MMM C M X XXXSX X Y Z T S G E ZYZ SSCCA X X AZCTTS A A... Date Added: 2009-06-24 11:59:37 |
| 09.txt Path: CSU San Bernardino >> CS >> 646 Fall, 2009 Description: .Open 09 . Schedule .Table Date .Item Meet\'g .Item $Study(2 pts) .Item Bring(5 pts) .Item $Topic(5 pts) .Item Notes .Row Wed Apr 26 .Item 8 .Item Chapter 8 section 8.7+Minsky .Item $Ex .Item The Halting Problem .Item Start $Project .Row Mon May 1 .I... Date Added: 2009-06-24 12:03:24 |
| 06Playfair.pdf Path: St. Xavier >> MATH >> 316 Spring, 2009 Description: The Playfair cipher 1 The Playfair cipher Sir Charles Wheatstone devised the following cipher system in 1896; it was named for his friend, Lord Lyon Playfair, who popularized its use. Rather than encrypting letter by letter, the plaintext is sepa... Date Added: 2009-06-24 12:06:57 |
| Lesson12.ppt Path: CSU Fullerton >> INT >> 222 Fall, 2009 Description: vti_encoding:SR|utf8-nl vti_timelastmodified:TR|19 Jul 2002 17:32:00 -0000 vti_extenderversion:SR|4.0.2.4426 vti_filesize:IR|364032 vti_title:SR|Cascading Style Sheets (CSS) vti_backlinkinfo:VX| vti_cacheddtm:TX|19 Jul 2002 17:32:00 -0000 vti_cachedl... Date Added: 2009-06-24 12:07:19 |
| 0716west.xls Path: Maryland >> JULY >> 1620 Fall, 2009 Description: 160 140 120 100 80 60 So. Carroll Frederick Long Park Ashburn Roanoke Rest Natural Bridge Little Buffalo Methodist Hill 40 20 0 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 120 100 80 60 Long Park Ashburn Roanoke Rest Natural Brid... Date Added: 2009-06-24 12:10:18 |
| unit_tests.txt Path: Carnegie Mellon >> ECE >> 649 Fall, 2009 Description: ;there is only one test in the sample file. Your file shall contain all tests. DoorControl doorcontrol.cf doorcontrol_test1.mf ... Date Added: 2009-06-24 12:10:32 |
| a8.pdf Path: Wisc Stevens Point >> MATH >> 357 Fall, 2009 Description: Math 357/557 Spring 2009 - Assignment #8 Due: Friday, April 3 20 points Announcement: Test 2 will NOT be on April 3 1. Pages 494 - 495, problems 10.2, 10.6, 10.7, 10.8 (2 points each) 2. Pages 501 - 508, problems 10.9, 10.10, 10.11, 10.12 - just ans... Date Added: 2009-06-24 12:12:55 |
| MODULE_11_Identity.doc Path: Allan Hancock College >> COMM >> 11005 Fall, 2009 Description: #e4D#MODULE_11_Identity.doc# #Wu/~{6-l #cdK$XF#K#bzvU #@02#b6#^p#^B#d%#0$!yla !`#;[KOwKM0dj33Uus={#%r]z w=%J=? 9#s}=O#W<09#Tjn G/Z1Dy}\'*r \'o3G\\?oNNJ%=#>;SX(k#| #<[? JV]%/#k#/^G{#z#}#Ssj#^_z{g#v,U Hko/Sy[n#l9b\\W(?#wllOd^f= LstT.X{tv][+CEn4... Date Added: 2009-06-24 12:14:58 |
| hw3.pdf Path: New Mexico >> MATH >> 510 Fall, 2008 Description: MATH 510 - Introduction to Analysis I Homework # 3 (sequences on metric spaces) The following problems appeared in Qualifying exams in the past. 1. (Qual Aug 1999 # 2) Let {an } be a sequence of real numbers. n=1 (a) Define lim sup an . n (b) Let bn... Date Added: 2009-06-24 12:15:35 |
| studyguide_film_malinowski.pdf Path: Delaware >> ANTH >> 101 Fall, 2008 Description: Strangers Abroad: Bronislaw Malinowski Film Study Guide What is the significance of Sir James George Frazer\'s 1922 book entitled The Golden Bough? Where are the Trobriand Islands? When did Malinowski arrive in the Trobriand Islands? How long did he s... Date Added: 2009-06-24 12:16:15 |
| section21.pdf Path: ASU >> STAT >> 371 Fall, 2009 Description: 21. Series of functions Exercise 21.1. Prove that with 0 < s < 1. n=0 xn converges uniformly on every interval of the form [-s, s] Exercise 21.2. Find an example of a series of functions which converges uniformly on R but does not satisfy the hypo... Date Added: 2009-06-24 12:23:02 |
| change.pdf Path: ASU >> STAT >> 371 Fall, 2009 Description: CHANGE OF VARIABLES JOHN QUIGG Change of Variables Theorem. If : [a, b] R is dierentiable, is integrable, and f : [a, b] R is continuous, then b (b) f (x) (x) dx = a (a) f (u) du. Proof. Since is dierentiable, it is continuous, so [a, b] i... Date Added: 2009-06-24 12:23:28 |
| 04.pdf Path: ASU >> STAT >> 472 Fall, 2009 Description: MAT 472 EXERCISES JOHN QUIGG 4. Countability Exercise 4.1. Prove that every innite subset of N is unbounded above. Exercise 4.2. A real number is algebraic if its a root of a polynomial with integer coecients. Prove that the set of all algebraic num... Date Added: 2009-06-24 12:25:01 |
| 027_Intro_to_Poly.pdf Path: Harford CC >> MATH >> 018 Fall, 2009 Description: 3/2/2009 Introduction to Polynomials MATH 018 Combined Algebra S. Rook Overview Section 5.3 in the textbook: Polynomial terminology Evaluating polynomials for a given value Simplifying polynomials 2 Polynomial Terminology 3 1 3/2/2009 Pol... Date Added: 2009-06-24 12:40:59 |
| m00dsn0l1a_opt_041391512_00.txt Path: Washington University in St. Louis >> MEXMRS >> 0046 Fall, 2009 Description: $MEX ORBIT PROPAGATION AND TIMING GEOMETRY FILE v002 * OPTG optg_mex_040511-040707.txt * TITLE 2004 Mars Express Mapping: OPTG File * CREATION JPL 04-MAY-11/14:16:18 * BEGIN SCE 04-MAY-11/00:00:00.000 * CUTOFF SCE 04-JUL-... Date Added: 2009-06-24 12:41:16 |
| 9.pdf Path: Great Lakes >> BIO >> 228 Fall, 2009 Description: Arthoses (Joints) Objectives 1. Describe the three structure types of joints and give examples. 2. Describe the three types of functional joints and give examples 3. List and give functions of structures associated with joints. 4. Describe important ... Date Added: 2009-06-24 12:45:37 |
| CH5sug.pdf Path: National Taiwan University >> BIO >> 113 Fall, 2009 Description: Ch. 5 - The Structure and Function of Macromolecules Polymer principles Carbohydrates - fuel and building materials Proteins - the molecular tools of the cell Nucleic acids - informational polymers Lipids - diverse hydrophobic molecules Polymer... Date Added: 2009-06-24 12:46:56 |
| 09Post.pdf Path: SUNY Stony Brook >> CHE >> 133 Fall, 2008 Description: 11/5/2008 Strength of Vinegar by AcidAcid-Base Titration Final Exercise 105 points Strong/Weak Acids Concentration Titration curves Indicator pH & pKa Techniques: Concepts: From last week Primary Standard Acid Dissociation/Ka End point / Equiv... Date Added: 2009-06-24 12:47:13 |
| de geus.pdf Path: Allan Hancock College >> IMS >> 5042 Fall, 2009 Description: Digitised by Monash University Library COMMONWEALTH OF AUSTRALIA Copyright Regulations 1969 WARNING This material has been reproduced and communicated to you by or on behalf of Monash University pursuant to Part VB of the Copyright Act 1968 (the Act... Date Added: 2009-06-24 13:08:59 |
| rprogrampart2.txt Path: UNC >> BIOL >> 145 Fall, 2008 Description: meandiff.errbar.plot<-function(listvals,alpha) { #subset data based on codes requested by parsing subs1<-splityear[eval(parse(text=paste(\"fulldata$CHISSpCode=\'\",listvals,\"\'\",sep=\",collapse=\"|\"),] #Generate paired differences coverdiff<-subs1$\"xx ... Date Added: 2009-06-24 13:12:55 |
| YNL028W.t2k.dssp-ehl2-logo.pdf Path: UCSC >> YNL >> 028 Fall, 2009 Description: YNL028W.t2k DSSP-EHL2 1 C X C X H C X X H H H H H E X X X X X X X C C H H E E H C H C H CC H CEHH C C H H X X X X EE EEEE C C X H X EHHEEEHHHH H HHH X EE E C C C C C H C C C X X X X X X X E C E X X X HHHHH C H C H C X X X X X H H X... Date Added: 2009-06-24 13:16:13 |
| YNL025C.t2k.CB_burial_14_7-logo.pdf Path: UCSC >> YNL >> 025 Fall, 2009 Description: YNL025C.t2k CB_BURIAL_14_7 3 2 1 AAAA X 1 10 20 30 40 A 3 2 1 AA AAAA BBBBBBBB X X X X X X X X E D E B A B D A E B A D A B E D A E B A D E B D A B D B A D A A B B B C C C C C C C C C C C D D D D D D D D D D D 51 60 70 80 90 D B 3... Date Added: 2009-06-24 13:16:32 |
| ISDS+Resume+5.pdf Path: LSU >> APPL >> 003 Fall, 2008 Description: Sample Rsum - Information Systems and Decision Sciences 225 5781548 career@lsu.edu www.lsu.edu/career Michelle T. Tiger 123 Tiger Town Baton Rouge, Louisiana 70803 (225) 578-3202 mtiger5@lsu.edu OBJECTIVE To obtain an Information Systems and ... Date Added: 2009-06-24 13:17:44 |
| Friday February 22.doc Path: St. Francis IL >> X >> 467 Fall, 2009 Description: Joe Alkerton 22/02/08 Children of the Net There is little doubt concerning the validity of computers in the classroom. However, with many of mans great inventions there are insidious issues lurking in the shadows. Yes, there we now have students who... Date Added: 2009-06-24 13:22:37 |
| hw28a.pdf Path: Arizona >> CHEE >> 201 Fall, 2008 Description: 7.33 (a) P = 5 bar Table B.6 Tsaturation = 1518 o C . At 75C the discharge is all liquid . Table B.7 (b) Inlet: T=350C, P=40 bar H in = 3095 kJ / kg , Vin = 0.0665 m 3 / kg H out = 314.3 kJ / kg , Vout = 1.03 10 -3 m 3 / kg Outlet: T=75C, P=5 b... Date Added: 2009-06-24 13:22:44 |
| YKL048C.t2k.alpha-logo.pdf Path: UCSC >> YKL >> 048 Fall, 2009 Description: YKL048C.t2k ALPHA 3 2 1 XXXXXEEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX XX B B C C E B B B B E E E E E E B B E E C C C B B B B BB B B C B B E B H B E B B E E B B B E B B C B B B B B B B B B B B H H H H H H H H X X X X X X X X X B B 1 1... Date Added: 2009-06-24 13:25:26 |
| tc2.txt Path: Allan Hancock College >> MATHS >> 2030 Fall, 2009 Description: \\documentclass[12pt]{article} \\usepackage{times} % for type-1 font ? \\usepackage{soul} \\usepackage[screen,nopanel,sectionbreak]{nopanel} \\margins{.5in}{.5in}{.2in}{.5in} \\screensize{6.25in}{8in} \\bottombuttons \\hypersetup{pdfcenterwind... Date Added: 2009-06-24 13:29:34 |
| ldvs.rtf Path: Ohio State >> AEDE >> 801 Fall, 2009 Description: Models with Limited Dependent Variables In this Section the Tobit model is presented. Construct the data in Table 19.2 as follows. First construct X and a vector of 20 N(0,16) random errors. x = ones(20,1)~seqa(1,1,20); t = rows(x); k = cols(x); open... Date Added: 2009-06-24 13:36:56 |
| amd-mmx.pdf Path: Lake County >> ECE >> 390 Fall, 2009 Description: Advance Information AMD-K6 Processor Multimedia Extensions (MMX) Publication # 20726 Issue Date: July 1996 Rev: A Amendment/0 This document contains information on a product under development at Advanced Micro Devices (AMD). The information is i... Date Added: 2009-06-24 13:48:48 |
| Physics123C_L14.ppt Path: Washington >> P >> 123 Fall, 2009 Description: Physics 123C Waves Lectur e 14 Ra yl ei gh Cr i ter i on, I nter fer ometer s M a y 4, 2005 John G. Cramer Professor of Physics B451 PAB cramer@phys.washington.edu Lecture 14 Announcements On Fr i day, M ay 6 we wi l l have Exam 2, cover i ng K ni ... Date Added: 2009-06-24 13:59:12 |
| RizzoniCH14SM_Final.pdf Path: FIU >> RIZZONI >> 3303 Fall, 2009 Description: G. Rizzoni, Principles and Applications of Electrical Engineering Problem solutions, Chapter 14 Chapter 14 Instructor Notes Chapter 14 logically follows the material on combinational digital logic circuits introduced in Chapter 13. Section 14.1 con... Date Added: 2009-06-24 14:05:53 |
| art213_syllabus.pdf Path: Kellogg CC >> ART >> 213 Fall, 2009 Description: INSTRUCTORS NAME: Peter Williams Phone: 965-3931 x2565 Email: williamsp@kellogg.edu Office hours: Mon.-Thurs. 9-10am, Mon.-Wed.1:30-2:30 Davidson Building office TITLE OF COURSE: ART 213, Art History DESCRIPTION OF COURSE: A historical survey of d... Date Added: 2009-06-24 14:06:13 |
| ECE210Lecture30.pdf Path: Lake County >> ECE >> 210 Fall, 2009 Description: ECE 210/211 Lecture 30 Mon., Mar. 16, 2009 Reading Assignment for Tuesday, March 17: Chapter 7, pp. 223-231, Fourier transform of non-periodic signals. Homework Assignments: HW8: Chap. 6, Exercises 1, 4, 5, 6a-c, 7, 8a-d, 9a,10 (due Wed). Reminder: ... Date Added: 2009-06-24 14:16:50 |
| slac-pub-12164.pdf Path: Stanford >> PUBS >> 12000 Fall, 2009 Description: SLAC-PUB-12164 October 2006 Energy Measurements of Trapped Electrons from a Plasma Wakefield Accelerator Neil Kirby1, David Auerbach2, Melissa Berry1, Ian Blumenfeld1, Christopher E. Clayton2, Franz-Josef Decker1, Mark J. Hogan1, Chengkun Huang2, Ra... Date Added: 2009-06-24 14:19:49 |
| Araceae.pdf Path: Iowa State >> BIO >> 366 Fall, 2009 Description: ALISMATALES Araceae Arum Family Terrestrial or aquatic herbs and shrubs; leaves simple, tops different in color or texture from bottoms Flowers many and small, on a spadix with a spathe surrounding Genera to Know: Spathiphyllum, Lemna Ovary positio... Date Added: 2009-06-24 14:24:25 |
| Classes.doc Path: UNC Charlotte >> CH >> 3286 Fall, 2009 Description: Classes Introduction: Classes define the nature of objects and form the basis of Object-Oriented Programming (OOP). They are templates for the objects that will be created in your java programs. Remember, an object is an instance of a class. Because ... Date Added: 2009-06-24 14:31:04 |
| hw10solutions.pdf Path: Wisconsin >> ECE >> 220 Fall, 2009 Description: ... Date Added: 2009-06-24 14:35:14 |
| currentsyl_710.pdf Path: Edinboro >> COMM >> 710 Fall, 2009 Description: Communication Ethics COMM710 Spring Semester 2009 Compton 206 COURSE OBJECTIVES Terrence L. Warburton, Ph.D. Compton 207 Phone: 814.732.1596 Fax: 814.732.2184 Email: warburton@edinboro.edu The intentions outlined by Johannesen et al. in the preface... Date Added: 2009-06-24 14:35:22 |
| resume_joe_siewert.pdf Path: Minnesota >> SIEW >> 0019 Fall, 2009 Description: Email: joe.siewert@gmail.com Joseph Siewert Education: University of Minnesota Curtis L. Carlson School of Management Bachelor of Science in Business, May 2006 Management Information Systems, Supply Chain Management Cumulative GPA: 3.66 www.joesiew... Date Added: 2009-06-24 14:35:36 |
| OM_Position_-_George_Mason_University.doc Path: Berkeley >> ATT >> 0251 Fall, 2009 Description: George Mason University School of Management Faculty Position in Operations Management The Information Systems and Operations Management (ISOM) Area at the School of Management, George Mason University (GMU), invites applications and nominations for ... Date Added: 2009-06-24 14:37:09 |
| T0419.t06.alpha-logo.pdf Path: UCSC >> T >> 0419 Fall, 2009 Description: T0419.t06 alpha 3 2 1 MFESAEVGHSIDKDTYEKAVIELREALLEAQFELKQQARFPVIILINGIEGAGKGETVKLLNEWMDPRLIEVQSFLRPSDEELERPPQWRFWRRLPPKGR 10 20 30 40 50 60 70 80 90 1 H 3 2 1 BSBEB H SBE TD EGSBDH EH E B H BH SB HS TGIFFGNWYSQMLYARVEGHIKEAKLDQAIDAAERFERML... Date Added: 2009-06-24 14:37:57 |
| 2005_test2.pdf Path: Maine >> ECE >> 486 Spring, 2008 Description: ECE486 Test 2, In Class Portion April 21, 2005 Closed Book, Closed Notes, No Calculators or Computers When you are nished with this portion of the exam, turn it in and go to work on the computer portion. After you turn this exam in, you may not retur... Date Added: 2009-06-24 14:50:23 |
| 566-sylabus.pdf Path: Southern Illinois University, Carbondale >> ECE >> 566 Fall, 2008 Description: Course Schedule Adaptive Control, ECE-566 Spring 2007 Instructor: Dr. Farzad Pourboghrat (618) 453-7026 pour@siu.edu http:/heera.engr.siu.edu/staff1/pour/myweb/pour.html Room E220, MWF, 1:00-1:50 p.m. Room A410, MW, 3:00-4:15 p.m. M. Krstic, I. Kanel... Date Added: 2009-06-24 14:52:36 |
| theory.pdf Path: Indiana >> EDUCY >> 520 Fall, 2009 Description: Theory, Models, Variables Y520 Strategies for Educational Inquiry 2-1 Three Meanings of Theory s s s A set of interrelated conceptions or ideas that gives an account of intrinsic (aka, philosophical) values. A set of principles for practice. A se... Date Added: 2009-06-24 14:53:16 |
| slides_linesplanes.pdf Path: Kennesaw >> MATH >> 2203 Fall, 2008 Description: 1 Equations of Lines and Planes in 3-D Recall that given a point P (a, b, c), one can draw a vector from the origin to P . Such a vector is called the position vector of the point P and its coordinates are a, b, c , the same as P . Position vectors... Date Added: 2009-06-24 14:54:24 |
| Section 8_4 Path: N.C. State >> MA >> 241 Spring, 2009 Description: WebAssign Section 8.4 (Homework) Due: Monday, April 6, 2009 11:01 PM EDT About this Assignment Question Points 1 2 3 4 5 6 7 8 0.25 0.25 0.25 0.25 0.25 0.25 0.25 4 Total 5.75/5.75 Description Other Convergence Tests The due date for this assignment... Date Added: 2009-06-24 14:57:15 |
| hw3.ps Path: Harvard >> CS >> 243 Fall, 2009 Description: %!PS-Adobe-3.0 %BoundingBox: (atend) %Pages: (atend) %PageOrder: (atend) %DocumentFonts: (atend) %DocumentNeedsFonts: (atend) %DocumentSuppliedFonts: (atend) %Creator: Frame 7.0 %DocumentData: Clean7Bit %EndComments %BeginProlog % % Frame ps_prolog 7... Date Added: 2009-06-24 15:04:20 |
| slidingdft.pdf Path: University of Toronto >> ECE >> 431 Fall, 2009 Description: ECE 431 Spring 2005 Tutorial - March 28, 2005 The Sliding DFT 1 Motivation Given a discrete-time signal, which can be considered as a sequence . . . , x(-2), x(-1), x(0), x(1), x(2), . . . , x(n), x(n + 1), . . . (1) In some applications, one may w... Date Added: 2009-06-24 15:06:31 |
| sp1999finalsln.pdf Path: Lake County >> ECE >> 431 Fall, 2009 Description: ... Date Added: 2009-06-24 15:06:46 |
| l-sockpit.pdf Path: Maine >> ECE >> 435 Fall, 2009 Description: Five pitfalls of Linux sockets programming http:/www-128.ibm.com/developerworks/linux/library/l-sockpit/ Five pitfalls of Linux sockets programming Develop reliable networked applications in heterogeneous environments Level: Intermediate M. Tim Jo... Date Added: 2009-06-24 15:07:05 |
| tlc.ppt Path: MO St. Louis >> CH >> 263 Fall, 2009 Description: Experiment 4 Thin Layer Chromatography COOH O CCH3 O Aspirin O N N CH3 Caffeine CH3 CHCO2H CH3O Naproxen CH3 N N CH3CHCH2 CH3 O NH CCH3 CH3CH2O Phenacetin CH3 CHCO2H HO O NH CCH3 Aetaminophen O C NH 2 OH CH3 O Ibuprofen O Salicylamide CH3 CHCO... Date Added: 2009-06-24 15:09:03 |
| ECE450_HW10.pdf Path: Lake County >> ECE >> 450 Fall, 2009 Description: ECE 450: Spring 2009 1. Homework Set 10 Due on Friday, Apr 17, 2009 Consider a Hertzian dipole of length 0.005 operating in air at the frequency of 1.0 GHz with input current I0 = 10.0 A. A measurement is conducted at a distance r = 0.5. Compare th... Date Added: 2009-06-24 15:13:11 |
| lect26.ps Path: Maryland >> CMSC >> 212 Fall, 2005 Description: %!PS-Adobe-3.0 %Title: Microsoft PowerPoint - lect26 %Creator: PScript5.dll Version 5.2.2 %CreationDate: 12/13/2005 7:20:38 %For: Owner %BoundingBox: (atend) %Pages: (atend) %Orientation: Portrait %PageOrder: Special %DocumentNeededResources: (atend)... Date Added: 2009-06-24 15:14:17 |
| Lecture4.pdf Path: Lake County >> ECE >> 462 Fall, 2009 Description: ... Date Added: 2009-06-24 15:17:45 |
| HW2SP03.pdf Path: Lake County >> ECE >> 475 Fall, 2009 Description: ECE 475 / BIOE 475 Modeling of Biological Systems Assignment #2 Spring 2006 Prof. Wheeler The objective of this assignment is to review basic linear systems theory and to acquaint you with using Matlab functions to expedite the solution of problem... Date Added: 2009-06-24 15:20:40 |
| Lec23_Snoopy.pdf Path: Maine >> ECE >> 498 Fall, 2008 Description: ECE498/598 Cluster Computing Shared-memory Multi-processors Lecturer: Dr. Yifeng Zhu Spring, 2006 ECE498/598 The slides are derived from the lecture notes of Avinash Karanth Kodi at U. of Arizona Lec 23.1 Review: What is a Multiprocessor A col... Date Added: 2009-06-24 15:24:04 |
| exam1.pdf Path: SUNY Stony Brook >> MAT >> 118 Summer, 2008 Description: First Exam PRINT your Name: MAT 118, Spring 2003 problem possible score 1 75 2 20 3 20 4 20 5 20 6 20 Total 175 Directions: There are 6 problems on 6 pages in this exam (printed on both sides). Do all of your work in this exam booklet, and ... Date Added: 2009-06-24 15:24:43 |
| GWch6_7.pdf Path: ASU >> STP >> 226 Fall, 2008 Description: STP226 Groupworkch6.Includeappropriatesketchforeveryquestion. 1.Considerthestandardnormalcurve.Find z .05 and z .25 2. Findtheareaunderthestandardnormalcurve a)between1.58and2.13. b)rightof1.78 3. Findfirstquartile,thirddecileand95thpercentile... Date Added: 2009-06-24 15:25:23 |
| quiz4ans.pdf Path: SUNY Stony Brook >> AST >> 101 Spring, 2008 Description: AST 101: INTRODUCTION TO ASTRONOMY SPRING 2008 Quiz 4 ANSWERS Name: _ SBU ID:_ You must show all work in order to get partial credit! 1. (4 pts) While stars are on the Main Sequence they produce energy through a set of nuclear reactions. In this rea... Date Added: 2009-06-24 15:25:51 |
| maptut3.pdf Path: ASU >> MAT >> 270 Fall, 2009 Description: ! xy2 + 3x = y3 sin (x) - cos(y) = xy \" f:=x*y^2 + 3*x = y^3; f := xy2 + 3x = y3 * # > with(plots): +# ! >implicitplot(f,x=-5.5,y=-5.5); [Graph Output] # ) # * ,implicitdiff(f,y,x); *# $\' # . \" y2 + 3 y (... Date Added: 2009-06-24 15:33:18 |
| formulas.pdf Path: SUNY Stony Brook >> MAT >> 362 Spring, 2008 Description: s s g s x x xx r l gsx r fxx rk v fsx r z s x ss x sx r l ss r sx rk v ss r z x x s T 9 U`7 I U7 v D qSDGenqxiRec t z s x s x s s xs5x r fss r fxx r sx r sx r 5xsx r v fsx r 5xss r v x l sx rk s l 5xsx rk 9 U`7 I TT I SDGe$i7 ... Date Added: 2009-06-24 15:33:23 |
| assignment8.pdf Path: SUNY Stony Brook >> MAT >> 142 Fall, 2008 Description: m fFG5HRP5w42 g nS 4 6 m r3 z u`uFP5suRG5aG8I@ S cS87i av g dwxz 96Pyfs5uRhuF95s6uR!5d%eqSh95SxC|S8pP5w s m 2 Dd B 5 U e F I r I B i D 5 D 6 t z ufuFP5suRG5aG8I@ nS 8HUGru`uFP5suRG5aG8I@ g nS cG8d m5 m 2D i C g wxz 96Gy\'rFs5G8sIEFs6GRcGxCIwr... Date Added: 2009-06-24 15:33:35 |
| homework2.pdf Path: SUNY Stony Brook >> PHY >> 688 Fall, 2008 Description: PHY 688: The Application of Simulation in Astrophysics Homework #2 Due: Fri. March 10, 2006 0. In a few weeks, we will begin running multidimensional hydrodynamic simulations using the FLASH Code. Please go to http:/flash.uchicago.edu/website/codere... Date Added: 2009-06-24 15:33:53 |
| Ciesla.pdf Path: SUNY Stony Brook >> AST >> 389 Fall, 2008 Description: Sara Ciesla- Strzelecki Professor Walters and Richard Caputo EGL 389 8 May 2008 Anwell So, how do I look? the young woman asked the figure behind her a s she stared at the mirror. She twirled around, presenting herself to the m an. Beautiful maam, h... Date Added: 2009-06-24 15:39:11 |
| JACINST.doc Path: Rutgers >> CE >> 578 Fall, 2009 Description: 1 INSTRUCTIONS FOR PROGRAM JACOBI Input Data File Line 1 Line 2 Line 3 - Output file name - Title - Up to 60 characters - N, IFPR N - Number of degrees of freedom IFPR - Printing index : 1 - print intermediate results 0 - do not print Line 4 - K(I,J... Date Added: 2009-06-24 15:39:45 |
| FPCounter.xls Path: Rose-Hulman >> CSSE >> 372 Fall, 2009 Description: Complexity Low Medium External Inputs (EI) External Outputs (EO) External inQuiries (EQ) Internal Logical Files (ILF) External Interface Files (EIF) Unadjusted FPs Factors Data communication Distributed data processing Performance Heavily used config... Date Added: 2009-06-24 15:40:37 |
| confl_stud.pdf Path: Hamline >> FAS >> 270 Fall, 2009 Description: certificate program conf l ic t HAMLINE UNIVERSITY GRADUATE SCHOOL OF EDUCATION st ud i es Whether you teach in the classroom or have significant administrative responsibilities, the Certificate in Conflict Studies offers you the flexibility t... Date Added: 2009-06-24 15:45:45 |
| 74998vs75028.ps Path: Stanford >> SOI >> 070220 Fall, 2009 Description: %!PS-Adobe-3.0 %BoundingBox: 0 0 396 283 %Title: Graphics produced by IDL %For: couvidat@n12.Stanford.EDU, /auto/scr20/couvidat/HMI %Creator: IDL Version 6.3 (linux x86_64 m64) %CreationDate: Wed Feb 21 11:26:29 2007 %DocumentData: Clean7bit %Require... Date Added: 2009-06-24 15:46:12 |
| detune_phases_contrasts_85500_calmode.ps Path: Stanford >> SOI >> 070225 Fall, 2009 Description: %!PS-Adobe-3.0 %BoundingBox: 0 0 566 765 %Title: Graphics produced by IDL %For: couvidat@n12.Stanford.EDU, /auto/scr20/couvidat/HMI %Creator: IDL Version 6.3 (linux x86_64 m64) %CreationDate: Wed Feb 28 13:10:13 2007 %DocumentData: Clean7bit %Require... Date Added: 2009-06-24 15:46:38 |
| T0501.t06.str2-logo.pdf Path: UCSC >> T >> 0501 Fall, 2009 Description: T0501.t06 str2 5 4 3 2 1 MLTKVIAQAHIDHFTKWFERADKIVIVSHVSPDGDAIGSSLGLYHFLDSQDKIVNVIVPNAFPDFLKWMPGSKDILLYDRYQEFADKLIMEADVICCLDF 1 10 20 30 40 50 60 70 80 90 H 5 4 3 2 1 T QP Q TH T Q TS TG H T H T QP T NALKRIDEMSDIVAASPGRKIMIDHHLYPEDFCRITISHPE... Date Added: 2009-06-24 15:47:20 |
| problems10.pdf Path: NSC Henderson >> MAT >> 251 Fall, 2009 Description: 10. Fermat and Eulers Theorems, RSA 1. Find prime factorizations for each of these numbers: (a) 47. (b) 99. (c) 8. (d) 72. 2. Find (n) for each of these numbers: (a) 47. (b) 99. (c) 8. (d) 72. 3. Prove that if p is prime and n is a natural number, th... Date Added: 2009-06-24 15:48:04 |
| 02x.pdf Path: MIT >> PUBLIC >> 1803 Fall, 2009 Description: 18.03 at ESG Independent Study Spring 2005 Chapter 2: Linear Equations of Higher Order There are no assigned problems from Sections 2.4, 2.6 or 2.7, but you may nd the material useful; folks taking 8.02 will be more interested, perhaps, in Section... Date Added: 2009-06-24 15:56:29 |
| sec1_hw2.pdf Path: Michigan >> M >> 454 Fall, 2009 Description: Assigned: Friday Sep. 16, 2005 Due: Friday Sep. 23, 2005 MATH 454: Homework 2 FALL 2005 1. Consider the polar coordinates x = r cos() y = r sin(). (a) Since r2 = x2 + y 2 , show that x r x = cos(), r y = sin(), y = cos() r, and = sin() ... Date Added: 2009-06-24 16:02:40 |
| YJL093C.t2k.dssp-ehl2-logo.pdf Path: UCSC >> YJL >> 093 Fall, 2009 Description: YJL093C.t2k DSSP-EHL2 2 1 C H C C H C H C CHCCCCCCCEEXXXEEEEEX C E E E X H C H X 10 20 30 40 E 2 1 T S H HHHHHHHHHHHHHHHHHHHHHHHHH X X X X X X X X X C C C C C C C C C H C C C C C C C C C C C C C C C C C C C C C C C C X X X X X X X X X X X X... Date Added: 2009-06-24 16:03:17 |
| mx.txt Path: NYU >> JK >> 1786 Fall, 2009 Description: mx ... Date Added: 2009-06-24 16:04:48 |
| ps4sol.pdf Path: SUNY Stony Brook >> MAT >> 531 Fall, 2008 Description: MAT 531: Topology&Geometry, II Spring 2006 Solutions to Problem Set 4 Problem 1: Chapter 1, #13ad (p51) (a) Show that [X, Y ] is a smooth vector eld on M for any two smooth vector elds X and Y on M . (d) Show that [, ] satises the Jacobi identity, i.... Date Added: 2009-06-24 16:06:58 |
| Structure of matter (1b).doc Path: Eastern Washington University >> TECH >> 208 Fall, 2008 Description: Structure of Matter A. To understand why electrical energy exists, we must first study the nature of materials. B. Matter: is anything that occupies space and has weight. o Can be solid, liquid or gaseous states (plasma: ionized atoms, electrons sepa... Date Added: 2009-06-24 16:07:58 |
| 10.1990.03Dallmeyer.pdf Path: Yale >> GEOLOGY >> 1990 Fall, 2009 Description: ... Date Added: 2009-06-24 16:10:40 |
| ProblemLog_LCOPackage_IVVb_LCO_F06a_T15_v1.1.xls Path: USC >> CSCI >> 577 Fall, 2009 Description: 0d56cbed88375f1a2829e6c741f04095adf12684.xls - Areas of Concern Log ProjectName: Artifact: Module: MBASEPhase/level: Team 15 - LANI Database Project LCOPackageSID,OCD,SSAD,SSRD,LCP,FRD,UML N/A Inception IV&VReview Review# ReviewDate: ReviewTime: ... Date Added: 2009-06-24 16:10:45 |
| CALCULATOR AND PHONE REGULATIONS.pdf Path: Miami Dade >> AVELAZQ >> 1025 Fall, 2009 Description: ... Date Added: 2009-06-24 16:12:21 |
| oax00z.txt Path: University of Illinois, Urbana Champaign >> IOP >> 20030625 Fall, 2009 Description: UPPER AIR CALCULATIONS AND PLOTTING (Ver 5.28A-LINUX-X11) Current filename: /noaaport/nwstg/convert/03062500_upa.wxp Date: 0000Z 25 JUN 03 Searching for KOAX. Searching the city database file for: KOAX . Date:0000Z 25 JUN 03 Station: KOAX WMO ... Date Added: 2009-06-24 16:13:46 |
| Request.doc Path: Penn State >> JUG >> 187 Fall, 2009 Description: Request For A New Application Date Submitted: December 6, 2007 Submitted by: Joshua George Purpose: To convert Kilometers to Miles for the local travel agency that schedules trips to Europe. Application Title: Algorithms: Joshuas Distance Converter M... Date Added: 2009-06-24 16:16:56 |
| Product Ordered SDB.xls Path: Penn State >> SDB >> 5028 Spring, 2009 Description: OrderID OrderDate ProductID ProductName 10285 1 Chai 9/20/1994 10294 1 Chai 9/30/1994 10317 1 Chai 10/31/1994 10348 1 Chai 12/8/1994 10354 1 Chai 12/15/1994 10370 1 Chai 1/3/1995 10406 1 Chai 2/7/1995 10413 1 Chai 2/14/1995 10477 1 Chai 4/17/1995 105... Date Added: 2009-06-24 16:21:54 |
| FR References.pdf Path: Penn State >> KMH >> 326 Fall, 2009 Description: MilestoneBuilding#4 KristenMHlopick ConstructionManagement|Dr.Riley|Germantown,Maryland|April9,2008 References AmericanSocietyofCivilEngineers.(2006).ASCE705Standard.UnitedStateofAmerica. Armstrong.(2008).CommercialCeilingsandWalls.R... Date Added: 2009-06-24 16:24:07 |
| PS10.pdf Path: UMBC >> MT >> 235 Fall, 2009 Description: MT235 Problem Set #10 Due Friday, April 24th, 2009. Problem 1: Consider the following payo table with decision alternatives A, B , C and D, and states of nature 1 and 2. Alternative #1 #2 A 120 20 B 60 40 C 10 110 D 90 90 (a) The probabilities of st... Date Added: 2009-06-24 16:24:48 |
| Anger.ppt Path: Wright State >> ED >> 911 Fall, 2009 Description: The key to anger reduction is knowing yourself. A match stick has a head but not a brain 3 Jan 2002 ANGER PREVENTION KIT Compiled by MRD 1of 28 Do important jobs now before they become urgent. A match stick has a head but not a brain 3 Jan 20... Date Added: 2009-06-24 16:25:40 |
| beheb10.txt Path: UNC >> DOCS >> 2030 Fall, 2009 Description: The Project Gutenberg Etext, LEGENDS OF BABYLON AND EGYPT By Leonard W. King, M.A., Litt.D., F.S.A. COPYRIGHT LAWS ARE CHANGING ALL OVER THE WORLD, BE SURE TO CHECK the copyright laws for your country before posting these files! Please take a look... Date Added: 2009-06-24 16:28:11 |
| pres6.ppt Path: JMU >> A >> 241 Fall, 2009 Description: Inventory Valuation Inventory Chapter 8. Major Methods of Valuation Major Specific Identification FIFO LIFO Weighted Average Standard Comparison. Comparison. Purchase 100 at $75 each $75 FIFO $75 LIFO $75 WtdAvg Comparisons Comparisons Pur... Date Added: 2009-06-24 16:35:03 |
| class_outline_revised2.pdf Path: ASU >> GEO >> 110 Fall, 2009 Description: GEOLOGICAL SCIENCES 110 SOLAR SYSTEM EXPLORATION Revised November 11 2003 Prof: Mark Robinson Locy Hall Room 200A robinson@earth.northwestern.edu Office Hours: by appointment 847 467 1825 TA: Han Li, Locy Hall Room 205 han@earth.northwestern.edu Offi... Date Added: 2009-06-24 16:35:53 |
| sgi_origin.pdf Path: Portland >> ECE >> 588 Fall, 2008 Description: The SGI Origin: A ccNUMA Highly Scalable Server James Laudon and Daniel Lenoski Silicon Graphics, Inc. 2011 North Shoreline Boulevard Mountain View, California 94043 laudon@sgi.com lenoski@sgi.com Abstract The SGI Origin 2000 is a cache-coherent non-... Date Added: 2009-06-24 16:36:43 |
| stats_exam1.ps Path: Oakland University >> AME >> 437 Spring, 2009 Description: %!PS-Adobe-2.0 %Creator: dvipsk 5.58f Copyright 1986, 1994 Radical Eye Software %Title: histogram.dvi %Pages: 1 %PageOrder: Ascend %BoundingBox: 0 0 612 792 %DocumentPaperSizes: Letter %EndComments %DVIPSCommandLine: dvips -o stats_exam1.ps histogram... Date Added: 2009-06-24 16:38:55 |
| correction_asg3.pdf Path: ECCD >> SCE >> 94553 Fall, 2009 Description: ... Date Added: 2009-06-24 16:39:47 |
|
|
Get Started With Course Hero Today!
Get study guides, join study groups, and more!
Sign up in seconds with your Facebook account!
Course Hero is a Facebook Application Partner.
Click below to sign-up for FREE.
Our Social Learning Network was built to provide students and key learning partners like professors a platform to share, meet and collaborate while accelerating their comprehension of course-related theories and concepts. We are committed to providing you immediate access to a growing wealth of study materials and an unparalleled academic network of students, professors and other key partners. Why do you care? Because you want the best grade possible and at times need a 24/7 resource that’s responsive to your needs. |
|
What People Are Saying About Course Hero
|
|||
|
|||
|
Explore the benefits of joining Course Hero's social learning network.
|
|||
![]() |
Get millions of study materials now!Need lecture notes for a missed class or want insightful explanation of the theories and concepts you learn in class? Look no further, Course Hero’s Study Materials empowers you to find a broad and deep set of materials that can help you right now!
Click below to sign-up for FREE.
|
||
![]() |
Get over 200,000 textbook solutions now!Having difficulty with your homework and need documents that are relevant for your Textbook? Don't be frustrated. Course Hero's Textbook Help presents you study materials from many college courses.
Click below to sign-up for FREE.
|
||
![]() |
Meet over 300,000 students and your fellow classmates now!Want to meet your current classmates or those that took the class last year? Don’t worry or have anxiety. Course Hero’s Study Groups gives you the seamless opportunity to develop both anonymous or direct relationships with those classmates whom you want to meet and get help from right now!
Click below to sign-up for FREE.
|
||


