Course Solutions And Notes - e1 13
| PAE2414.t06.o_notor2-logo.pdf Path: UCSC >> A >> 2414 Fall, 2009 Description: PAE2414.t06 o_notor2 3 2 1 27 30 40 50 60 N 3 2 1 H N B N B N B A B N B 70 170 120 AL Q SANPV VKSIALAVAGESKAKAETP L SV V KY G V YY V Y E GG G W A LS A A P N 77 80 90 100 P 3 2 1 N M N H N B 110 SA V STPQL YAVGFGNCPADISGLYGRA ... Date Added: 2009-06-18 21:38:30 |
| exam_answers_CHEM 237 Exam 2 KEY Green.pdf Path: Washington >> CHEM >> 237 Fall, 2008 Description: ... Date Added: 2009-06-18 21:38:38 |
| Matt Miller Concept 12 An.doc Path: Bradley >> MM >> 250 Fall, 2009 Description: MattMillerConcept12Answers 1) Whatshallwemakeofthe\"single\"applianceapproach? Whatdowelearnfromthe\"Ipod\"thatisadifferent lessonthanthe\"ebook\"?Whatof\"Ican\'tprogrammy VCR\"? Singleapplianceapproachisagoodideaformany reasons.Peoplethesedayshaveveryfastan... Date Added: 2009-06-18 21:39:40 |
| crisis summary.doc Path: Allan Hancock College >> POLS >> 2067 Fall, 2009 Description: Lecture: Crisis and Australian Democracy Abolition of the Queensland Legislative Council How democratic was all this? Given that an appointed chamber is anything but democratic, was the Labor government right to disregard the outcome of the 1917 refe... Date Added: 2009-06-18 21:40:11 |
| LabVIEW_intro.ps Path: Maple Springs >> HEP >> 3150 Fall, 2009 Description: %!PS-Adobe-2.0 %Creator: dvips(k) 5.86 Copyright 1999 Radical Eye Software %Title: manual.dvi %Pages: 1 %PageOrder: Ascend %BoundingBox: 0 0 596 842 %EndComments %DVIPSWebPage: (www.radicaleye.com) %DVIPSCommandLine: dvips -f manual %DVIPSParameters:... Date Added: 2009-06-18 21:40:58 |
| laptops[1].doc Path: U. Houston >> CUIN >> 3112 Fall, 2008 Description: Independent Project Laptops in the Classroom How would you like to have a classroom that has no learning boundaries? Incorporating laptops into a classroom is a great way to incorporate this task. It seems students are confined to one maybe two c... Date Added: 2009-06-18 21:41:42 |
| Quiz_9_P_Key_08.pdf Path: Michigan State University >> CEM >> 251 Fall, 2008 Description: ... Date Added: 2009-06-18 21:41:53 |
| spec_pc_bg.txt Path: Berkeley >> ASTRO >> 00153514 Fall, 2009 Description: # tmin tmax 0.582121 857.293 [ksec] ;instrument XRT ;exposure 121601.10 ;xunit kev ;bintype counts 0.000000 0.010000 0.000000 0.000000 0.010000 0.020000 0.000000 0.000000 0.020000 0.030000 0.000000 0.000000 0.030000 0.040000 0.000000 0... Date Added: 2009-06-18 21:42:01 |
| qopt-ratebased.pdf Path: W. Alabama >> CS >> 848 Fall, 2009 Description: Rate-Based Query Optimization for Streaming Information Sources Authors: Efstratios Viglas, Jeffrey F. Naughton Paper Number: 233 Area: Core Database Technology Category: Research Relevant Topics: Optimization and Performance Contact Author: Efstrati... Date Added: 2009-06-18 21:42:40 |
| w440509.pdf Path: University of Hawaii - Hilo >> MAY >> 1944 Fall, 2009 Description: ... Date Added: 2009-06-18 21:43:22 |
| strategy list.doc Path: Minnesota >> AVERY >> 035 Fall, 2009 Description: Strategy List Celeste Avery CI 5505 Teacher Strategies Teaching Strategies: Varied Activities Use of a variety of activities in the classroom ensures that different learning styles are being addressed. Hands on activities, authentic activities t... Date Added: 2009-06-18 21:48:53 |
| hw2.pdf Path: Caltech >> HW >> 120 Fall, 2009 Description: Homework 2, CNS/Bi/Psy 120 2008/09 Due: Wednesday, April 22, 2009 Grade: 6% of total grade 2 Cortical Maps and Enabling factor In the class The Early Visual System, we learned that the visual world, projected onto the retina, is transformed at the... Date Added: 2009-06-18 21:49:26 |
| unit3tables.doc Path: Western Michigan >> SPPA >> 205 Fall, 2009 Description: SPPA 2050 Speech Anatomy & Physiology I. MUSCLES OF INSPIRATION ORIGIN INSERTION MECHANICAL ACTION MOTOR SUPPLY MUSCLE Diaphragm External intercostals Internal intercostals Intercartilaginous Levator costarum (Costal elevators) Serratus posterior s... Date Added: 2009-06-18 21:49:39 |
| homework1.pdf Path: U. Houston >> MATH >> 3340 Fall, 2008 Description: Math 3340 - Fixed Income Mathematics Homework 1 NAME: PEOPLESOFT ID: How to submit homework Print out the homework and complete the problems in the spaces provided. Scan and submit the homework through your CourseWare account assignments tab. I su... Date Added: 2009-06-18 21:50:13 |
| 2007March3902Assignment5.doc Path: UWI Mona >> IO >> 3902 Fall, 2009 Description: Name: Student Number: Assignment 5 ACS - 3902 due Wed March 28, 2007 Suppose employee records have an employeeId, firstName, lastName, etc. Suppose 12 employee records are to be inserted and where the employeeId values are 2369 3760 4692 4871 56... Date Added: 2009-06-18 21:50:20 |
| Exercise8.pdf Path: Maple Springs >> M >> 1550 Fall, 2009 Description: Math 1550 Exercise 8 - Sections 6.5 - 6.6 and 7.1 - 7.3 Do not submit your solution. Section 6.5: Questions 3, 11, 13, 19, 21 and 23. Section 6.6: Questions 5, 7, 9, 25, 27, 31, 35, 37, 41 and 43. Section 7.1: Questions 1, 9, 17, 23, 25 and 29. Secti... Date Added: 2009-06-18 21:51:00 |
| vector5.cpp.txt Path: USC >> CSCI >> 201 Fall, 2009 Description: / Demonstrating insert on vectors; effects on size/capacity #include <vector.h> #include <algo.h> #include <assert.h> int main() { cout < \"Demonstrating Simple Use of vectors.\" < endl; int x[5] = {2, 3, 5, 7, 11}; / Initialize vector1 to x[0... Date Added: 2009-06-18 21:51:27 |
| summary_preview_of_632.pdf Path: Oregon State >> MTH >> 631 Fall, 2008 Description: Major Theorems Embedding Theorem: Every separable metric space is homeomorphic to a subspace of I [0, 1] . Proof: Done. Tychonoff\'s Theorem: An arbitrary product of compact spaces is compact. Proof: Outlined. Urysohn\'s Lemma: (constructing a functi... Date Added: 2009-06-18 21:51:52 |
| mtdefs.pdf Path: Oregon State >> MTH >> 631 Fall, 2008 Description: Definitions for Mth 631 Midterm Metric Space Topology Order Topology Separable Product topology on X Y Limit Point Boundary Equivalent Bounded Metric S First countable Quotient map T0 , T1 , T2 , T3 , T4 Normal B (x) Topology induced by metric Dictio... Date Added: 2009-06-18 21:51:52 |
| Nasher Assignment_MLevin.ppt Path: Dallas >> MGL >> 015000 Fall, 2009 Description: EVE I love Eve by Auguste Rodin. I took a photo and made a wire version. ... Date Added: 2009-06-18 21:52:33 |
| as4.ps Path: CSU Channel Islands >> ICS >> 184 Fall, 2009 Description: %!PS-Adobe-2.0 %Creator: dvips(k) 5.86 Copyright 1999 Radical Eye Software %Title: as4.dvi %Pages: 2 %PageOrder: Ascend %BoundingBox: 0 0 596 842 %EndComments %DVIPSWebPage: (www.radicaleye.com) %DVIPSCommandLine: dvips -o as4.ps as4.dvi %DVIPSParame... Date Added: 2009-06-18 21:52:40 |
| Regrade_request.pdf Path: Washington >> PHYS >> 122 Fall, 2008 Description: Regrade request 122D I have read the solutions to this exam. I have not made any changes or marks on the original examination. (Portions of each exam are photocopied.) I understand that each question may be entirely regraded and that it is possible... Date Added: 2009-06-18 21:53:53 |
| ee272_ho16.ps Path: Stanford >> EE >> 272 Fall, 2009 Description: %!PS-Adobe-3.0 %BoundingBox: (atend) %Pages: (atend) %PageOrder: (atend) %DocumentFonts: (atend) %Creator: Frame 4.0 %DocumentData: Clean7Bit %EndComments %BeginProlog % % Frame ps_prolog 4.0, for use with Frame 4.0 products % This ps_prolog file is ... Date Added: 2009-06-18 21:54:22 |
| PHYS-311-5.pdf Path: Laurentian >> PHYS >> 311 Fall, 2009 Description: ... Date Added: 2009-06-18 21:54:38 |
| indexing_prelim_topost.pdf Path: Princeton >> COS >> 435 Spring, 2009 Description: Review: Model Using and storing the index Document: sequence of {terms + attributes} Query: sequence of terms Can make more complicated: Advanced search Satisfying: in current search engines, documents \"containing\" all terms AND model \"conta... Date Added: 2009-06-18 21:54:54 |
| school.txt Path: Duke >> STA >> 290 Fall, 2008 Description: model{ for (j in 1:J){ y[j] ~ dnorm (theta[j], tau.y[j]) theta[j] ~ dnorm (mu.theta, tau.theta) tau.y[j] <- pow(sigma.y[j], -2) } mu.theta ~ dnorm (0.0, 1.0E-6) tau.theta <- pow(sigma.theta, -2) sigma.theta... Date Added: 2009-06-18 21:56:12 |
| DCLOOPAZH350001.xls Path: Minnesota >> AZH >> 350001 Fall, 2009 Description: Average with Error Bars (0kV) 2 1.8 1.6 1.4 1.2 Nanoamps 1 0.8 0.6 0.4 0.2 0 0 2 4 6 8 10 Pixel 12 14 16 18 20 Mean(0kV) Average with Error Bars (12kV) 2 1.8 1.6 1.4 1.2 Nanoamps 1 0.8 0.6 0.4 0.2 0 0 2 4 6 8 10 Pixel 12 14 16 18 20 Mean(12kV) St... Date Added: 2009-06-18 21:57:30 |
| 11200.txt Path: Columbia College >> DOCS >> 11200 Fall, 2009 Description: Project Gutenberg\'s The World War and What was Behind It, by Louis P. Benezet This eBook is for the use of anyone anywhere at no cost and with almost no restrictions whatsoever. You may copy it, give it away or re-use it under the terms of the Proj... Date Added: 2009-06-18 21:57:52 |
| slides2a.pdf Path: Toledo >> STA >> 414 Fall, 2009 Description: )( 431 8 57 9 75 6 @A B5 84DC GD F A 96 4H7 C B 7H GH B H P6 6 56 A 6S ET \' H47 4H7 4RP G D FE EQ 6I E ! 12 0 6 5( \" #! $ % B6 UV@ H 4X7 W G B8 7 4Y5 D GD HD RD ab`a 5 )F )( ... Date Added: 2009-06-18 21:58:47 |
| 2up-lecture03.pdf Path: Duke >> CPS >> 104 Fall, 2009 Description: Under the Hood: Memory and Bit Operations CPS 104 Lecture 3 Administrivia Homework #1 Due September 12 Memory Bitwise operations Outline Review data representations Arrays Pointers Pointer Arithmetic Bitwise operations (AND, OR) Reading Cha... Date Added: 2009-06-18 21:58:56 |
| ProEval_1.pdf Path: Wisc Stevens Point >> BSMAL >> 144 Fall, 2009 Description: ... Date Added: 2009-06-18 22:00:13 |
| ep_nfl_dat.txt Path: Berkeley >> ASTRO >> 00345777 Fall, 2009 Description: # Ep dEp lprob lNiso dlNiso 47.226 0.038 3.86e-05 5.846 0.334 47.265 0.041 1.54e-05 5.846 0.330 47.308 0.047 4.03e-05 5.846 0.330 47.358 0.053 8.56e-05 5.846 0.331 47.416 0.061 1.15e-04 5.846 0.331 47.481 0.070 1.24e-04 5.846 0.331 47.556 0.080 1.32e... Date Added: 2009-06-18 22:00:31 |
| Food Safety and Quality.ppt Path: Michigan State University >> FSC >> 421 Spring, 2008 Description: Regulating the Quality and Safety of Foods The Elements of Food Safety Law S ty afe Science Policy Safety System Basics Only safe and wholesome foods may be marketed Regulatory decisionmaking is sciencebased Government has enforc... Date Added: 2009-06-18 22:04:12 |
| FT1-commercialtourism.rtf Path: Maryland >> AMST >> 205 Fall, 2008 Description: AMST 205-0101/AMST 205-0201 September 30, 2005 Field Trip #1: Tourism and Consumer Culture We will not have class on September 30th; instead, sometime before October 3rd, you must complete the following assignment. Bring this worksheet and the rest o... Date Added: 2009-06-18 22:04:54 |
| asci.99.pdf Path: Michigan Flint >> CSC >> 577 Fall, 2009 Description: Exploiting Location Awareness for Scalable Location-Independent Object IDs Gerco Ballintijn Maarten van Steen Andrew S. Tanenbaum Vrije Universiteit, Department of Mathematics and Computer Science, De Boelelaan 1081a, 1081 HV, Amsterdam, The Netherl... Date Added: 2009-06-18 22:05:03 |
| lec18.pdf Path: CofC >> EVSS >> 650 Fall, 2008 Description: Lec #18: 25 March 2009 Fossil Fuels. III. < 10 m F.F. 1. Supply, Extraction, Use (Chap 7) coal, gas, oil; what are they; how formed? where to find? hidden costs F.F. 2. Combustion of FF & The Byproducts (Chap 8) Combustion Process and Byproduct... Date Added: 2009-06-18 22:05:41 |
| P4.doc Path: UCLA >> EE >> 202 Fall, 2009 Description: P4. Moshe Golan 002907793 First I calculated for the gate delays for the different operating voltage for both the Multiplier and the ALU. The gate delay is computed as follows: K = vdd/(vdd-0.8)^2. K5V = 5/(5-0.8)^2 = 0.283 K3.3V = 3.3/(3.3-0.8)^2 = ... Date Added: 2009-06-18 22:07:06 |
| main.txt Path: UCLA >> EE >> 202 Fall, 2009 Description: DAVID OMOTO 802 842 321 EE 202A HW#3 PROBLEM#6 The purpose of this program is to check whether a certain task set is schedulable or not using rate monotonic scheduling with priority ceiling. The program will read in values from a user-defined fi... Date Added: 2009-06-18 22:07:07 |
| b112_Lecture_33_p02 Path: Pacific Union >> BIOL >> BIOL-112 Fall, 2009 Description: ... Date Added: 2009-06-18 22:09:30 |
| b112_Lecture_33a Path: Pacific Union >> BIOL >> BIOL-112 Fall, 2009 Description: BIOL 112 Chapter 33 The Invertebrates General Points About Invertebrates Contains all the phyla except part of phylum Chordata Most species are marine or aquatic Defining characteristic Lack of a backbone Phylum Porifera Sponges ~ 9,000 spec... Date Added: 2009-06-18 22:10:35 |
| Adams v Zayre (ed).pdf Path: N.E. Illinois >> BUS >> 2750 Fall, 2009 Description: ADAMS v. ZAYRE CORPORATION 148 Ill. App. 3d 704 (2d Dist. 1986) This suit was brought by a shopper for false imprisonment. A judgment for $2,500 in general damages, plus $ 30,000 in punitive damages was entered for plaintiff. This appeal timely foll... Date Added: 2009-06-18 22:10:41 |
| external flows.ppt Path: Fayetteville State University >> EML >> 3016 Fall, 2009 Description: External Flows An internal flow is surrounded by solid boundaries that can restrict the development of its boundary layer, for example, a pipe flow. An external flow, on the other hand, are flows over bodies immersed in an unbounded fluid so that the... Date Added: 2009-06-18 22:11:45 |
| SimpleTripDistF08.xls Path: Princeton >> ORF >> 467 Fall, 2008 Description: P: 2 6 4 8 Ainput: 1 5 7 7 D: 1.1 2 3 5 Sum: 3.13 4.35 4.71 3.89 2 1.2 4 6 3 4 1.3 7 P/Sum 0.64 1.38 0.85 2.05 [P][A]transp: 2 6 4 8 P 2 6 4 8 5 6 7 1.4 I 1 0 0 0 F: 0.83 0.25 0.11 0.04 0 1 0 0 0.25 0.69 0.06 0.03 0 0 1 0 [P/Sum]transpose 0.64 1... Date Added: 2009-06-18 22:12:57 |
| Section64.pdf Path: WVU >> MATH >> 156 Fall, 2008 Description: ... Date Added: 2009-06-18 22:13:26 |
| l04.pdf Path: Concordia Chicago >> STAT >> 24600 Fall, 2009 Description: Allele Frequency Estimation Example: ABO blood types ABO genetic locus exhibits three alleles: A, B, and O Four phenotypes: A, B, AB, and O Genotype A/A A/O A/B B/B B/O O/O Phenotype A A AB B B O Data: Observed counts of four phenotypes A, B, AB,... Date Added: 2009-06-18 22:13:44 |
| math251-spring2007-final_exam-EXAMPLE-answer_key.pdf Path: Rutgers >> MATH >> 251 Fall, 2008 Description: SAMPLE FINAL EXAM - Answer Key 1. (9 points): Lines and Planes (a) Find parametric equations for the line which passes through (1, 2, 3) and is parallel to the vector 1, 0, 1 . A vector equation for this line is r(t) = 1, 2, 3 + 1, 0, 1 t. x(t) = 1 +... Date Added: 2009-06-18 22:14:24 |
| LongAssignment.pdf Path: Arizona >> MATH >> 323044 Fall, 2009 Description: MATH 323, FALL 2004 SECOND WRITING ASSIGNMENT DUE MONDAY, NOVEMBER 29, 2004 William McCallum Your assignment is to write an account of the construction of the real number system. There are a number of ways of constructing the real numbers, including ... Date Added: 2009-06-18 22:14:35 |
| ch 5 Review.pdf Path: Wake Forest >> MTH >> 109 Spring, 2008 Description: ... Date Added: 2009-06-18 22:15:36 |
| syllabus.ps Path: Boise State >> CS >> 242 Fall, 2009 Description: %!PS-Adobe-2.0 %Creator: dvips(k) 5.86 Copyright 1999 Radical Eye Software %Title: syllabus.dvi %Pages: 2 %PageOrder: Ascend %BoundingBox: 0 0 596 842 %EndComments %DVIPSWebPage: (www.radicaleye.com) %DVIPSCommandLine: dvips syllabus -o syllabus.ps %... Date Added: 2009-06-18 22:16:40 |
| tempconverter.pdf Path: Syracuse >> ECS >> 102 Fall, 2008 Description: EXAMPLE /*tempconverter.c*/ /* Read temperatures in Farenheit and prints them in Celsius. */ #include<stdio.h> /* function prototypes */ double FarToCel(double fTemp); int main() { /* variables local to main */ double origTemp; double finalTemp; /* o... Date Added: 2009-06-18 22:17:28 |
| Fin 284 Yield Spreads S2004.ppt Path: Drake >> FIN >> 284 Fall, 2009 Description: Yield Spreads Finance 298 Analysis of Fixed Income Securities DRAKE UNIVERSITY Drake Fin 284 Level of interest rates Drake Drake University Fin 284 We often refer to the \"level of interest rates\" in the economy. How is this measured? Wha... Date Added: 2009-06-18 22:17:50 |
| net7_worksheet.doc Path: Washington >> LIS >> 549 Fall, 2008 Description: NET-4 Worksheet: Security Exercises LIS 549 Spring 2008 Name: _ Lab 1: Security Quiz Objective Try out you security knowledge on a couple online security quizzes. Step 1 Go to the SonicWALL Phishing IQ Test (http:/www.sonicwall.com/phishing/), look... Date Added: 2009-06-18 22:18:04 |
| ep_nfl_dat.txt Path: Berkeley >> ASTRO >> 00208870 Fall, 2009 Description: # Ep dEp lprob lNiso dlNiso 81.861 0.066 -1.59e-04 7.208 0.209 81.929 0.072 8.19e-04 7.208 0.209 82.006 0.082 1.88e-03 7.208 0.208 82.094 0.094 3.08e-03 7.208 0.208 82.195 0.108 4.38e-03 7.208 0.208 82.311 0.124 5.83e-03 7.208 0.208 82.443 0.142 7.40... Date Added: 2009-06-18 22:18:13 |
| guide.pdf Path: Caltech >> AERO >> 101 Fall, 2009 Description: Fluid Mechanics 101 A Skeleton Guide J. E. Shepherd Aeronautics and Mechanical Engineering California Institute of Technology Pasadena, CA USA 91125 1995-present - Revised December 16, 2007 Foreword This is guide is intended for students in Ae101... Date Added: 2009-06-18 22:20:58 |
| Ch19-qs.pdf Path: BYU >> CS >> 252 Fall, 2009 Description: ... Date Added: 2009-06-18 22:21:10 |
| plant.pdf Path: FIU >> FB >> 978 Fall, 2009 Description: Major Buildings on FIU Campuses North Campus AC I AC II AQ WUC HM KCC SHC LIB Gross Building Name Square Feet ACADEMIC ONE 145,911 ACADEMIC TWO 101,800 AQUATIC CENTER 1,607 CAMPUS SUPPORT COMPLEX 21,460 G B WOLFE UNIVERSITY CENTER 128,322 HOSPITALITY... Date Added: 2009-06-18 22:22:24 |
| How to Make a Work Breakdown Structure Easier.doc Path: UNC Wilmington >> POM >> 100 Fall, 2009 Description: Tech Management TechGuides How to make Work Breakdown Structure easier By Tom Mochal, Special to ZDNet Asia Wednesday, June 20, 2007 02:54 PM Almost all project schedules are built using a Work Breakdown Structure (WBS). Almost all project schedule... Date Added: 2009-06-18 22:22:29 |
| lec-12-s.pdf Path: W. Alabama >> ECE >> 327 Fall, 2009 Description: LEC-12 Preliminaries 1 LEC-12: Functional Validation of State Machines Lecture Notes Sections: 3.5 3.5.9 University of Waterloo Dept of Electrical and Computer Engineering E&CE 427 Digital Systems Engineering 2003t1Winter LEC-12 Preliminaries 2... Date Added: 2009-06-18 22:23:17 |
| Proposal Rubric.doc Path: Iowa State >> HELL >> 3340 Fall, 2009 Description: Rubric: Proposal Essay 1. Group members worked well together and contributed to the project equally. 2. Establishes audience/purpose clearly. 3. Justifies the need for the business. 4. Clearly and concisely describes details of making the business co... Date Added: 2009-06-18 22:25:30 |
| T0506.t2k.str2-logo.pdf Path: UCSC >> T >> 0506 Fall, 2009 Description: T0506.t2k str2 6 5 4 3 2 1 1 10 20 30 40 T 6 5 4 3 2 1 H H T 51 60 70 80 90 Z Y Z Y Z A Y Z 6 5 4 3 2 1 T S Z Y A H T T Z A S T 101 110 120 130 140 A 6 5 4 3 2 1 Z Y Z G H T G H T Z Y A Y Z E 151 160 170 180 ... Date Added: 2009-06-18 22:26:02 |
| lnb1.ppt Path: St. Thomas >> QMCS >> 490 Fall, 2009 Description: Lecture 10 Project Comments Course Future Secret Key Crypto March 2005 R. Smith - University of St Thomas - Minnesota 1 Class Project \"Class Project\" is 20% of the grade That\'s more work than that 4-page paper! I expect a 15-minute demo or pre... Date Added: 2009-06-18 22:26:47 |
| littleplant.pdf Path: UNC >> MUSIC >> 24912 Fall, 2009 Description: THE LITTLE PLANT. EMILIE POULSSON. j j j 2 b 4 oej oeoe oe oe b &b ?b oe oe J oe oeoe oe J J j j oe oe oe oe oe oe oe oe oe oe oe J J oe oej oe J j oe oej oe oe oe C.C. ROESKE. oe oe oe oe oe oe oe oe oe oe oe oe oe oe oe... Date Added: 2009-06-18 22:26:53 |
| LHopitals Rule Key.doc Path: Boise State >> MATH >> 160 Fall, 2008 Description: L\' Hopital\' s Rule Find the following limits 1. xx lim 5x3 - 4x + 3 =+ 2x 2 - 1 2. xx lim ln ( 1+ e x ) 1+ x =1 3. lim xx 1- e x =- 1 0 x 4. lim xx x2 ( ln x ) 3 =+ 5. lim xx x3 - x2 + x - 1 =1 1 x + ln x - 1 1 1 1 6. lim = x x ... Date Added: 2009-06-18 22:27:38 |
| Area Between Curves Worksheet.doc Path: Boise State >> MATH >> 160 Fall, 2008 Description: Area Between Curves Worksheet Sketch the graph and find the area of the region bounded by the graph of each of the given functions and above the x -axis from x = a to x = b. 1. f ( x ) = x 2 - 4; a = - 2, b = 2 2. f ( x ) = x 3 ; a = - 1, b = 0 3. ... Date Added: 2009-06-18 22:27:55 |
| Implicit Differentiation Worksheet.doc Path: Boise State >> MATH >> 160 Fall, 2008 Description: Implicit Derivatives Find dy by implicit differentiation dx 1. x 2 + y 2 = 16 2. x 2 - 2 y 2 = 16 3. x 2 y 2 - xy = 6 4. x 2 + 5 xy + y 2 = 10 5. x+y = x 6. ( 2 x + 3y ) 3 1 = x2 Find an equation of the tangent line to the graph of the fun... Date Added: 2009-06-18 22:28:11 |
| chapter10_11_12highlight.doc Path: CSU LA >> ACCT >> 300 Fall, 2009 Description: Chapter 10 Standard-costing I. SETTING STANDARDS Two types of standards that may be used: perfection standards and practical standards. Perfection standards assume that production takes place in the ideal world: employees always work at peak perform... Date Added: 2009-06-18 22:29:53 |
| SP09_boundary.pdf Path: UCLA >> EE >> 206 Fall, 2009 Description: Boundary Detection Jue Wang and Runhe Zhang Outline Boundary detection using static nodes Boundary detection using mobile nodes Applications: Dark / Light (without Gradient) Chemical Spills (without Gradient) Temperature (with Gradient) May 17, 20... Date Added: 2009-06-18 22:30:02 |
| Week 06-Solutions.pdf Path: Berkeley >> CS >> 186 Fall, 2009 Description: Fall 2004 CS 186 Exercise Questions Week 6 ending 10/8 SQL Consider the following schema for an airline database (primary key attributes are in bold): FLIGHTS (flight_num, source_city, destination_city) DEPARTURES (flight_num, date, plane_t... Date Added: 2009-06-18 22:31:51 |
| q6_00f_s.pdf Path: Alabama Huntsville >> MAE >> 466 Fall, 2009 Description: ... Date Added: 2009-06-18 22:33:55 |
| tomasulo.ps Path: UCSD >> CSE >> 240 Spring, 2001 Description: %!PS-Adobe-3.0 %Title: (L11 Tomasulo) %Creator: (Microsoft PowerPoint: PSPrinter 8.3.1) %CreationDate: (3:36 AM Thursday, May 8, 1997) %For: () %Pages: 19 %DocumentFonts: Times-Italic Times-Roman MonotypeSorts Helvetica ArialMT ArialItalicMT Helvetic... Date Added: 2009-06-18 22:36:05 |
| 14_Kane_Molly_Structures_3.pptx Path: Purdue >> WEEK >> 450 Spring, 2009 Description: Molly Kane February 14, 2008 Structures Group Analysis of Unpressurized External Structure AAE 450 Spring 2008 Unpressurized Conical Shells Nose cone Third Stage (Pressurized) Skirt 2 (Unpressurized) Second Stage (Pressurized) Skirt 1 (Unpressurize... Date Added: 2009-06-18 22:37:54 |
| 2003fallchap4webct.pdf Path: Utah >> FCS >> 3450 Fall, 2008 Description: Chapter 4. Income, Consumption, Saving and Borrowing Income data Median household income by state Two-year average of 1999-2000 U.S. : $42,168 Utah: $46,436 Maryland: $52,881 highest West Virginia: $29,737 lowest California: $46,008 Idaho: $37,28... Date Added: 2009-06-18 22:38:02 |
| ee527_hw05.pdf Path: Penn State >> EE >> 580 Fall, 2009 Description: EE 527 - Linear Control Systems Homework 5 Due on Tuesday, October 30 Department of Electrical Engineering Pennsylvania State University Fall 2007 1. Consider the system x1 (t) = max(0, t)x2 (t) + u(t), 1 x2 (t) = min(0, t)x1 (t) + min(0, t)2 u(t).... Date Added: 2009-06-18 22:38:20 |
| LixiaBonding_bsac.ppt Path: Berkeley >> EECS >> 245 Fall, 1997 Description: Berkeley Sensor Actuator Center Spontaneous hydrophilic Si bonding Infrared picture of ... Date Added: 2009-06-18 22:39:14 |
| Review for Test 3.doc Path: Minnesota >> GARB >> 0074 Fall, 2009 Description: Review for Exam III Note: These are only practice questions for the exam. There could be problems on the exam that are not on this study, but there will not be questions on the exam that you haven\'t done homework problems on. 1) Find the distance be... Date Added: 2009-06-18 22:45:23 |
| sg6.pdf Path: University of South Dakota >> BIOL >> 161 Fall, 2008 Description: Biology 162 Study Guide 6 \"Plantae\"= Glaucophytes, Red Algae, Green Plants \"Green Plants\"= various green algae and \"Plants\" \"Plants\"= \"Land Plants\"=\"Embryophytes\" Use Glauophytes, Red Algea, Green Plants, Chlorophytes, Charaophytes, or Land Plants to... Date Added: 2009-06-18 22:47:43 |
| spec_wt_bg.txt Path: Berkeley >> ASTRO >> 00148646 Fall, 2009 Description: # tmin tmax 0.311592 6.34208 [ksec] ;instrument XRT ;exposure 192.07899 ;xunit kev ;bintype counts 0.000000 0.010000 0.000000 0.000000 0.010000 0.020000 0.000000 0.000000 0.020000 0.030000 0.000000 0.000000 0.030000 0.040000 0.000000 0... Date Added: 2009-06-18 22:48:29 |
| Ch 19 RxDrugs.ppt Path: Boise State >> KINES >> 442 Fall, 2008 Description: Drug Products Chapter 19 Carolyn Gee We Will Cover: OTC vs. Prescription Drugs Prescription Drug Facts Drug Patents Brand-Name vs. Generic Drugs Myths of Generic Drugs Interactions Label, Written Prescription Drug Requirements Prices Brand... Date Added: 2009-06-18 22:48:55 |
| reading signup.docx Path: CSU Northridge >> GM >> 61310 Fall, 2009 Description: QS 301 Reading Sign Up Sheet Week 3, 9/11 What is Queer Studies for this class? Pfohl\'s \"Images of Deviance and Social Control\" Barbara Smith\'s \"Homophobia, Why Bring It Up?\" Wittig\'s \"One is Not Born a Woman\" Week 4, 9/18 From Social to Political... Date Added: 2009-06-18 22:49:19 |
| Lecture10_1_colour_4p.pdf Path: Allan Hancock College >> CHEM >> 1001 Fall, 2009 Description: Equilibrium Key chemical concepts: Disturbing equilibrium: Le Chatelier\'s principle; Direction of chemical change; Equilibrium constants; Equilibrium as a dynamic process; Equilibrium Themes: controlling equilibrium atmospheric equilibria co... Date Added: 2009-06-18 22:49:30 |
| wbschart.pdf Path: UNC Wilmington >> CIS >> 520 Fall, 2009 Description: Project Vision/Scope Summer School Process for New Hanover Co. Schools Organization of the Project Needs Assessment /Gathering Information Organizational level Cause Analysis Develop a Blueprint Communicati on Plan Implementation Evaluation ... Date Added: 2009-06-18 22:49:45 |
| Math111W09Midterm1.pdf Path: Oregon >> M >> 111 Fall, 2009 Description: Name Midterm #1 (02/04/09) Directions: Make sure to show all of your work to receive full credit. You may not use your neighbor\'s papers, or anything else that would be construed as cheating. Please turn off all cell phones, mp3 players, or pretty m... Date Added: 2009-06-18 22:51:36 |
| ch04.pdf Path: USC >> BUAD >> 305 Fall, 2008 Description: CHAPTER 4 THE BALANCE SHEET 1 CURRENT ASSETS Current assets include assets that are expected to be used within one year or the operating cycle, if longer The operating cycle involves the use of cash to buy inventories, selling the inventory to cr... Date Added: 2009-06-18 22:52:52 |
| Asil2001.ppt Path: Berkeley >> EECS >> 347 Fall, 2008 Description: An Automated Design Flow for LowPower, HighThroughput Dedicated Signal Processing Systems W. Rhett Davis, Ning Zhang, Kevin Camera, Dejan Markovi, Tina Smilkstein, Nathan Chan, M. Josie Ammer, Engling Yeo, Borivoje Nikoli, Robert W. Brodersen h... Date Added: 2009-06-18 22:53:20 |
| Learning Exercise.doc Path: Winona >> BIO >> 242 Fall, 2009 Description: Learning Exercise Do this on Friday Rate yourself on each of the study skills, motivation ratings and habits listed below. Give yourself a 1 if you are perfect in that regard and a 6 if you stink. Anything below a 3 is starting to smell and for yo... Date Added: 2009-06-18 22:53:28 |
| climatecodered.pdf Path: Utah >> ECON >> 3960 Fall, 2008 Description: climate code red the case for a sustainability emergency David Spratt Philip Sutton Climate `code red\' The case for a sustainability emergency David Spratt CarbonEquity Philip Sutton Greenleap Strategic Institute Climate Code Red is published by... Date Added: 2009-06-18 22:53:48 |
| appendb-old.pdf Path: UCSD >> SIO >> 227 Fall, 2009 Description: APPENDIX B Some special functions in low-frequency seismology 1. Spherical Bessel functions The functions jl and yl are useful in constructing mode solutions in homogeneous spheres. They satisfy d2 jl 2 djl l(l + 1) + k2 - jl = 0 + 2 dr r dr r2 (B... Date Added: 2009-06-18 22:54:32 |
| Math1111_Test2StudyGuide.pdf Path: Macon State >> MATH >> 1111 Fall, 2009 Description: Math 1111 Test 2 Study Guide Section 2.1: Know and understand the definition of a function and the vertical line test both on page 186. (see #\'s 11-13, 16, 17, 19, 23, 27, 29, 31, 35 pg 194) The domain of a function is the set of x-values or inputs... Date Added: 2009-06-18 22:55:59 |
| CmpE296P-OOAD-L02n.ppt Path: San Jose State >> CMPE >> 296 Fall, 2009 Description: Advanced Object-Oriented Analysis & Design Dr. M.E. Fayad, Professor Computer Engineering Department, Room #283I College of Engineering San Jos State University One Washington Square San Jos, CA 95192-0180 http:/www.engr.sjsu.edu/~fayad 2003 SJSU -... Date Added: 2009-06-18 22:58:38 |
| Computer 3D Desktop.pdf Path: Marshall >> HANDLEY >> 120 Fall, 2009 Description: Desktop effects Compiz: The 3D desktop Chances are that if you\'ve seen any Linux screenshots over the last year or two, they\'ll have shown a really cool spinning cube. Welcome to the world of Compiz. ne of the best features on a modern Linux install... Date Added: 2009-06-18 22:58:54 |
| hwsol3.pdf Path: Utah >> MATH >> 1170 Fall, 2008 Description: Problem Set 3 MATH 1170, Fall 2007 Solutions Graded problems in bold. 1.5 : 15. The first five values are given by repeatedly plugging in the current value into the discrete-time dynamical system vt+1 = 1.5vt . We start with the given initial condit... Date Added: 2009-06-18 22:58:59 |
| 02_Gametogenesis.pdf Path: Utah >> BIOLOGY >> 3360 Fall, 2009 Description: Omne vivum ex ovo - All living things come from eggs. William Harvery, 1651 Gametogenesis This lecture is the preface, so to speak, to embryology; that is, it introduces the development of the specialized germ line of cells from the male and the fem... Date Added: 2009-06-18 23:00:44 |
| cours2_ISM.ppt Path: Neumont >> PHY >> 6791 Fall, 2009 Description: Facult des arts et des sciences Dpartement de physique Astronomie Extragalactique Cours 2: ISM (HI, H , H2) Facult des arts et des sciences Dpartement de physique ISM (Inter-Stellar Medium) Mlange de gaz et de poussire (M gaz /Mpoussire ~ 100) ... Date Added: 2009-06-18 23:03:00 |
| Ch5a.pdf Path: Drexel >> FASH >> 201 Fall, 2009 Description: Fashion From concept to consumer Gini Stephens Frings 7th edition Chapter 5; Textile Fiber and Fabric Production Textile Producers The industry has experienced phenomenal growth It has been costly for the domestic producers Manmade fibers are th... Date Added: 2009-06-18 23:03:32 |
| assessmentbasics.ppt Path: Wilfrid Laurier >> MAR >> 673 Fall, 2009 Description: Learning ASSESSMENT Basics & Paradoxes From Gronlund, N. 1998, The Assessment of Student Acheivemen Agenda 1. Three Stages of Instruction/ Assessment Decisions: Beginning - Readiness and Placement Assessment Middle - Formative evlauation End - ... Date Added: 2009-06-18 23:04:05 |
| Integrals for Term Project.pdf Path: Oregon State >> ENGR >> 213 Fall, 2008 Description: ... Date Added: 2009-06-18 23:04:52 |
| lab1.pdf Path: Mich Tech >> CE >> 4333 Fall, 2008 Description: CE4333 Lab Problem September 19, 2006 A contractor is estimating the amount of earth to be removed from site for grading. The topographic plan is shown in attached figure. The area to be graded includes the grids from B2 to D5. The desired level is 9... Date Added: 2009-06-18 23:06:59 |
| T0444.t04.near-backbone-11-logo.pdf Path: UCSC >> T >> 0444 Fall, 2009 Description: T0444.t04 near-backbone-11 3 2 1 M HH H H H H S S G VD L G TE N L YF Q S MS D TN E S E I K SN E E PL L R KS S R RF V I FP I Q Y P DI W K M Y K Q A Q A S FW T A E E V D LS K D L P H W NK L K A D E K YF I S H I L A FF 1 10 20 30 40 50 60 70 80 90 AG I... Date Added: 2009-06-18 23:07:02 |
| T0444.t06.o_notor2-logo.pdf Path: UCSC >> T >> 0444 Fall, 2009 Description: T0444.t06 o_notor2 5 4 3 2 1 M HH H H H H S S G VD L G TE N L YF Q S MS D TN E S E I K SN E E PL L R KS S R RF V I FP I Q Y P DI W K M Y K Q A Q A S FW T A E E V D LS K D L P H W NK L K A D E K YF I S H I L A FF 1 10 20 30 40 50 60 70 80 90 N 5 4 3 ... Date Added: 2009-06-18 23:07:05 |
| Lecture_01.5.ppt Path: NSCC >> ECON >> 100 Fall, 2009 Description: Econ 100 Lecture 1.5 Essential Concepts and Terms 1-09-2009 Basic Economics Vocabulary Scarcity Opportunity Cost Tradeoffs Benefit/Cost Analysis Economics and Scarcity Lionel Robbins (1932): \"the science which studies human behaviour as a rel... Date Added: 2009-06-18 23:07:42 |
| hw8.ps Path: Maryland >> ENEE >> 244 Fall, 2008 Description: %!PS-Adobe-2.0 %Creator: dvips(k) 5.85 Copyright 1999 Radical Eye Software %Title: hw8.dvi %Pages: 1 %PageOrder: Ascend %BoundingBox: 0 0 596 842 %EndComments %DVIPSWebPage: (www.radicaleye.com) %DVIPSCommandLine: dvips hw8 %DVIPSParameters: dpi=600,... Date Added: 2009-06-18 23:09:13 |
| TuitionDraft.pdf Path: E. Kentucky >> MEDIA >> 3052 Fall, 2009 Description: DRAFT DRAFT DRAFT University of Kansas Guaranteed Four-Year Base Tuition Plan Academic Years 2007-08 through 2012 -13 The University is now completing the third year of a five-year tuition enhancement plan that was endorsed and supported by studen... Date Added: 2009-06-18 23:09:46 |
| Identifying Components Graphic Organizer.pdf Path: Wisc Stevens Point >> KADAM >> 961 Fall, 2009 Description: Identifying Mystery Components DETECTIVE Name_ CRIME FACTS SUSPECTS CLUES MOTIVES RED HERRINGS CULPRIT SOLUTION ... Date Added: 2009-06-18 23:09:58 |
| assign7soln.doc Path: Texas San Antonio >> CS >> 3343 Fall, 2008 Description: ... Date Added: 2009-06-18 23:13:39 |
| coverletter.doc Path: UF >> ENC >> 2210 Fall, 2008 Description: A Proposal on How To Make A Bed Prepared for: Virginia Agnew ENC 2210 Instructor College of Liberal Arts and Sciences University of Florida Sheila Austin College of Agriculture and Life Science University of Florida Mariah Jensen M.E. Rinker Sr. Sc... Date Added: 2009-06-18 23:16:15 |
| 11a_IFT232_Tests.ppt Path: Rush >> IFT >> 785 Fall, 2009 Description: vti_encoding:SR|utf8-nl vti_timelastmodified:TR|04 Apr 2006 18:17:30 -0000 vti_extenderversion:SR|6.0.2.5516 vti_author:SR|PORT-DOMUS-06\\sylvain vti_modifiedby:SR|PORT-DOMUS-06\\sylvain vti_timecreated:TR|04 Apr 2006 18:17:30 -0000 vti_cacheddtm:TX|04... Date Added: 2009-06-18 23:17:43 |
| CUHK_TON01.pdf Path: UCCS >> CS >> 522 Fall, 2009 Description: IEEE/ACM TRANSACTIONS ON NETWORKING, VOL. 9, NO. 6, DECEMBER 2001 801 Adaptive Proportional Delay Differentiated Services: Characterization and Performance Evaluation Matthew K. H. Leung, John C. S. Lui, Member, IEEE, and David K. Y. Yau, Member, I... Date Added: 2009-06-18 23:18:53 |
| mid203.pdf Path: Washington >> MATH >> 308 Fall, 2008 Description: ... Date Added: 2009-06-18 23:19:43 |
| nsc396a_syllabus_s2006.pdf Path: Arizona >> NSC >> 396 Fall, 2008 Description: NSC 396A Survey of Nutrition Careers Spring 2006 Wed 2-2:50 FCS 202 INSTRUCTOR Kelly Jackson, MS, RD Shantz 307 626-3504 kjackson@email.arizona.edu Office hours: by appointment COURSE DESCRIPTION The purpose of this course is to introduce undergradu... Date Added: 2009-06-18 23:20:45 |
| Lecture12.pdf Path: ECCD >> MATH >> 1007 Fall, 2009 Description: 3.7 Higher Derivatives The derivative f of a differentiable function f , is also a function. f may have a derivative of its own, denoted by (f ) = f . f is called the second derivative of f . We also write the second derivative of y = f (x) as d2 y... Date Added: 2009-06-18 23:21:33 |
| PHIntro.pdf Path: Washington >> PHARM >> 445 Fall, 2008 Description: Pharmacy 445 Public Health Applications in Pharmacy Jacqueline Gardner, Ph.D. Professor, Department of Pharmacy Pharmacists\' Role1 Promotion of health improvement, wellness, and disease prevention in cooperation with patients, communities, at-risk p... Date Added: 2009-06-18 23:26:41 |
| arf_pc.txt Path: Berkeley >> ASTRO >> 00236430 Fall, 2009 Description: ;instrument XRT ;exposure 31423.803 ;xunit kev ;bintype counts 0.0000000 0.0049999999 5.0947980 1.00000 0.0049999999 0.0099999998 5.1136897 1.00000 0.0099999998 0.015000000 5.1325862 1.0... Date Added: 2009-06-18 23:26:55 |
| shw1a.pdf Path: UMass (Amherst) >> CHEM >> 122 Fall, 2009 Description: CHEM 122H HonorsGeneral Chemistry 2 February 10th, 2006 Supplemental Homework #1 Duein dassFriday, February 1ih, 2006 1) (3pts) Cydopropane (~Ha) has been used in a mixture with oxygen as an anesthetic; howevethis pra:tice has di minished greatly... Date Added: 2009-06-18 23:27:05 |
| u030606a.pdf Path: UF >> U >> 030606 Fall, 2009 Description: CNS /Update Newsletter Feature Get Connected to IT Connections CNS Document ID: U030606a Last Updated: 6/5/03 UF Computing & Networking Services 112 Bryant Space Sciences Bldg, University of Florida P.O. Box 112050 Gainesville Florida 32611-2050 (3... Date Added: 2009-06-18 23:28:32 |
| QualSp03Ques2Sol.xls Path: Los Angeles Southwest College >> CSE >> 513 Fall, 2009 Description: Matthews\' Answer to Question 2 Qualifying Exam Spring 2003 Original Code Loop LW R1, 1000(R3) ADD R1, R1, R2 SW R1,-1000(R3) SUB R2, R3, 4 BNEZ R3, Loop Rearranged to put store in delay slot and use the sub to avoid one stall cycle Loop LW R1, 1000(R... Date Added: 2009-06-18 23:29:49 |
| ex-02-e-05sd.pdf Path: Bradley >> EE >> 221 Fall, 2009 Description: EE221 Exam No. 2 Spring 2005 1 of 5 Name: _ PLEASE PRINT CLEARLY EE 221 Exam No. 2 (100pts.) General Remarks Do not use back side. The back side of this test will not be graded. Attach more pages if necessary. DL: _ ERR: _ PTS: _ TLGR: _ Problem... Date Added: 2009-06-18 23:30:11 |
| probability_hand.pdf Path: Hofstra >> CSC >> 120 Fall, 2009 Description: $ \" %#! x s { u{ zu x~gA88% R |zxxA s } w u { z { }{ gc|vP~{8~V8|z8~% }~u} |A y u }u{ w u y { m m e x|88v|} l{8~yc|zAx%8gxx! prd z{ z zu { u u z y wu { u u { w }u u w { ... Date Added: 2009-06-18 23:31:29 |
| Genetic Counseling and Consanguineous Relationships.doc Path: Midwestern State University >> BIOL >> 519 Fall, 2009 Description: Genetic Counseling and Consanguineous Relationships Katie Van Horne and Marcie Logsdon Professor Golmulkiewicz BIOL 519: Introduction to Population Genetics This presentation will address some of the basic information about genetic counseling includi... Date Added: 2009-06-18 23:32:14 |
| cm3.pdf Path: Idaho >> ENGR >> 4258 Fall, 2009 Description: ... Date Added: 2009-06-18 23:32:15 |
| Solution_HW2.pdf Path: New Mexico >> ECE >> 340 Spring, 2008 Description: ECE340, Probability and Statistics for Engineers SOLUTIONS TO ASSIGNMENT #2 14. Solution: a. From Fig. P2.1 in the text, we see that if we want to transmit the signal from input to output, the following condition must be satisfied: at least one switc... Date Added: 2009-06-18 23:35:53 |
| area-perimeter.xls Path: Millersville >> EDFN >> 333 Fall, 2009 Description: Sheet1 Problem 1 Problem 2 Problem 3 Problem 4 Problem 5 Problem 6 Page 1 Sheet1 Page 2 ... Date Added: 2009-06-18 23:36:46 |
| part2_XP.ppt Path: CSU Mont. Bay >> CS >> 1020 Fall, 2009 Description: Exploring Windows XP Vol. 1 Part Two - Getting Organized: Windows Explorer and File Management Chapter 2 1 Chapter Objectives Understand the methods available for navigating your computer. Use the Folders button to change navigation mode. D... Date Added: 2009-06-18 23:37:37 |
| lect5.pdf Path: Washington >> ATMOS >> 505 Fall, 2009 Description: ... Date Added: 2009-06-18 23:38:49 |
| Prelab04.pdf Path: UT Arlington >> CSE >> 1310 Fall, 2008 Description: PRELAB #4 (Summer 2006) CSE 1310 1. What is the result of the following expression? 8/4+2*3-4 a) 4 b) 0 c) 2 d) 8 2. What is the result of the following expression? 5+(2*(9+5)-4)/2 a) 12.5 b) 14.5 c) 15 d) 17 3. Which of the following is not a data t... Date Added: 2009-06-18 23:40:41 |
| NitrateFrost.doc Path: Colby >> CH >> 142 Fall, 2009 Description: ... Date Added: 2009-06-18 23:41:08 |
| Lab8_ECE757_FL2006.pdf Path: New Hampshire >> ECE >> 757 Fall, 2008 Description: ECE757/857 - Fundamentals of Communication Systems 1 LABORATORY #8 I/Q modulation OBJECTIVE: To become familiar with I/Q modulation as used in digital communication systems. PREPARATION: 1. Read pages 1-17 of \"HP Application Note 1298, Digital Mod... Date Added: 2009-06-18 23:41:12 |
| Upper and Lower Respiratory.ppt Path: Southern Utah >> NUR >> 410 Fall, 2009 Description: DRUGS FOR COMMON UPPER RESPIRATORY DISORDERS Elsevier items and derived items 2006, 2003 by Saunders, an imprint of Elsevier Inc. Slide 1 ANTIHISTAMINES (H1 BLOCKERS) DECONGESTANTANTS (SYMPATHOMIMETICS) INTRANASAL GLUCOCORTICOIDS ANTITUSSIV... Date Added: 2009-06-18 23:41:50 |
| 8.pdf Path: Berkeley >> M >> 128 Fall, 2009 Description: Solving Systems of Equations Adrian Down February 09, 2006 1 1.1 Solving the linear tri-diagonal system by LU factorization Motivation LU decomposition is a general method for dealing with nonsingular systems. The method essentially represents Gau... Date Added: 2009-06-18 23:41:51 |
| practice3.pdf Path: UCSC >> PH >> 116 Fall, 2009 Description: Physics 116A Practice problem set #3 Winter 2006 Here is a collection of practice problems covering material from Chapters 9 and 10 of McQuarrie and homework sets #810. Along with the rst two practice problem sets, this may help you in preparing f... Date Added: 2009-06-18 23:43:03 |
| review.pdf Path: East Los Angeles College >> ELEC >> 3035 Fall, 2009 Description: ELEC 3035: Review of Part I Ivan Markovsky Representations Autonomous systems and stability Controllability and observability Pole placement ELEC 3035 (Part I) Review of Part I 1 / 34 Input/output representation Bi/o (P, Q) The difference eq... Date Added: 2009-06-18 23:43:47 |
| 5.3 FTC.pdf Path: Delaware >> M >> 241 Fall, 2009 Description: MATH 241 Section 5.3 Page 1 The Fundamental Theorem of Calculus, Part 1 If f is continuous on [a, b], then the function g defined by g ( x ) = f (t ) dt a x for a x b, is continuous on [a, b] and differentiable on (a, b), and g (x) = f(x). ... Date Added: 2009-06-18 23:44:13 |
| Questentree.doc Path: Neumont >> ORCO >> 6304 Fall, 2009 Description: Nom: Date de naissance: Adresse : Ville: Code Postal : ge : Tlphone: Courriel: Tlc. : 1. Contexte scolaire Niveau atteint : Matires prfres / moins aimes: Auto-valuation des aptitudes scolaires: Aspiration scolaires: valuation globale de l\'cole: (aim... Date Added: 2009-06-18 23:44:32 |
| readme.txt Path: Loyola Maryland >> CS >> 201 Fall, 2009 Description: Hangman source code The Hangman program consists of the following source code file: Hangman.java Also, for the program to run you need the follow class files: Condemned.class Dictionary.class The program will run with these class files. When yo... Date Added: 2009-06-18 23:44:52 |
| Corrections negatifs.doc Path: Eckerd >> NVUFRENCH >> 301 Fall, 2009 Description: 1. II. Mettez les phrases suivantes la forme ngative. Attention, ne rpondez pas aux questions, mettez-les la forme interrogative ngative : 1. Elle portait une robe du soir en satin. Elle ne portait pas de robe du soir en satin. 2. Je voulais dispar... Date Added: 2009-06-18 23:44:55 |
| Composition3-Vincent.doc Path: Eckerd >> NVUFRENCH >> 301 Fall, 2009 Description: Fte de Promotion Il se place devant la porte, il est rempli d\'agitation au fur et mesure que les heures approchent. J\'espre que la personne qui m\'a sauv est dj ici, il pense. Avec un soupir d\'abandon, Vincent frappe sur la porte d\'entre de Nathalie ... Date Added: 2009-06-18 23:45:10 |
| lidar.pdf Path: Washington >> ESRM >> 201 Fall, 2008 Description: REVIEWS REVIEWS REVIEWS On the potential for high-resolution lidar to improve rainfall interception estimates in forest ecosystems Brian E Roth1*, K Clint Slatton2,3, and Matthew J Cohen1 Closing the gaps in the water budget of forested ecosystems i... Date Added: 2009-06-18 23:46:31 |
| OCD_LCO_F06a_T01_V1.2.doc Path: USC >> CSCI >> 577 Fall, 2009 Description: Operational Concept Description Version no. 1.2 Operational Concept Description (OCD) California Science Center Newsletter System Team 1 Jeremy Stoller Vincent Tsan Nisarg Patel Harsh Vardhan Saboo Abhilash Augustine Jaimin Vaidya Mitesh H Shah Mu... Date Added: 2009-06-18 23:47:56 |
| math 2406 - hw2.pdf Path: Georgia Tech >> MATH >> 2406 Fall, 2008 Description: Math 2046 HW2: (1.15: 15, 1.15: 20, 1.17: 3, 3.5: 2, 3.5: 10) Brian Black, Patrick Brandt 1.15: 15. Given three linearly independent vectors in A, B, C in Rn. Prove or disprove each of the following: (a) A B , BC , AC are linearly independent. Proof... Date Added: 2009-06-18 23:53:35 |
| equity analysis project.doc Path: Illinois State >> FIL >> 242 Fall, 2008 Description: DEPARTMENT OF FINANCE, INSURANCE, & LAW COLLEGE OF BUSINESS ILLINOIS STATE UNIVERSITY Fall 2003 FIL 242 Investments Ahlgrim EQUITY ANALYSIS PROJECT (100 points) Due Date Friday, December 6th (the last day of class) OBJECTIVE Evaluate the attractiven... Date Added: 2009-06-18 23:53:47 |
| syllabus.pdf Path: Duquesne >> JMA >> 345 Fall, 2009 Description: Web Development Tools JMA 345 Department of Journalism and Multimedia Arts Section 01 at 1:00-1:50 on MWF in 205 College Hall Instructor: Nick Sinagra Office: 204 College Hall Office Hours: By Appointment E-Mail: sinagra987@duq.edu Class Web Site: ht... Date Added: 2009-06-18 23:54:31 |
| sept_04_charts.ppt Path: Creighton >> ATS >> 571 Fall, 2009 Description: ... Date Added: 2009-06-18 23:55:38 |
| discourse a.ppt Path: Laurentian >> ANTH >> 2510 Fall, 2009 Description: DISCOURSE AND POWER Broadly speaking, inculcation is the mechanism of power-holders who wish to preserve their power, while communication is the mechanism of emancipation and the struggle against domination (Fairclough 2003: 63). Two headlines: The ... Date Added: 2009-06-18 23:57:21 |
| comment8.txt Path: Purdue >> GER >> 524 Fall, 2008 Description: Noch einige Hinweise zur Pruefung . 1. LESEVERSTEHEN grammatische und Rechtschreibefehler werden hier nicht gewertet, nur Fakten 2. HOERVERSTEHEN die Zusammenfassung (also der dritte Teil) kann in der Landessprache geschrieben werden; we... Date Added: 2009-06-18 23:58:01 |
| Day7_option_value_principles_and_binomial_intro.ppt Path: Portland >> FIN >> 441 Winter, 2008 Description: Overview of Tuesday, April 21 discussion: Option valuation principles & intro to binomial model FIN 441 Prof. Rogers Basic Notation and Terminology Symbols S0 (stock price) X (exercise price) T (time to expiration = (days until expiration)/365) ... Date Added: 2009-06-18 23:58:21 |
| lecture14.pdf Path: Texas Tech >> CS >> 3352 Fall, 2008 Description: Make can also be used in conjunction with SCCS and RCS SCCS or Source Code Control System keeps backup versions of source code files. RCS or Revision Control System does the same thing. RCS is a freeware product and is installed on tornado (man rcsin... Date Added: 2009-06-18 23:58:36 |
| Week13_2.pdf Path: Allan Hancock College >> COMP >> 5212 Fall, 2009 Description: Outline Review Postconditions of the course COMP5212 Week 13 Preparing for the Exam School of Information Technologies School of Information Technologies 2 Postconditions Ability to read and write correct, clean code in C that allocates, deall... Date Added: 2009-06-18 23:59:30 |
| modl.txt Path: Berkeley >> ASTRO >> 00154112 Fall, 2009 Description: chi^2/nu= 103.66187 / 50 The fit is rejectable at 99.998724 % Confidence -9.68000 -4.64000 385.67264 -4.64000 -3.68000 636.54480 -3.68000 -1.52000 761.84694 -1.52000 -0.56000... Date Added: 2009-06-18 23:59:33 |
| arf_pc.txt Path: Berkeley >> ASTRO >> 00154112 Fall, 2009 Description: ;instrument XRT ;exposure 70770.209 ;xunit kev ;bintype counts 0.0000000 0.0049999999 13.919642 1.00000 0.0049999999 0.0099999998 13.969296 1.00000 0.0099999998 0.015000000 14.018950 1.0... Date Added: 2009-06-18 23:59:40 |
| favfruit.xls Path: U. Houston >> CUIN >> 3111 Fall, 2008 Description: What is your favorite Fruit? girls banana orange strawberries pineapple watermelon grapes peach apple 1 2 4 1 7 1 0 3 boys 1 0 2 0 6 1 2 2 total 2 2 6 1 13 2 2 5 What is your favorite fruit? 14 12 10 8 6 4 2 0 What is your favorite Fruit? fruit gi... Date Added: 2009-06-19 00:02:19 |
| hw5.pdf Path: Washington >> EE >> 471 Spring, 2009 Description: EE 471 Spring 2009 HW# 5 Due May 5, 2009 Take the single cycle processor developed in class, and add the following instructions. Note that each instruction will require a separate datapath and control logic that extends the one in class do not do o... Date Added: 2009-06-19 00:03:48 |
| lab3.pdf Path: Washington >> EE >> 471 Spring, 2009 Description: LAB 3 MIPS Single-Cycle CPU * Warning this lab takes significantly longer than the previous two. Start EARLY * Introduction: For this project you are to design a simple 32-bit MIPS Single-Cycle CPU. The CPU instructions to be implemented are LW, SW,... Date Added: 2009-06-19 00:04:12 |
| 041309.pdf Path: Washington >> EE >> 400 Fall, 2009 Description: ... Date Added: 2009-06-19 00:05:09 |
| TP5H2008.doc Path: Neumont >> DIFT >> 1969 Fall, 2009 Description: IFT 1969 Charg de cours: Yves Claude nonc du T.P. #5 Session hiver 2008 Date de remise: Au plus tard le lundi 14 avril 2008, avant minuit. Pnalit de retard: Chaque jour de retard entranera une pnalit de 10 points par jour. Aucun travail de ne sera... Date Added: 2009-06-19 00:05:48 |
| aloe.xls Path: Uni. Westminster >> STL >> 1007 Fall, 2009 Description: ALOE = Assets, Liabilities & Owner Equity Copyright 2007 ACBA - All Rights Reserved BusinessAllstars.com Name Net Assets Cash Acc/Rec Inventory Other CA Acc/Pay (Minus) Net WC Equipment Buildings Land Other LTAssets Net Assets $50,000 $75,000 $100,0... Date Added: 2009-06-19 00:06:30 |
| HW12 Sol.pdf Path: UT Arlington >> EE >> 2446 Fall, 2008 Description: HW12 Sol 16.4-11,16.4-15, 16.5-5, 16.7-5, SP16-3, DP16-2 P16.4-11 Voltage division: 1 Cs V0 ( s ) = V ( s ) , V1 ( s ) = (1 + s R C )V0 ( s ) 1 1 R+ Cs KCL: V1 - Vs V -V + 1 0 + (V1 -V0 ) n C s = 0 mR R Combining these equations gives: 1 sC 2 ... Date Added: 2009-06-19 00:06:58 |
| RobertReid.doc Path: Berkeley >> I >> 247 Fall, 2009 Description: Pre Focus Group Questionnaire This should take about five to ten minutes. This Pre Focus Group Questionnaire will help us to frame the discussion Monday night according to the groups\' travel experiences and preferences. Please answer the questions... Date Added: 2009-06-19 00:07:39 |
| Lab4.doc Path: Central Washington University >> CS >> 112 Fall, 2009 Description: Lab 4 Names: _ _ Chapter 4 Exercises As you complete each exercise, show your world to your instructor or TA and have them sign it as completed. 1. Complete Chapter 4, Exercise 9, Enhanced cleverSkater (a) and (b) _ Start with the Chap04SkaterWith... Date Added: 2009-06-19 00:11:20 |
| StoryboardAssignment.doc Path: Central Washington University >> CS >> 112 Fall, 2009 Description: Score: _ out of 2 Storyboards Sketch your Visual Storyboards for the movie you intend to produce for your Alice programming assignment. By writing your name below, you are pledging that the storyboards you are submitting are your own and not that of... Date Added: 2009-06-19 00:11:24 |
| cse472exm3f05.doc Path: Penn State >> CSE >> 472 Fall, 2008 Description: CSE472 Fall 2005 Final Exam Name: _ Student ID (last 4 digits): _ Please write your name on every page. Write your solutions clearly. You may use backside of each page for scratch but the solutions must be shown on the designated place near (or ... Date Added: 2009-06-19 00:12:10 |
| solhomework8.pdf Path: San Jose State >> EE >> 160 Fall, 2008 Description: EE160 - Fall 2004 Solution Homework # 8 1. (a) Note that si (t) = 2E T San Jos State University e cos(2fi t), for i = 1, 2. In other words, a = a2 T 2 2E T . Alternatively, the energy of s1 (t) (or s2 (t) is equal to E = P [error] = Q E N0 . It... Date Added: 2009-06-19 00:14:20 |
| ptc1.pdf Path: UNC Greensboro >> ISM >> 110 Fall, 2008 Description: Potato Chip Cookies Potato chips give these cookies a crunchy texture and eliminate the need for baking soda. Ingredients: 2 sticks of butter (softened) c.dark brown sugar (firmly packed) c.crushed potato chips c.chopped pecans 1 tsp. vanilla ext... Date Added: 2009-06-19 00:14:27 |
| week0402.pdf Path: Toledo >> CSC >> 407 Fall, 2009 Description: CSC407: Software Architecture Winter 2007 Math Greg Wilson BA 4234 gvwilson@cs.utoronto.ca 1 2 1 3 4 2 5 6 3 So What Is Architecture? Decomposition of system into components/modules/subsystems, which defines: Component interfaces What a c... Date Added: 2009-06-19 00:17:28 |
| week4-patintro.ppt Path: Toledo >> CSC >> 407 Fall, 2009 Description: CSC407: Software Architecture Summer 2006 Design Patterns Greg Wilson BA 3230 gvwilson@cs.utoronto.ca 1 Design Patterns Design patterns represent solutions to problems that arise when developing software within a particular context Pattern = probl... Date Added: 2009-06-19 00:17:30 |
| Ferree 2004 - The Gay Wedding Backlash.doc Path: Washington >> SOC >> 585 Fall, 2009 Description: THE GAY WEDDING BACKLASH Newsday 2004 A threat to modern marriage To insist on two genders is to open the door to separate gender roles, not equal partnership BY MYRA MARX FERREE Myra Marx Ferree is a professor of sociology at the University of Wisc... Date Added: 2009-06-19 00:18:12 |
| class6.ppt Path: Kentucky >> MA >> 375 Fall, 2008 Description: M a 375 Communi cati ng M athemati cs Carl Eberhar t and Paul Eaki n Cl ass 6 - M aki ng a pr obl em set Pr obl em Set M aki ng M aki ng new pr obl em sets i s one of a teacher \'s jobs. I t i s ni ce to have the tool s to do i t i n a pr ofessi ona... Date Added: 2009-06-19 00:18:29 |
| Acknowledging.doc Path: Washington >> SOC >> 352 Fall, 2008 Description: 1Acknowledging, Paraphrasing, and Quoting Sources When you write at the college level, you often need to integrate material from published sources into your own writing. This means you need to be careful not to plagiarize: \"to use and pass off (the i... Date Added: 2009-06-19 00:18:32 |
| effective presentation.ppt Path: UConn >> CE >> 294 Fall, 2009 Description: Effective Technical Presentations Norman W. Garrick Tell the Story Right Organize Your Ideas Remember a story has a BEGINNING END MIDDLE Use an outline to help keep you organized Orient your audience Know Your Audience What do they k... Date Added: 2009-06-19 00:19:12 |
| 3rda105.doc Path: ASU >> PUBLIC >> 100 Fall, 2009 Description: The Musical A Film Journal by Sean J. Carney ENG 105 ONLINE Dr. Steve Beatty 1 - Pink Floyd\'s The Wall: One Hell of a Trip An Essay by Sean Joseph Carney ENG 105 Online, Film Journal Album Advertisement, 1979 It only takes one small piece of squ... Date Added: 2009-06-19 00:19:24 |
| L1.pdf Path: UNC Wilmington >> C >> 121 Fall, 2009 Description: csc 121 lab 1 August 26, 2005 Becoming familiar with MS-DOS, the command prompt, entering a simple Java program via a text editor, and compiling and running a program using the command prompt. [If you are using your own computer, you may need to dow... Date Added: 2009-06-19 00:20:25 |
| displays.pdf Path: Virginia Tech >> CS >> 5754 Fall, 2008 Description: VE displays Doug Bowman 1 Introduction to displays Display: device which presents perceptual information Often `display\' used to mean `visual display\' Goal: display devices which accurately represent perceptions in simulated world (i.e., higher lev... Date Added: 2009-06-19 00:20:28 |
| multimedia_6.pdf Path: Virginia Tech >> CS >> 5516 Spring, 2003 Description: Multimedia Applications Multimedia requirements Streaming Phone over IP Recovering from Jitter and Loss RTP Diff-serv, Int-serv, RSVP Multimedia Applications Srinidhi Varadarajan 2 Application Classes Typically sensitive to delay, but can tolerate... Date Added: 2009-06-19 00:20:44 |
| Answers to Exam 1 Review.pdf Path: UF >> STA >> 3024 Summer, 2008 Description: Answers to Exam 1 Review: 1a) This is a one-proportion problem. Since .5 is not in the interval and the interval contains values greater than .5, we concluded that in vitro fertilization does favor the female gender. b) This is a difference in two me... Date Added: 2009-06-19 00:20:47 |
| slac-pub-11024.pdf Path: Stanford >> PUBS >> 11000 Fall, 2009 Description: SLAC-PUB-11024 Black holes in many dimensions at the LHC: testing critical string theory Stanford Linear Accelerator Center, 2575 Sand Hill Rd. Menlo Park, CA 94025 (Dated: March 17, 2005) Critical string theory requires that the number of extra dim... Date Added: 2009-06-19 00:21:11 |
| ParticipantWorksheet.doc Path: Sanford-Brown Institute >> DOCS >> 20090610 Fall, 2009 Description: Using the Strategic Mapping Process to Systemically Focus District Improvement Efforts A process for assisting states to better align their intervention and support strategies for underperforming districts and schools RAW NOTES AND DATA {School N... Date Added: 2009-06-19 00:21:35 |
| quiz_example_solution.pdf Path: Ohio State >> ECE >> 209 Fall, 2008 Description: Name: Instructor Table number: Solution ECE 209: Circuits and Electronics Laboratory Lab 0: Laboratory Title Quiz (10 points) Description. Complete this quiz with closed book and closed notes. Problem Q0-1: Quiz Question with Solution What is 2 +... Date Added: 2009-06-19 00:21:52 |
| lp.pdf Path: Kentucky >> AEC >> 302 Fall, 2008 Description: AEC 302: Agricultural Management Principles Fall 2003 Lecture Notes: October 28, 2003 Linear Programming Instructor: Carl Dillon For additional information, please contact Dr. Dillon at: cdillon@uky.edu Linear Programming How can I use the comput... Date Added: 2009-06-19 00:22:17 |
| tut02.pdf Path: Allan Hancock College >> ELEC >> 2500 Fall, 2009 Description: ELEC2500 Introduction to Telecommunications Amplitude and frequency modulation School of Electrical Engineering and Computer Science The University of Newcastle, Australia ELEC2500 Introduction to Telecommunications Tutorial 2-Amplitude and freque... Date Added: 2009-06-19 00:24:02 |
| abstract.doc Path: NJIT >> AB >> 224 Fall, 2009 Description: ABSTRACT FABRICATION AND CHARACTERIZATION OF HIGH PERFORMANCE Si-SiO2 BACK ILLUMINATED CMOS PHOTODIODE ARRAY by Amrita Banerjee With the rapid development in low-cost CMOS technology, silicon photodiodes are currently recognized as promising core of ... Date Added: 2009-06-19 00:25:46 |
| exam.pdf Path: Wisconsin >> ECE >> 738 Fall, 2008 Description: Final Exam ECE 738 Brian Eriksson Problem 1) Create a multi-resolution decomposition of an image 1 2 3 2 3 2 4 3 4 4 The bitstream is encoded using Reed-Solomon (RS). Layer-1 is (48,1) Layer-2 is (48,3) Layer-3 is (48,12) Layer-4 is (48,48) (must ... Date Added: 2009-06-19 00:26:19 |
| CPSC461-A2-Sol.pdf Path: Wilfrid Laurier >> CPSC >> 461 Fall, 2009 Description: ... Date Added: 2009-06-19 00:27:17 |
| emoticons.ppt Path: Washington >> LIS >> 549 Fall, 2008 Description: Emoticons COLLECTED BY D.A. CLEMENTS Asian Emoticons (^_^) Laughing (>_<)> Troubled (^_^;) Troubled (ToT) Crying m(_ _)m Apologising (^;) Shy (?) Grinning (?)/ Joyful (?;) Surprised (#^.^#) Shy (*?`*) ... Date Added: 2009-06-19 00:28:08 |
| net4_worksheet.doc Path: Washington >> LIS >> 549 Fall, 2008 Description: NET-4 Worksheet: Security Exercises LIS 549 Spring 2008 Name: _ Lab 1: Security Quiz Objective Try out you security knowledge on a couple online security quizzes. Step 1 Go to the SonicWALL Phishing IQ Test (http:/www.sonicwall.com/phishing/), look... Date Added: 2009-06-19 00:28:08 |
| GE300_Schedule_05_06_Backup.doc Path: MSOE >> GE >> 300 Fall, 2009 Description: Tentative GE300 Schedule Winter Quarter 2005-2006 WEEK/TIME-PM 11/29/05 5:00-5:50 12/01/05 5:00-5:50 12/06/05 5:00-5:50 12/08/05 5:00-5:50 12/13/05 5:00-5:50 12/15/05 5:00-5:50 12/20/05 5:00-5:50 01/05/06 5:00-5:50 01/10/06 5:00-5:50 TOPIC GE-300: ... Date Added: 2009-06-19 00:28:52 |
| STob2pg2.pdf Path: Wisc Stevens Point >> AHANS >> 634 Fall, 2009 Description: ... Date Added: 2009-06-19 00:29:47 |
| Review Questions_Ch13_Closure.doc Path: UNLV >> IS >> 488 Fall, 2008 Description: Review Questions 1. How does the project audit differ from the performance measurement control system discussed in Chapter 13? The project audit is a macro view of project performance as a part of the total organization. Although the audit is concern... Date Added: 2009-06-19 00:30:41 |
| Chapter_2.pdf Path: Auburn >> RAL >> 0011 Fall, 2009 Description: Economic Freedom of the World: 2005 Annual Report 29 Chapter 2: Economic Freedom and Peace by Erik Gartzke Introduction With war in the Middle East and the prospect of terrorist attacks at sites ranging from major airports to the local shopping mal... Date Added: 2009-06-19 00:30:42 |
| bat_hdr.txt Path: Berkeley >> ASTRO >> 00348152 Fall, 2009 Description: SIMPLE = T / file does conform to FITS standard BITPIX = 8 / number of bits per data pixel NAXIS = 0 / number of data axes EXTEND = T / FITS dataset may contain extensio... Date Added: 2009-06-19 00:31:04 |
| libjpeg.doc Path: UCSC >> CMPS >> 161 Fall, 2008 Description: USING THE IJG JPEG LIBRARY Copyright (C) 1994-1998, Thomas G. Lane. This file is part of the Independent JPEG Group\'s software. For conditions of distribution and use, see the accompanying README file. This file describes how to use the IJG JPEG libr... Date Added: 2009-06-19 00:31:25 |
| Exam1S02.doc Path: Evansville >> CS >> 210 Fall, 2009 Description: CS 210 Hour Exam 1 Name_ January 28, 2002 1. Write a C+ equation for the following algebraic equation. Take all variables to be int. ab e y=k + - _ c ad 2. If i = 3, j = 12, and k = 4, determine whether each of the following is TRUE or FALSE. A) (i... Date Added: 2009-06-19 00:31:38 |
| reg.txt Path: Arkansas Little Rock >> C >> 201 Fall, 2009 Description: CMPUT 201, Winter 1996 - (C) David Southwell Regular Expressions c ^ $ . [abc] [d-k] [^xyz] Any character; use \\c if a specialdenotes the start of the linedenotes the end of the lineany single charactera, b or c are matchedd,e,f,g,h,i,j or k are mat... Date Added: 2009-06-19 00:32:53 |
| stack.ex.doc.ps Path: Arkansas Little Rock >> C >> 201 Fall, 2009 Description: %!PS-Adobe-3.0 %Title: (Microsoft Word - stack.ex.doc) %Creator: (Microsoft Word: LaserWriter 8 8.6.5) %CreationDate: (11:31 PM Sunday, March 25, 2001) %For: (T.A. Marsland) %Routing: (mailto:\00Tony.Marsland@ualberta.ca) %Pages: 14 %DocumentFonts: ... Date Added: 2009-06-19 00:32:58 |
| Edward Albert proposal.doc Path: San Diego State >> ARCHIVED >> 240 Fall, 2009 Description: Edward Albert Art 240 Website Proposal The Upper Level The purpose of this web address is to exhibit my personal portfolio. Works of art ranging in various mediums will embrace the screen. The companies name is the upper level. Its inception began i... Date Added: 2009-06-19 00:33:02 |
| FINALBOOKCOVER2006.pdf Path: San Diego State >> ARCHIVED >> 240 Fall, 2009 Description: L OVE G AME LOVE GAME Tennis found its most dominant force when Russian Marat Safin arrived in the men\'s tennis tour in 2001 as an unranked player. As a seventeen year-old, the then tennis phenom shocked the tennis world by easily defeating top ten p... Date Added: 2009-06-19 00:33:10 |
| b6sol.pdf Path: Duke >> STA >> 113 Fall, 2008 Description: STA 113, Bonus Question 6 Notes Zhi Ouyang zo2@stat.duke.edu March 29, 2005 Only solution for Bonus 6.2 is posted, and Bonus 6.1 moved to Bonus Question 7. Suppose X1 = 10X and Y1 = 10Y , then their densities are pX1 (x1 ) = pY1 (y1 ) = 1/6 x1 = 10, ... Date Added: 2009-06-19 00:33:23 |
| mat13.txt Path: Duke >> STA >> 113 Fall, 2008 Description: STA113 Spring 2005 Lab 3Week 13 Apr 15p-values>x=normrnd(0,1,10,1)>help ttest>[h,p,ci]=ttest(x,1,.10, -1) % test true mean=1, vs mean<1, alpha=.10>tstat=(mean(x)-1)/(std(x)/sqrt(10)>tcdf(tstat,10-1) % lower tail area>[h,p,ci]=ttest(x,1,.10,0) % two-s... Date Added: 2009-06-19 00:33:24 |
| index.txt Path: Berkeley >> ASTRO >> 00114797 Fall, 2009 Description: 0.33000004 1.2100000 9.3523981 -0.11793466 23039.309 1.2100000 584644.69 9.6246057 -1.2759088 13479.412 ... Date Added: 2009-06-19 00:33:52 |
| slac-pub-12653.pdf Path: Stanford >> PUBS >> 12500 Fall, 2009 Description: SLAC-PUB-12653 July 2007 OVERALL HOM MEASUREMENT AT HIGH BEAM CURRENTS IN THE PEP-II SLAC B-FACTORY* A. Novokhatski#, SLAC, Menlo Park, CA 94025, U.S.A. Abstract We describe a simple method of measuring the total Higher Order Mode (HOM) losses and t... Date Added: 2009-06-19 00:34:37 |
| Chapter7.doc Path: Willamette >> CS >> 150 Fall, 2009 Description: Chapter 7 Conditional Statements Introduction In the old procedural paradigm, writing a program was essentially the construction of an algorithm (see \"Definition of Algorithm\" at the beginning of Chapter 1, \"Programming is Like Juggling\"). To design ... Date Added: 2009-06-19 00:35:43 |
| p151prelab4.pdf Path: Michigan >> P >> 151 Fall, 2009 Description: Pre-Lab Lab 4 - Capacitance 1) Explain how you will charge the `demonstration\' capacitor in the first half of the lab. Why is it important to only touch the movable plate of the capacitor? Where does the charge on the fixed plate come from? 2) The A... Date Added: 2009-06-19 00:36:20 |
| lec25.ppt Path: Texas A&M >> CVEN >> 302 Fall, 2008 Description: Numerical integration Idea is to do integral in small parts - like the way you first learned integration - a summation 12 10 8 6 4 2 0 3 5 7 9 11 13 15 Numerical methods just try to make it faster and more accurate Newton-Cotes Simpson\'s rule R... Date Added: 2009-06-19 00:36:52 |
| calculate average.xlsx Path: Alabama >> PH >> 012 Fall, 2009 Description: grade you want 73 first test second test HW average in class 92 50 90 90 grade you need on the final 52 ... Date Added: 2009-06-19 00:40:26 |
| froot-thaler.pdf Path: Toledo >> ECO >> 328 Fall, 2009 Description: ... Date Added: 2009-06-19 00:42:39 |
| sachstornell.pdf Path: Toledo >> ECO >> 328 Fall, 2009 Description: ... Date Added: 2009-06-19 00:42:45 |
| rot_coord.pdf Path: Texas A&M >> ATMO >> 336 Fall, 2008 Description: Like a Record, Baby: The Rotating Coordinate Transformation (Atmo 336, Spring 2009) Getting Started. Life would be a lot easier if we lived in an inertial reference frame. (Ok, maybe just dynamics class would be easier.) But we don\'t: we live in a ro... Date Added: 2009-06-19 00:42:53 |
| 1213-tallentire-toruth.pdf Path: Virginia Tech >> USA >> 1924 Fall, 2009 Description: Tallentire to Ruthenberg [Dec. 13, 1924] 1 Letter to C.E. Ruthenberg, Executive Secretary, Workers Party of America, in Chicago from Norman H. Tallentire, WPA District 12 Organizer in Seattle, Dec. 13, 1924. A document in the Comintern Archive, f. ... Date Added: 2009-06-19 00:46:13 |
| ncoproj_pad.txt Path: Glasgow Caledonian University >> EE >> 194 Fall, 2009 Description: Release 7.1.03i - par H.41 Copyright (c) 1995-2005 Xilinx, Inc. All rights reserved. Mon May 01 10:20:47 2006 INPUT FILE: ncoproj_map.ncd OUTPUT FILE: ncoproj_pad.txt PART TYPE: xc3s1000 SPEED GRADE: -5 PACKAGE: ft... Date Added: 2009-06-19 00:46:59 |
| sponsors.pdf Path: UNC >> READ >> 5113179 Fall, 2009 Description: NCLGISA Spring Sponsors First Name Donna Brian Rob Blair Debbie Chris Kurt Kendall Zeke Hari John Tom Jill Glenn Dan Josh Connelly Rick David Michael Nancy Susan Ted Jennifer Jeff Conor Lisa Mike Elyce Chad Jody DeLane Keith Mike Andy Jay Kevin Wend... Date Added: 2009-06-19 00:49:18 |
| names.txt Path: Michigan Flint >> SORT >> 275 Fall, 2009 Description: Boyd,Michael Roberts,Sally Green,Gene Piper,Peter Neuman,Alfred Roast,Chuck Hooper,Grace Coder,Carol Boole,George Brown,Robert Mouse,Mickey Johnson,Lyndon Johns,John Brown,Betty Programm... Date Added: 2009-06-19 00:49:20 |
| sol5.ps Path: Carnegie Mellon >> STAT >> 218 Fall, 2009 Description: %!PS-Adobe-2.0 %Creator: dvipsk 5.58f Copyright 1986, 1994 Radical Eye Software %Title: sol5.dvi %Pages: 5 %PageOrder: Ascend %BoundingBox: 0 0 612 792 %DocumentPaperSizes: Letter %EndComments %DVIPSCommandLine: dvips -o sol5.ps sol5.dvi %DVIPSParame... Date Added: 2009-06-19 00:50:30 |
| course assignment write up.doc Path: CSU San Marcos >> OCEAN >> 609 Fall, 2009 Description: SCM 809 Course assignment write-up Summer 2009 Rationale: As a follow-up to the syllabus design assignment, this assignment gives you experience guiding students through exercises intended to support the course objectives and provide assessment tools... Date Added: 2009-06-19 00:51:19 |
| September 1.doc Path: Appalachian State >> NS >> 43996 Fall, 2009 Description: September 1, 2004 Wednesday Long Lasting Empire Day 13 Goals: 3. Monarchies and Empire- The learner will investigate significant events, people, and conditions in the growth of monarchial and imperial systems of government. 2, 8 Objectives: 3.2 D... Date Added: 2009-06-19 00:53:00 |
| Chapter32.pdf Path: BYU >> PS >> 100 Fall, 2008 Description: Physical Science 100 Chapter 32, Plate Tectonics: A Working Model for the Earth Plate tectonics: The outer rigid layer of the earth is fractured into plates The plates float on the partially melted asthenosphere Convection currents carry the plat... Date Added: 2009-06-19 00:53:19 |
| bamtable.doc Path: Berkeley >> I >> 213 Spring, 2009 Description: <?xml version=\"1.0\" encoding=\"UTF-8\"?> <Error><Code>NoSuchKey</Code><Message>The specified key does not exist.</Message><Key>1358146da5fec9f57ddfeb1676d291a832fbbd08.doc</Key><RequestId>5 AC43E0F94DBAB0C</RequestId><HostId>i21cPUAE3R9EdCUYIKA2lDF2QaP... Date Added: 2009-06-19 00:54:35 |
| IHUM-Lee.pdf Path: Stanford >> GROUP >> 0506 Fall, 2009 Description: Introduction to the Humanities Spring 2005 Winner Jessica Lee Instructor\'s Foreword In \"Death of the Faces of God\" Jessica Lee unmasks the heart of religion in modernity, an awareness of the reciprocity between heaven and earth which renders not onl... Date Added: 2009-06-19 00:57:34 |
| Hw 1 CS 428.pdf Path: Cornell >> CS >> 428 Fall, 2009 Description: CS 428: Homework I ([*] =15 points bonus) Due Thursday Sept 14 at 2:30PM. 1. Write a Matlab function that computes the interaction energy of N water molecules and the forces that they exert on each other. It is useful to separate the calculation to d... Date Added: 2009-06-19 00:58:06 |
| Lec8.pdf Path: Montana >> PH >> 221 Fall, 2009 Description: Newtons\' Third Law Announcement 1. For all problems: Draw Free Body Diagrams 2. Thurs. Feb. 14: 5-min, in-class quiz: Free Body Diagrams Come prepared to draw FBDs according to the rules Rules for Free Body Diagrams 1. 2. 3. 4. Label the free body ... Date Added: 2009-06-19 00:58:11 |
| iat102proj.pdf Path: Sveriges lantbruksuniversitet >> WEEK >> 102 Fall, 2009 Description: Superstylize Me, Says Game Boy Lorem ipsum dolor sit amet, consectetuer sadipscing elitr, sed diam nonumy eirmod tempor invidunt ut labore et dolore magna aliquyam erat, sed diam voluptua. At vero eos et accusam et justo duo dolores et ea rebum. Stet... Date Added: 2009-06-19 00:58:59 |
| notes-6up.pdf Path: Allan Hancock College >> CS >> 9311 Fall, 2009 Description: Relational Algebra Relational Algebra Relational algebra (RA) can be viewed as . Some analogies: a mathematical system for manipulating relations, or relational algebra is a \"machine language\" for RDBMSs a data manipulation language (DML) for the ... Date Added: 2009-06-19 01:00:31 |
| PAE3556.t04.str2-logo.pdf Path: UCSC >> E >> 3556 Fall, 2009 Description: PAE3556.t04 str2 4 3 2 1 157 160 170 180 190 Y Z Y Z 4 3 2 1 T Z Y A T Y A S T A 200 EL N LNCTC RLGLMPYEIFVRRGNRYIV A KF Y LN A S SP R S K KA F F I MG E G G S T 207 NV L ... Date Added: 2009-06-19 01:02:32 |
| earthquakelab.doc Path: Purdue >> EAS >> 102 Fall, 2008 Description: Classroom Hazard Hunt Are free-standing cabinets, bookcases, and wall shelves secured to a structural support? Are heavy objects removed from shelves above the heads of seated students? Are aquariums and other potentially hazardous displays lo... Date Added: 2009-06-19 01:03:43 |
| designpresentation.pdf Path: Glasgow Caledonian University >> CS >> 190 Fall, 2009 Description: Design Presentation Seth Rashmi Vista Dan Design and Requirements David David Rashmi Documentation Seth Bridget Seth David Bridget MAC System Independent Components (Javascript) Rashmi Dan Documentation is associated with all other tasks... Date Added: 2009-06-19 01:09:02 |
| OOP.ps Path: Cornell >> CS >> 211 Fall, 2008 Description: #%-12345X@PJL JOB @PJL SET RESOLUTION=600 @PJL ENTER LANGUAGE=POSTSCRIPT %!PS-Adobe-3.0 %Title: Untitled Document %Creator: Windows NT 4.0 %CreationDate: 12:7 8/31/1999 %Pages: (atend) %BoundingBox: 13 12 780 598 %LanguageLevel: 2 %DocumentNeededFont... Date Added: 2009-06-19 01:13:21 |
| testing.pdf Path: SUNY Albany >> CSI >> 518 Fall, 2009 Description: 7 ( y E D 7 ) ` 1 ) G S` ` y 3dH1 2A7 be1 Q 3Y01 51dC U $` 9 HPFBC B87 3fA7 5320( \' 7 ) ` 7 ( y E D... Date Added: 2009-06-19 01:13:31 |
| syl-518.doc Path: SUNY Albany >> CSI >> 518 Fall, 2009 Description: CSI 518 Software Engineering Fall 2007 Course Handout TTH 1:15 2:35 HU019 http:/www.albany.edu/~csi518 1. Instructor: Prof. Mei-Hwa Chen Computer Science Department, LI67G mhc@cs.albany.edu Voice Mail: (518)442-4283 Office hours: TTH: 12:00 1:00 pm... Date Added: 2009-06-19 01:13:36 |
| Usability Test.doc Path: Mt. Mercy >> IBS >> 540 Fall, 2009 Description: Plan Organize.Com web site will have multiple features for its users. They are able to browse the web site see exactly what servi... Date Added: 2009-06-19 01:14:18 |
| Project1SectionCFactorAnalysis6 after handed out.rtf Path: UNLV >> PROJECT >> 712 Fall, 2009 Description: 1 Psy 712 Project 1 Section C Due: Thurs April 29 Factor Analyses 14 Marks You may complete this assignment individually or in groups of up to three students. Open up the data file in which you have already recoded the items on the scale you are exam... Date Added: 2009-06-19 01:17:11 |
| week13.2.pdf Path: Texas >> CS >> 380 Fall, 2008 Description: Topology and Distributed Computing Outline Topology Manifolds Simplicial Complexes Distributed Computing Wait-Free RW model Impossibility of Asynchronous Consensus Felix Klein Erlangen Program about transformations Geometry is Manifolds... Date Added: 2009-06-19 01:17:21 |
| 7210 syllabus 09 butler v1 as of Jan 8 2009.doc Path: Auburn >> BUSI >> 7210 Spring, 2008 Description: Schedule BUSI 7210 and 7216 Marketing & Consumer Theory Winter 2009 as of January 6, 2009 Dr. Steven B. Caudill Office: Lowder 216 Phone: 844-2907 Email: caudisb@auburn.edu Web: www.business.auburn.edu/~caudisb Dr. Danny Butler Office: BB 251 Phone: ... Date Added: 2009-06-19 01:18:49 |
| midterm_prep.pdf Path: Washington >> HSTAA >> 101 Fall, 2008 Description: Preparing for the HSTAA 101 midterm-May 1: 1. Begin now: 2. Study together. Collaborate. But check each others\' ideas and answers. 3. Use the EPost Discussion board to tap into the knowledge of your peers, organize study groups, share notes, etc. The... Date Added: 2009-06-19 01:20:49 |
| SG4_Dirty_Ice_or_Icy_Dirt_a.doc Path: Arizona >> VERSION >> 042706 Fall, 2009 Description: DIRTY ICE OR ICY DIRT: Water Weight Percent Lab Use the following sheet to write up your experiment proposal. Your lab procedure must be approved before you begin the experiment. Note that you will need to use the following equation: Water weight per... Date Added: 2009-06-19 01:21:49 |
| SG4_Dirty_Ice_or_Icy_Dirt.doc Path: Arizona >> VERSION >> 081604 Fall, 2009 Description: DIRTY ICE OR ICY DIRT: Water Weight Percent Lab Use the following sheet to write up your experiment proposal. Your lab procedure must be approved before you begin the experiment. Note that you will need to use the following equation: Water weight per... Date Added: 2009-06-19 01:21:52 |
| I589Page6.doc Path: Colorado >> I >> 589 Fall, 2009 Description: ... Date Added: 2009-06-19 01:22:48 |
| m_3311146_nw_12_1_20070607.txt Path: Arizona >> DOQQ >> 33111 Fall, 2009 Description: Metadata: Identification_Information: Citation: Citation_Information: Originator: USDA-FSA-APFO Aerial Photography Field Office Publication_Date: 20080109 Title: NAIP Digital Ortho Photo Image Geospatial_Da... Date Added: 2009-06-19 01:23:28 |
| dan-4.pdf Path: Iowa State >> CALCULUS >> 166 Fall, 2009 Description: ... Date Added: 2009-06-19 01:23:43 |
| F08prntrn.doc Path: UNC Charlotte >> FR >> 1100 Fall, 2009 Description: FREN 1201 (Stephenson) Les pronoms interrogatifs Traduisez en franais: Who is doing the dishes? What is different in this room? Who do you want? What do they want to do? Who are you looking for? What are your parents doing? Who is Paul talking to? Wh... Date Added: 2009-06-19 01:23:56 |
| ENGR_493_-_Reflection.pdf Path: Penn State >> JTO >> 5001 Fall, 2009 Description: ENGR 493 Leadership Reflection By: John Oakley In the beginning of the semester we were told to choose which project we would like to work on for our ENGR 493 practicum. After reviewing the projects, I quickly decided on the rainwater harvesting ... Date Added: 2009-06-19 01:24:33 |
| Lab 7ArtSel,Pt2B-07.pdf Path: Colby >> BI >> 164 Fall, 2009 Description: Biology 164 Laboratory Artificial Selection in Brassica, Part 2B (Based on a laboratory exercise developed by Professor Bruce Fall, University of Minnesota) I. Objectives for Part 2B of this study: 1) Screening second-generation plants of both stand... Date Added: 2009-06-19 01:24:52 |
| Chap18HMWKProbs.ppt Path: Wisconsin >> FINANCE >> 320 Fall, 2008 Description: ... Date Added: 2009-06-19 01:24:56 |
| slac-pub-11641.pdf Path: Stanford >> PUBS >> 11500 Fall, 2009 Description: SLAC-PUB-11641 PLASMA DARK CURRENT IN SELF-IONIZED PLASMA WAKE FIELD ACCELERATORS E. Oz, S. Deng, T. Katsouleas, P. Muggli, USC, Los Angeles, CA 90089, C.D. Barnes, F.J. Decker, M.J. Hogan, R. Iverson, D.K. Johnson, P. Krejcik, C. O\'Connell, R.H. Si... Date Added: 2009-06-19 01:25:24 |
| syllabus_econ606_2009Spring.pdf Path: Georgetown >> JB >> 543 Fall, 2008 Description: Econ 606: Graduate Macroeconomics (II) Georgetown University Jinhui Bai Spring 2009 Last Update: December 10, 2008 Instructor: Jinhui Bai, ICC 557, 202-687-0935, jb543@georgetown.edu. Teaching Assistant: Masaki Higurashi <mh437@georgetown.edu>. Time ... Date Added: 2009-06-19 01:25:24 |
| gal_lec17.pdf Path: University of Hawaii - Hilo >> AST >> 626 Fall, 2009 Description: GALAXIES 626 Upcoming Schedule: Today: Structure of Disk Galaxies Thursday:Structure of Ellipticals Tuesday 10th: dark matter (Emily\'s paper due) Thursday 12th :stability of disks/spiral arms Tuesday 17th: Emily\'s presentation (intergalactic metals... Date Added: 2009-06-19 01:25:37 |
| Instructions03.ps Path: Penn State >> PHYS >> 211 Fall, 2009 Description: %!PS-Adobe-3.0 %Creator: xpdf/pdftops 2.01 %LanguageLevel: 2 %DocumentSuppliedResources: (atend) %DocumentMedia: plain 612 792 0 () () %Pages: 5 %EndComments %BeginDefaults %PageMedia: plain %EndDefaults %BeginProlog %BeginResource: procset xpdf 2.01... Date Added: 2009-06-19 01:25:48 |
| Cond.doc Path: Central Washington University >> CHEM >> 345 Fall, 2009 Description: vti_encoding:SR|utf8-nl vti_author:SR|PC78754\\johansea vti_modifiedby:SR|PC78754\\johansea vti_timelastmodified:TR|28 Mar 2003 19:17:12 -0000 vti_timecreated:TR|28 Mar 2003 19:17:12 -0000 vti_title:SR| vti_assignedto:SR| vti_approvallevel:SR| vti_exte... Date Added: 2009-06-19 01:28:07 |
| xapp234 Virtex SelectLink .pdf Path: Wisconsin >> ECE >> 554 Fall, 2008 Description: Application Note: Virtex Series R Virtex SelectLink Communications Channel Author: John Logue XAPP234 (v1.1) March 15, 2000 Summary Systems with two or more FPGAs often require high-bandwidth data paths between devices. As the clock period and sw... Date Added: 2009-06-19 01:29:13 |
| F15.078.txt Path: Stanford >> YJM >> 789 Fall, 2009 Description: >F15.078 repeat_region TEL15R-YP (Y\' element) Chr15 1084617.1091269 tatatatgtcactgtattgcatgctggatggtgttagacaaggccgtagg gacatatagcatctaggaagtaaccttgtacgaaaataggcaatatttcc tgtttaggcgattgtgacgcagattttagtccaacgatctagcgtcaagg aatttttttatagtgggacattgcacca... Date Added: 2009-06-19 01:29:28 |
| Lecture1.pdf Path: Maryville MO >> ECE >> 2210 Fall, 2009 Description: ... Date Added: 2009-06-19 01:30:41 |
| FCSN 545 Midterm Exama.doc Path: Central Washington University >> NUTR >> 545 Fall, 2009 Description: FCSN 545 Midterm Exam Sample Questions From Cloud DVD: Module 1: 1. Feeding problems interfere with a child\'s nutritional status by: a. interfering with growth in height and weight b. leading to vitamin deficiencies c. preventing full functioning of ... Date Added: 2009-06-19 01:32:33 |
| 345STGU1.doc Path: Central Washington University >> NUTR >> 345 Fall, 2009 Description: vti_encoding:SR|utf8-nl vti_timelastmodified:TR|02 Dec 2003 17:16:30 -0000 vti_extenderversion:SR|4.0.2.7802 vti_cacheddtm:TX|02 Dec 2003 17:16:30 -0000 vti_filesize:IR|22528 vti_cachedlinkinfo:VX| vti_cachedsvcrellinks:VX| vti_cachedtitle:SR|FCSN 34... Date Added: 2009-06-19 01:33:06 |
| 091-REMx.pdf Path: Arizona >> SCHEDULE >> 091 Fall, 2009 Description: Crs. # (units) Call # Sec # Course/Section Title Time Days Instructor Bldg. Room # Crs. # (units) Call # Sec # Course/Section Title Time Days Instructor Bldg. Room # REMOTE SENSING (REM ) Dr. Alfredo Huete, Chair, Shantz 429, 621-3228 REM 490... Date Added: 2009-06-19 01:36:25 |
| Population genetics.ppt Path: Evansville >> B >> 32002 Fall, 2009 Description: Population Genetics How Much Genetic Variation Exists in Natural Populations? Phenotypic variation - variation between individuals in their structure Environmental variation - differences in phenotype can result from differences in environmental c... Date Added: 2009-06-19 01:38:32 |
| Intro-Pipelining.pdf Path: Contra Costa College >> COEN >> 6741 Fall, 2009 Description: Introduction to Pipelining Instruction Set Principles and Examples - 1 Sequential Laundry 6 PM 7 8 9 Time T a s k O r d e r 10 11 Midnight 30 40 20 30 40 20 30 40 20 30 40 20 A B C D Sequential laundry takes 6 hours for 4 loads If they learn... Date Added: 2009-06-19 01:38:45 |
| 355R3vsR33.txt Path: Sveriges lantbruksuniversitet >> EAGLE >> 355 Fall, 2009 Description: May 2001 Fred Heep, SFU Engineering Science For those wishing to use EAGLE to provide screen captures for insertion into technical documentation. The program files supplied cover revision levels EAGLE355R3 and 355R33. R33 would normally replace t... Date Added: 2009-06-19 01:39:24 |
| quiz7.pdf Path: UNC Charlotte >> M >> 1100 Fall, 2009 Description: Quiz 7 Suppose R varies inversely as the square of s. Suppose also that R = 80 when s = 1/4. Write an equation that relates R and s, and find the value of R when s = 2. Solution. We know that R = k/s2 for some value of k To find this value of k, k n... Date Added: 2009-06-19 01:39:36 |
| a1000igsa.txt Path: Mt. Holyoke >> ASOL >> 1000 Fall, 2009 Description: a1000igsa -11.0748 1337 -11.0295 1332 -10.9842 1299 -10.9389 1272 -10.8936 1260 -10.8483 1259 -10.8030 1292 -10.7577 1318 -10.7124 1316 -10.6671 1312 -10.6218 1336 -10.5765 1360 -10.5312 1370 -10.4859 1367 -10.4406 1328 -10.3953 1308 -10.3500 1328 -1... Date Added: 2009-06-19 01:39:37 |
| midterm2.ps Path: University of Illinois, Urbana Champaign >> ECON >> 522 Spring, 2008 Description: %!PS-Adobe-2.0 %Creator: dvips(k) 5.95b Copyright 2005 Radical Eye Software %Title: midterm2.dvi %CreationDate: Fri Apr 13 12:57:38 2007 %Pages: 3 %PageOrder: Ascend %BoundingBox: 0 0 612 792 %DocumentFonts: CMR10 CMBX12 CMSY10 CMMI10 CMSY7 CMMI7 CMS... Date Added: 2009-06-19 01:43:41 |
| Ifmch01F2000.ppt Path: Stetson >> FIN >> 503 Fall, 2009 Description: FIN 503 Prof. Jim Mallett Chapter 1 Introduction: The Multinational Firm 1-1 I. The Multinational Firm A. Define: Significant portion of revenues derived from business conducted in foreign countries B. Attitudes toward multinationals 1-2 II. Rat... Date Added: 2009-06-19 01:44:43 |
| Stat Project 4.xls Path: St. Johns >> GFERN >> 507 Fall, 2009 Description: ST. JOHN\'S UNIVERSITY/TCB DS-33B GREGORY FERNANDEZ (2006-2007) ILLUSTRATIVE DATA SET Intervals 60-79 80-99 100-119 120-139 140-159 160-179 180-199 200-219 220-239 Mi 70 90 110 130 150 170 190 210 230 Fi 0 4 7 9 13 9 5 3 0 50 Estimated Grouped Mea... Date Added: 2009-06-19 01:50:03 |
| lab4_plethoraofderivatives.pdf Path: Occidental >> MATH >> 114 Fall, 2009 Description: Math 114 Fall 2005 Lab 4: A Plethora of Derivatives Objectives: 1. To become familiar with the various Rules of Differentiation 2. Introduce the Chain Rule Introduction This lab will consist of a number of worksheets which you will need to complet... Date Added: 2009-06-19 01:52:16 |
| hw-03.ps Path: Occidental >> MATH >> 312 Fall, 2009 Description: %!PS-Adobe-2.0 %Creator: dvips 5.516 Copyright 1986, 1993 Radical Eye Software %Title: hw3.dvi %CreationDate: Fri Feb 13 10:04:40 1998 %Pages: 2 %PageOrder: Ascend %BoundingBox: 0 0 612 792 %DocumentFonts: Palatino-Roman Palatino-Bold Palatino-Italic... Date Added: 2009-06-19 01:52:54 |
| l24.ps Path: W. Alabama >> CS >> 349 Fall, 2009 Description: %!PS-Adobe-3.0 %BoundingBox: (atend) %Pages: (atend) %PageOrder: (atend) %DocumentFonts: (atend) %DocumentNeedsFonts: (atend) %DocumentSuppliedFonts: (atend) %Creator: Frame 6.0 %DocumentData: Clean7Bit %EndComments %BeginProlog % % Frame ps_prolog 6... Date Added: 2009-06-19 01:53:04 |
| l25.ps Path: W. Alabama >> CS >> 349 Fall, 2009 Description: %!PS-Adobe-3.0 %BoundingBox: (atend) %Pages: (atend) %PageOrder: (atend) %DocumentFonts: (atend) %DocumentNeedsFonts: (atend) %DocumentSuppliedFonts: (atend) %Creator: Frame 6.0 %DocumentData: Clean7Bit %EndComments %BeginProlog % % Frame ps_prolog 6... Date Added: 2009-06-19 01:53:05 |
| WEEK03.pdf Path: Occidental >> MATH >> 212 Fall, 2009 Description: Multivariable Calculus Math 212 Fall 2005 c 2005 Ron Buckmire Fowler 307 MWF 9:30pm - 10:25am http:/faculty.oxy.edu/ron/math/212/05/ Week 3 Monday September 12 Class 4: The Vector Cross Product. Reading: Williamson & Trotter, (Section 1.6) Homework ... Date Added: 2009-06-19 01:54:29 |
| 13-fri-022208.ppt Path: Occidental >> MATH >> 214 Fall, 2009 Description: Which of the following matrices does not have an inverse? Class 13: Question 1 Class 13: Question 2 Class 13: Question 3 Class 13: Question 4 TRUE OR FALSE: If A, B and C are square matrices, and we know that AB=AC, this means that matrix B is e... Date Added: 2009-06-19 01:55:36 |
| 114PracticeExam2-solutions.pdf Path: Occidental >> MATH >> 114 Fall, 2009 Description: ... Date Added: 2009-06-19 01:55:58 |
| rules-3.pdf Path: Occidental >> MATH >> 110 Fall, 2009 Description: Math 110 Fall 1998 Test Rules and Regulations Preparing for Exam 3 1. The ideas are the most important thing! And what are those ideas? A partial list is: Implicit Di erentiation Besides taking the derivative dy of a function = explicitly you sho... Date Added: 2009-06-19 01:56:02 |
| Quiz04.pdf Path: Occidental >> MATH >> 370 Fall, 2009 Description: Math 370 Spring 2009 QUIZ 4 Name: Time Begun: Time Ended: Friday February 20 Prof. Ron Buckmire Numerical Analysis Topic : Root-finding Algorithm(s) The idea behind this quiz is for you togive you an opportunity to demonstrate your understanding ... Date Added: 2009-06-19 01:56:17 |
| 423CH11.pdf Path: MSOE >> IE >> 423 Fall, 2009 Description: ng ri ee in ng to the Incremental Income tax rate: rate E applied of next dollar earned ol ho c Srate: Income tax liability Average Incomee tax ke Taxable Income au ilw M S. H. Rather, Dept. of Mechanical Engineering Income Taxes Example: Average v... Date Added: 2009-06-19 01:56:44 |
| mtarf3_palmer_magneticinsulation.pdf Path: Illinois Tech >> MICE >> 101508 Fall, 2009 Description: Needed rf Experiments R. B. Palmer 07/07/08 Experiments to test theory But more important: Experiments to test HP gas solution Dependency on volume dependency on frequency Experiments to test magnetic insulation solution Simple pillbox at 90 d... Date Added: 2009-06-19 01:56:57 |
| s55_40x_3_jpg.htm.txt Path: IUPUI >> D >> 502 Fall, 2009 Description: <html> <head> <title>Laboratory 11, Lower GI / s55.40x.3.jpg</title> </head> <body bgcolor=\"#ffffff\"> <table border=0> <tr> <td align=\"left\"><h2>Laboratory 11, Lower GI/s55.40x.3.jpg</h2> <a href=\"s55_40x_2_jpg.htm\">Previous</a> | <a href=\"./index1.h... Date Added: 2009-06-19 01:57:28 |
| s81_10x_f2_jpg.htm.txt Path: IUPUI >> D >> 502 Fall, 2009 Description: <html> <head> <title>Laboratory 18, Female Reproductive System / s81.10x.f2.jpg</title> </head> <body bgcolor=\"#ffffff\"> <table border=0> <tr> <td align=\"left\"><h2>Laboratory 18, Female Reproductive System/s81.10x.f2.jpg</h2> <a href=\"s81_10x_f1_jpg.... Date Added: 2009-06-19 01:58:49 |
| lab1Part3.xls Path: Washington >> ATM >> 211 Fall, 2009 Description: Lab 1: Introductory Statistics and Concepts Part 3. Global Climatology and Correlations Name: Table 1. 20 Years of Annual Average Temperature Data (in deg C) Year Barrow Samoa St Cloud Yakutsk (deg C) (deg C) (deg C) (deg C) 1973 -11.80 27.20 6.40 ... Date Added: 2009-06-19 01:59:35 |
| project3-pt2.pdf Path: IUP >> MATH >> 124 Fall, 2009 Description: ... Date Added: 2009-06-19 02:00:03 |
| lecture4and5.ppt Path: Stanford >> STATS >> 210 Fall, 2009 Description: Statistical Inference June 30-July 1, 2004 Statistical Inference The process of making guesses about the truth from a sample. Truth (not observable) Sample (observation) Make guesses about the whole population FOR EXAMPLE: What\'s the average weight... Date Added: 2009-06-19 02:00:11 |
| 2004-April.txt Path: Portland >> IST >> 510 Spring, 2008 Description: From education_software4 at academic-net.com Mon Apr 19 23:10:30 2004 From: education_software4 at academic-net.com (School Sales) Date: Wed Jul 13 10:28:14 2005 Subject: ACADEMIC SOFTWARE MAJOR DISCOUNTS Message-ID: <20040419-23103071-994-1@tttttt>... Date Added: 2009-06-19 02:02:45 |
| Quiz10_sol.pdf Path: Pittsburgh >> MAJST >> 0250 Fall, 2009 Description: MATH 0250 Quiz 10 Solutions 10:00am, Friday 22 July, 2005 Name:. . . . . . . . . . . . . . . . . . . . . . . . . . . Question One Let P be the matrix P = 1 2 1 2 1 2 1 2 Then P : R2 R2 is the orthogonal projection matrix onto the line y = x. Find... Date Added: 2009-06-19 02:03:09 |
| new revised rubricdoc.doc Path: U. Memphis >> SPED >> 49006900 Fall, 2009 Description: Assessment Development of an Individual Education Plan or Individual Family Service Plan Each student will be given a case study. Using the information and data within the case study, each student will complete an Individual Education Plan (IEP) docu... Date Added: 2009-06-19 02:06:22 |
| 2.pdf Path: Stockton >> STK >> 25182 Fall, 2009 Description: Art as F Sty le ashi on Fas hion as A rt ... Date Added: 2009-06-19 02:07:34 |
| ep_fl_dat.txt Path: Berkeley >> ASTRO >> 00281993 Fall, 2009 Description: # Ep dEp lprob lEiso dlEiso 74.081 0.058 1.68e-06 -12.133 0.148 74.143 0.066 -3.59e-05 -12.133 0.141 74.214 0.076 -2.06e-04 -12.133 0.140 74.296 0.087 -3.72e-04 -12.133 0.140 74.389 0.100 -5.45e-04 -12.133 0.140 74.496 0.114 -7.51e-04 -12.033 0.184 7... Date Added: 2009-06-19 02:07:58 |
| DynamicSemantics.pdf Path: UAB >> CS >> 405 Fall, 2009 Description: Chapter 3 Describing Syntax and Semantics ISBN 0-321-49362-1 Chapter 3 Topics Describing the Meanings of Programs: Dynamic Semantics Copyright 2007 Addison-Wesley. All rights reserved. 3-2 1-2 1 Semantics There is no single widely acceptabl... Date Added: 2009-06-19 02:08:14 |
| 9.pdf Path: University of Central Oklahoma >> AAC >> 0607 Fall, 2009 Description: ... Date Added: 2009-06-19 02:08:33 |
| 75.pdf Path: University of Central Oklahoma >> AAC >> 0506 Fall, 2009 Description: ... Date Added: 2009-06-19 02:09:40 |
| 001169_1.pdf Path: Pittsburgh >> AEI >> 3594 Fall, 2009 Description: ... Date Added: 2009-06-19 02:10:04 |
| pc_evlist.txt Path: Berkeley >> ASTRO >> 00176620 Fall, 2009 Description: output00176620000_999/sw00176620000xpcw2po_cl.evt output00176620001_999/sw00176620001xpcw2po_cl.evt output00176620002_999/sw00176620002xpcw2po_cl.evt output00176620003_999/sw00176620003xpcw2po_cl.evt output00176620004_999/sw00176620004xpcw2po_cl.evt ... Date Added: 2009-06-19 02:10:13 |
| initial-model-and-loads.txt Path: UMass (Amherst) >> ECS >> 605 Fall, 2009 Description: /prep7 !gain acces to the preprocessor ! ! Initialize design variable parameters ! ! x1=0.1 !initialize variable X1, the width of the cross section x2=0.3 !Initialize variable x2, the height of the cross section ! ! Define element type, area, mome... Date Added: 2009-06-19 02:10:43 |
| initial mode and loads.txt Path: UMass (Amherst) >> ECS >> 605 Fall, 2009 Description: /prep7 !gain acces to the preprocessor ! ! Initialize design variable parameters ! ! x1=0.1 !initialize variable X1, the width of the cross section x2=0.3 !Initialize variable x2, the height of the cross section ! ! Define element type, area, mome... Date Added: 2009-06-19 02:10:43 |
| hw3.pdf Path: Duke >> MATH >> 103 Fall, 2008 Description: Math 103X.02 Homework 3-due September 29 Instructor: Lenny Ng Fall 2006 Please remember to show all work (even for odd numbered problems!), acknowledge any collaboration, and write up your own solutions. 2.1: 13, 14, 19, 34, 45, 47 2.2: 7, 11, 12, 13... Date Added: 2009-06-19 02:11:01 |
| Chapter 14.ppt Path: Idaho >> PTTE >> 495 Fall, 2008 Description: ADMINISTRATIVE OFFICE MANAGEMENT Chapter 14 Essential Business Communication Skills Chapter 14 Administrative Office Management, 13th Ed 1 Effective Reading Skills s Previewing s Questioning s Reviewing s Mapping Chapter 14 Administrative Office M... Date Added: 2009-06-19 02:13:30 |
| class08-PP2003-morning.ppt Path: Youngstown >> CIS >> 3723 Fall, 2008 Description: INTRODUCTION NETWORKING CONCEPTS AND ADMINISTRATION CSIS 3723 Graciela Perera Department of Computer Science and Information Systems Meshel Hall 320 (330) 941 1341 gpererao@cis.ysu.edu Slide 1 of 14 Graciela Perera September 19, 2007 Department o... Date Added: 2009-06-19 02:17:00 |
| chapter3.ppt Path: Youngstown >> CIS >> 3723 Fall, 2008 Description: C hapte 3 r Transport Laye r A note on the use of these ppt slides: We\'re making these slides freely available to all (faculty, students, readers). They\'re in PowerPoint form so you can add, modify, and delete slides (including this one) and slide c... Date Added: 2009-06-19 02:17:00 |
| 001212_1.pdf Path: Pittsburgh >> AEI >> 4328 Fall, 2009 Description: ... Date Added: 2009-06-19 02:17:23 |
| dp_c181_hoereth_sonnicksen.pdf Path: Pittsburgh >> AEI >> 9057 Fall, 2009 Description: Zentrum fr Europische Integrationsforschung Center for European Integration Studies Rheinische Friedrich-Wilhelms-Universitt Bonn Discussion Paper Marcus Hreth/Jared Sonnicksen Making and Breaking Promises The European Union under the Treaty of Li... Date Added: 2009-06-19 02:17:29 |
| CS490ns_Course_Intro_bw.ppt Path: UMKC >> CS >> 490 Fall, 2009 Description: CS490ns Practical Network Security Course Syllabus Course Meeting Time Tuesday and Thursday 2:00 to 3:15 PM Location FH304 Instructor: Bob Cotter (e-mail cotterr@umkc.edu) (Web page: http:/www.csee.umkc.edu/~cotterr/) Office Hours: Tuesday a... Date Added: 2009-06-19 02:20:00 |
| gcnR.txt Path: Berkeley >> ASTRO >> 00191157 Fall, 2009 Description: -17280 R 0 GCN4816 -17280 R 0 GCN4810 96.768 15.68 0.2 none yes 217.728 17.6 0.2 none yes 482.112 18.55 0... Date Added: 2009-06-19 02:20:25 |
| spec_pc.txt Path: Berkeley >> ASTRO >> 00191157 Fall, 2009 Description: # tmin tmax 10.0000 13673.0 [ksec] ;instrument XRT ;exposure 312374.36 ;xunit kev ;bintype counts 0.000000 0.010000 0.000000 0.000000 0.010000 0.020000 0.000000 0.000000 0.020000 0.030000 0.000000 0.000000 0.030000 0.040000 0.000000 0... Date Added: 2009-06-19 02:20:31 |
| OCD_LCO_F06a_T02_V1.30.pdf Path: USC >> CSCI >> 577 Fall, 2009 Description: Operational Concept Description (OCD) California Science Center Event RSVP System Team #2 Ravneet Sahni (Project Manager) Chitra Gulabrani (LCP Person) Chien-Ju Hung (SSAD Person) Ya-Chen Lee (SSRD Person) Anupama Premjani (OCD Person) Wen-Hsin Hsi... Date Added: 2009-06-19 02:21:54 |
| OCD_FCP_F08a_T05_V3.0.doc Path: USC >> CSCI >> 577 Fall, 2009 Description: Operational Concept Description (OCD) Hunter Gatherer Interactive Database Team # 5 Nachiket Mistry Bhushan Shah Mayank Sheth Bhumi Damania Neha Irla Srinivasan Srivatsan Project Manager System Architect Requirement Engineer Feasibility Analyst Li... Date Added: 2009-06-19 02:22:19 |
| swb_slew_times.txt Path: Berkeley >> ASTRO >> 00310785 Fall, 2009 Description: -752.41980 37.222100 49.586600 4857.5800 4874.5287 45343.133 45343.133 45343.133 45343.134 45343.134 45343.134 45343.134 45343.134 45343.134 45343... Date Added: 2009-06-19 02:23:40 |
| Sting calibration.doc Path: Michigan >> ME >> 395 Fall, 2009 Description: Drag Force vs. Velocity 0.6 0.5 0.4 Drag Force [N] 0.3 0.2 0.1 0 0 -0.1 Velocity [m/s] 5 10 15 20 25 30 35 Sting Drag Force Model Drag Force Linear (Sting Drag Force) y = 0.0007x - 0.014 Drag Calibration (sting) 3.5 3 2.5 2 Force [N] 1.5 1 y = -1.1... Date Added: 2009-06-19 02:23:58 |
| beta-amyloid precursor protein 695 [Canis familiaris].txt Path: NMSU >> MOLB >> 470 Fall, 2009 Description: >gi|62363239|gb|AAX81911.1| beta-amyloid precursor protein 695 [Canis familiaris] MLPALALVLLASWTARALEVPTDGNAGLLAEPQVAMLCGKLRMHMNVQNGKWESDPLGTKTCIGSKEDIL QYCQEVYPELQITNVVEANQPVTIQNWCKKGRKQCKTHAHIVIPYRCLVGEFVSDALLVPDKCKFLHQER MDVCETHLHWHTVAKETCSEKSTNLH... Date Added: 2009-06-19 02:24:16 |
| housetype1.pdf Path: LA Tech >> TECH >> 321 Fall, 2009 Description: ... Date Added: 2009-06-19 02:24:36 |
| Module08Worksheet.doc Path: Michigan State University >> CSE >> 460 Fall, 2008 Description: Module 8 Worksheet In Class Questions 1) (S6) Give an element of FINITE over alphabet {a,b,c}. 2) (S6) Give an element of FINITE over alphabet {a,b,c} that is NOT in CARD-3. 3) (S7) Does the example on this slide prove that FINITE is closed under set... Date Added: 2009-06-19 02:28:46 |
| OFDM.pdf Path: NSULA >> GEL >> 64486 Fall, 2009 Description: Comparaison Orthogonal Frequency Division Multiplexing p g OFDM FDM multiplexage en frquence Typiquement pour plusieurs usagers Oscillateurs physiquement spars Dtection non cohrente OFDM Typiquement pour un seul usager Symboles diffrents sur ch... Date Added: 2009-06-19 02:28:53 |
| feynman_waveguides.pdf Path: UCSC >> PH >> 110 Fall, 2009 Description: ... Date Added: 2009-06-19 02:29:16 |
| Knapp.pdf Path: Stanford >> ERE >> 1975 Fall, 2009 Description: GEOPRESSURED GEOTHERMAL RESERVOI R ENGl NEERl NG RESEARCH AT THE U N I V E R S I T Y OF TEXAS R. M. Knapp, M. H. Dorfman, and 0. F. l s o k r a r i P e t r o l eum E n g i n e e r i n g Department The U n i v e r s i t y o f Texas a t A u s t i n A... Date Added: 2009-06-19 02:29:38 |
| hw_1.pdf Path: Minnesota >> ECE >> 5333 Fall, 2009 Description: - University of Minnesota -Institute of Technology Department of Electrical Engineering Home Work #1 Due: Thursday, September 15, 1999 EE5333: Analog Integrated Circuit Design 1) Do problem 1.4 2) Do problem 1.5 3) Do problem 1.10 4 Do problem 1.11 ... Date Added: 2009-06-19 02:30:06 |
| JESIntro.txt Path: Georgia Tech >> GTG >> 909 Fall, 2009 Description: Welcome to JES 3.0.1! JES - The Jython Environment for Students: Inside this Software Suite, you will find all the tools you need to make pictures, audio, and video using the Jython language. For JES to work, you need to register yourself. When yo... Date Added: 2009-06-19 02:30:54 |
| 430laba.doc Path: CUNY Baruch >> CS >> 430 Fall, 2009 Description: Lucky 7 Slot Machine - Programming Steps -1. Create the User Interface (7 objects) Spin, end buttons, 3 spinner windows, a descriptive label, and a winer display window 2. Set the properties (10 properties) 3. Write the program code (2 objects) Pick ... Date Added: 2009-06-19 02:33:42 |
| m322_exam090506.pdf Path: Washington University in St. Louis >> M >> 322 Fall, 2009 Description: Biostatistics Math 322 - Spring 2009 Final Exam The exam is due Wednesday May 6th, at noon in Cupples I, room 100. This exam contains twenty-five problems numbered 1, 2a, 2b, 3a, 3b, 4a, 4b, 5a, 5b, 5c, 6, 7a, 7b, 7c, 7d, 7e, 7f, 8a, 8b, 8c, 9a, 9b, ... Date Added: 2009-06-19 02:33:46 |
| project2.ps Path: Georgia Tech >> CS >> 6760 Fall, 2009 Description: %!PS-Adobe-2.0 %Creator: dvipsk 5.526a Copyright 1986, 1993 Radical Eye Software %Title: project2.dvi %Pages: 2 %PageOrder: Ascend %BoundingBox: 0 0 612 792 %EndComments %DVIPSCommandLine: dvips project2 -o %DVIPSParameters: dpi=300, comments removed... Date Added: 2009-06-19 02:33:48 |
| Chp9.pdf Path: MNSU >> MTH >> 103 Fall, 2009 Description: ... Date Added: 2009-06-19 02:34:38 |
| Final Study Guide.doc Path: UCSB >> ES >> 106 Fall, 2009 Description: ES 106 Final Exam Study Guide Chapter 3 Key point: How do Values and Beliefs influence peoples actions? More minor details: a. Ecocentric vs. Homocentric norms b. Ecotheology vs. dominant western paradigm; c. Deep Ecology Movement d. Ecofeminism A... Date Added: 2009-06-19 02:34:48 |
| midterm1sol.pdf Path: UCSD >> COGSCI >> 109 Fall, 2009 Description: UNIVERSITY OF CALIFORNIA, San Diego Department of Cognitive Science COGS 109 (Modeling and Data Analysis) Instructor: Virginia de Sa Midterm 1 Oct 30,2008 Duration: 80 minutes No aids allowed. This is a closed book test. This examination paper consis... Date Added: 2009-06-19 02:34:50 |
| ISR.ppt Path: Iowa State >> PLP >> 692 Fall, 2009 Description: Induced Systemic Resistance (ISR) ISR SAR PGPR PR (1, 2, 3 etc) Acidic, basic SA INA NahG JA MeJA jar1 C2H4 ACC 1 aminocyclopropane 1 carboxylate ein1 Priming NPR1 Acquired R reported as early as 1933, and according to Kuc, even earlier. Chester K ... Date Added: 2009-06-19 02:34:50 |
| 00fe1review.ps Path: Wisconsin >> ECE >> 735 Fall, 2008 Description: %!PS-Adobe-2.0 %Creator: dvips 5.76 Copyright 1997 Radical Eye Software (www.radicaleye.com) %Title: temp.dvi %CreationDate: Wed Oct 25 16:48:28 2000 %Pages: 2 %PageOrder: Ascend %BoundingBox: 0 0 612 792 %EndComments %DVIPSCommandLine: dvips -o temp... Date Added: 2009-06-19 02:34:56 |
| s3solns.pdf Path: Angelo State >> M >> 1332 Fall, 2009 Description: Math 1332 Introduction to Contemporary Mathematics Answers to Test 3 Sample Problems These are answers, not complete solutions. Remember that on the test on Thursday you must justify your answers by showing your work or explaining your reasoning. 1. ... Date Added: 2009-06-19 02:35:11 |
| AZ0311216AC.txt Path: Minnesota >> AZ >> 0311216 Fall, 2009 Description: HPDSN AZ0311216 Date 2003-05-21 Time 14:14:05 ScanType AC Crosstalk Comment Channel 18 output is 0.258320 percent of channel 10 output. Output in mV (Channel 10 is divided by 100). Time(ns) Channel 8 Channel 10 Channel 18 250.00 0.02814040 -0... Date Added: 2009-06-19 02:35:45 |
| AZ0230003DC.txt Path: Minnesota >> AZ >> 0230003 Fall, 2009 Description: HPDSN AZ0230003 Date 2002-08-15 Time 14:23:34 ScanType DC Crosstalk Comment Passed. Sum of outputs is 2.623410. pixel ratio(percentage) 1 0.052323 2 0.083360 3 0.053335 4 0.126717 5 0.285490 6 0.285049 7 0.087749 8 0.055081 9 0.288417 10 0.000... Date Added: 2009-06-19 02:35:55 |
| AZ0249119_1AC.txt Path: Minnesota >> AZ >> 0249119 Fall, 2009 Description: HPDSN AZ0249119_1 Date 2004-07-30 Time 14:59:32 ScanType AC Crosstalk Comment Channel 18 output is 0.184756 percent of channel 10 output. Output in mV (Channel 10 is divided by 100). Time(ns) Channel 8 Channel 10 Channel 18 250.00 -0.02016750... Date Added: 2009-06-19 02:36:05 |
| AZ0321256AC.txt Path: Minnesota >> AZ >> 0321256 Fall, 2009 Description: HPDSN AZ0321256 Date 2003-10-24 Time 13:58:00 ScanType AC Crosstalk Comment Channel 18 output is 0.118002 percent of channel 10 output. Output in mV (Channel 10 is divided by 100). Time(ns) Channel 8 Channel 10 Channel 18 250.00 0.02563640 -0... Date Added: 2009-06-19 02:36:17 |
| AZ0317205DC.txt Path: Minnesota >> AZ >> 0317205 Fall, 2009 Description: HPDSN AZ0317205 Date 2003-07-11 Time 13:45:53 ScanType DC Crosstalk Comment pixel ratio(percentage) 1 0.075055 2 0.115346 3 0.072705 4 0.115134 5 0.423760 6 0.403915 7 0.109016 8 0.071234 9 0.408303 10 0.000000 11 0.380746 12 0.067712 13 0.1048... Date Added: 2009-06-19 02:37:22 |
| AZ0323307AC.txt Path: Minnesota >> AZ >> 0323307 Fall, 2009 Description: HPDSN AZ0323307 Date 2003-10-08 Time 17:08:29 ScanType AC Crosstalk Comment Channel 8 output is 0.368851 percent of channel 10 output. Output in mV (Channel 10 is divided by 100). Time(ns) Channel 8 Channel 10 Channel 18 250.00 0.00156620 0.0... Date Added: 2009-06-19 02:37:56 |
| AZ0151001_1DC.txt Path: Minnesota >> AZ >> 0151001 Fall, 2009 Description: HPDSN AZ0151001_1 Date 2005-02-24 Time 11:08:06 ScanType DC Crosstalk Comment Passed. Sum of outputs is 2.010243. pixel ratio(percentage) 1 0.020117 2 0.046929 3 0.034345 4 0.047019 5 0.253718 6 0.237188 7 0.052815 8 0.031523 9 0.265232 10 0.0... Date Added: 2009-06-19 02:38:56 |
| paragraph_to_essay.doc Path: CSU Northridge >> SAB >> 14883 Fall, 2009 Description: From Paragraphs to Essays An American scholar had some rather good advice to give on turning paragraphs into essays. Here is what he wrote. Before you start you must have a form in mind; and it must be a form felt in paragraphs or sections, not in wo... Date Added: 2009-06-19 02:40:53 |
| Energy OH_old.doc Path: Cal Poly Pomona >> BIO >> 304 Fall, 2009 Description: LECTURE #10 ENERGY I. Energy Sources in the United States (% of total energy used) A. Fossil Fuels 85% 1. Oil 39% 2. Natural Gas (90% CH4) 23% 3. Coal 23% (56% of electricity) B. Other 15% 1. Nuclear 8% (20% of electricity) 2. Other 5%(solar, wind,... Date Added: 2009-06-19 02:41:34 |
| xm3b_08_key.jnt.pdf Path: St. Augustine NC >> KEYS >> 1212 Fall, 2009 Description: CHEM 1212 Exam III-B Name: _ 1 H 1.01 3 4 Periodic Table of the Elements 5 6 7 8 9 2 He 4.00 10 Li 6.94 11 Be 9.01 12 B 10.81 13 C 12.01 14 N 14.01 15 O 16.00 16 F 19.00 17 Ne 20.18 3 Na 22.99 19 Mg 24.31 20 21 22 23 24 25 26 27 28 29 ... Date Added: 2009-06-19 02:42:14 |
| Lect13-ClassToRelational.ppt Path: CSU Fullerton >> PRJ >> 566 Fall, 2009 Description: PRJ566: Project Planning and Management Converting a Class Diagram to a Relational Model Steps to Convert from an Class Diagram to Relational 1. 2. 3. 4. Simple classes become tables. Identify a unique identifier and make this a primary key. Inter... Date Added: 2009-06-19 02:42:28 |
| AddReading.pdf Path: Western Michigan >> ECE >> 6800 Fall, 2008 Description: ECE 6800 Design Factors for Distributed Systems Additional References Catalog Info: ECE 6800 Design Factors for Distributed Systems, An introduction to distributed computing systems operation and design. Previous Course Textbooks: Andrew Tanenbaum a... Date Added: 2009-06-19 02:42:38 |
| syllabus_237_syllabus.pdf Path: Washington >> CHEM >> 237 Fall, 2008 Description: ... Date Added: 2009-06-19 02:42:45 |
| highspeednids_final.ppt Path: North-West Uni. >> CS >> 450 Fall, 2009 Description: Hongyu Gao Clint Sbisa Processing speed is crucial concern for NIDS/NIPS Limited by rate of parsing packets Inefficient parsing leads to slow speeds and bottlenecks Binpac Declarative language and compiler Designed to simplify task of con... Date Added: 2009-06-19 02:43:41 |
| cpe169_exp4 ise91 nexys1_2.pdf Path: Cal Poly >> EXP >> 169 Fall, 2009 Description: COMPUTER ENGINEERING PROGRAM California Polytechnic State University CPE 169 Experiment 4 Introduction to Gate Delays, Timing Diagrams, Circuit Simulation, and Static Logic Hazards Learning Objectives 1. Digital Logic To learn about the propagation... Date Added: 2009-06-19 02:43:45 |
| MAT251_homework.pdf Path: ASU >> MAT >> 251 Fall, 2009 Description: MAT251 HOMEWORK PROBLEMS from Calculus for Life Sciences, by Bittenger et. al. Section 2.1 2.2 2.3 2.4 2.5 2.6 2.7 2.8 2.9 3.1 3.2 4.1 4.2 4.5 4.3 4.4 3.4 3.5 3.6 3.7 5.1 5.2 5.3 5.4 5.5 5.6 7.1 7.2 7.3 Problems 5, 6, 9, 10, 11, 12, 13, 14 1, 2, 3, ... Date Added: 2009-06-19 02:44:44 |
| PopQuiz1_2004answers.pdf Path: Oregon State >> FRWS >> 3700 Fall, 2009 Description: FRWS 3700 Pop Quiz 1 Fall 2004 Name: _ 1. (20 points) In one sentence, describe the difference between a goal and an objective in the context of natural resource management. A goal is an overall project/program direction whereas an objectives are... Date Added: 2009-06-19 02:46:51 |
| Regrade_request.pdf Path: Washington >> PHY >> 121 Fall, 2009 Description: Regrade request 122D I have read the solutions to this exam. I have not made any changes or marks on the original examination. (Portions of each exam are photocopied.) I understand that each question may be entirely regraded and that it is possible... Date Added: 2009-06-19 02:47:10 |
| Unit1studySummer09.pdf Path: High Point >> ACME >> 0928 Fall, 2009 Description: US Government (Summer 2009) Unit 1 Focus Questions 1. What are the core components of America\'s political culture? What economic, political and ideological forces were most important in shaping the values and social context that most influenced the f... Date Added: 2009-06-19 02:48:29 |
| studentinfo.pdf Path: Sveriges lantbruksuniversitet >> MATH >> 252 Fall, 2009 Description: MATH 252-3 Vector Calculus Spring 2004 Name: Where are you from (hometown)?: E-mail address: Local telephone number (optional): College year: Program/department/field of interest: Previous mathematics courses (when taken): Calculus of one V... Date Added: 2009-06-19 02:48:43 |
| water216_TestB.txt Path: Oakland University >> CSE >> 216 Fall, 2009 Description: No MPI compilation. # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # ... Date Added: 2009-06-19 02:49:23 |
| HW5_solution.pdf Path: University of Hawaii - Hilo >> PH >> 170 Fall, 2009 Description: Ph170A Spring 2004 Prof. Pui Lam SOLUTION Reading Assignment #5 :Ch. 11-1,2,3,4 & 6 , Ch 12-1, 2,3 Homework #5: Work, Energy and Conservation of Energy Due: Feb. 13, 2004 _ 1. Work-Kinetic Energy Theorem. A ball of mass m is drop from an initial... Date Added: 2009-06-19 02:50:34 |
| RF Amplifier Design.pdf Path: Case Western >> EECS >> 397 Fall, 2009 Description: ... Date Added: 2009-06-19 02:50:43 |
| zhu2002.pdf Path: Stanford >> CBIO >> 241 Fall, 2009 Description: PERSPECTIVES TIMELINE How acute promyelocytic leukaemia revived arsenic Jun Zhu*, Zhu Chen, Valrie Lallemand-Breitenbach* and Hugues de Th* Despite its many therapeutic qualities, arsenic trioxide has been more commonly remembered as Madame Bovary\'s... Date Added: 2009-06-19 02:55:15 |
| Jenkins_etal_1995.pdf Path: Fayetteville State University >> BSC >> 3402 Fall, 2009 Description: Food Hoarding by Merriam\'s Kangaroo Rats: A Test of Alternative Hypotheses Stephen H. Jenkins; Aron Rothstein; Wendy C. H. Green Ecology, Vol. 76, No. 8. (Dec., 1995), pp. 2470-2481. Stable URL: http:/links.jstor.org/sici?sici=0012-9658%28199512%2976... Date Added: 2009-06-19 02:55:32 |
| Ex3distb.pdf Path: University of Illinois, Urbana Champaign >> MCB >> 240 Spring, 2008 Description: Attention: Fall 2006 Distribution and Range of Second Midterm Grades Physiology (MCB) 240 Students Final Total Scores (out of 100) GRADE RANGE # STU D. % OF CLASS A+ A AB+ B BC+ C CD+ D DF >93 91-93 88-90 85-87 82-84 79-81 76-78 72-75 67-71 62-66 ... Date Added: 2009-06-19 02:58:50 |
| Exam4_07_Key.pdf Path: UF >> STA >> 4321 Fall, 2008 Description: ... Date Added: 2009-06-19 02:59:36 |
| spec_pc.txt Path: Berkeley >> ASTRO >> 00148833 Fall, 2009 Description: # tmin tmax 0.244761 1372.27 [ksec] ;instrument XRT ;exposure 211807.86 ;xunit kev ;bintype counts 0.000000 0.010000 0.000000 0.000000 0.010000 0.020000 0.000000 0.000000 0.020000 0.030000 0.000000 0.000000 0.030000 0.040000 0.000000 0... Date Added: 2009-06-19 03:01:14 |
| hw6.ps Path: Moravian >> CS >> 105 Fall, 2009 Description: %!PS-Adobe-2.0 %Creator: dvips(k) 5.95a Copyright 2005 Radical Eye Software %Title: hw6.dvi %Pages: 1 %PageOrder: Ascend %BoundingBox: 0 0 612 792 %DocumentFonts: Times-Roman CMMI9 %DocumentPaperSizes: Letter %EndComments %DVIPSWebPage: (www.radicale... Date Added: 2009-06-19 03:01:44 |
| Thrust Graph.pdf Path: RIT >> P >> 08454 Fall, 2009 Description: Power Consumption vs Thrust 3 2.5 2 Thrust (lb) 1.5 P08454 Forward P08454 Reverse Seabotix 150 1 Technadyne 260 0.5 0 0 -0.5 Power Consumed (Watts) 5 10 15 20 25 30 35 40 45 50 PDF Creator - PDF4Free v2.0 http:/www.pdf4free.com ... Date Added: 2009-06-19 03:03:27 |
| hmwk1sol.pdf Path: UCSD >> PHYS >> 210 Fall, 2009 Description: ... Date Added: 2009-06-19 03:05:21 |
| ecgr2181 - PP ch3.pdf Path: UNC Charlotte >> CH >> 2181 Fall, 2009 Description: ! \" \" \" # \" # $ \" ) * $ # \'# % # \" \" \" \" ( \" # # ... Date Added: 2009-06-19 03:08:25 |
| hardVmag.txt Path: Berkeley >> ASTRO >> 00158855 Fall, 2009 Description: chi^2/nu= 44.315083 / 314.000 The fit is rejectable at 4.1711531e-75 % Confidence #index t1 t2 fade_index delta_mag_pk hindex dhindex rate1 drate1 rate2 drate2 logr dlogr 0 3.0362 15.9579 -0.84 0.0 -0.02 0.13 1.11E-0... Date Added: 2009-06-19 03:08:52 |
| ooTerminology.ps Path: Benjamin Franklin Institute of Technology >> CSE >> 5660 Fall, 2009 Description: %!PS-Adobe-3.0 %BoundingBox: (atend) %Pages: (atend) %PageOrder: (atend) %DocumentFonts: (atend) %Creator: Frame 4.0 %DocumentData: Clean7Bit %EndComments %BeginProlog % % Frame ps_prolog 5.0, for use with Frame 5.0 products % This ps_prolog file is ... Date Added: 2009-06-19 03:09:29 |
| final-sp08.pdf Path: UCF >> MATH >> 2311 Fall, 2009 Description: Name: Course: MAC2311 Calculus I, Section: 0302 Instructor: David Rollins PID: Final Exam Show all your work to receive full credit. Basic scientic calculator allowed. 1. Sketch the graph of an example of a function f that satises all of the follow... Date Added: 2009-06-19 03:09:56 |
| 08_IPv6_routers_Spring_2006_Web.ppt Path: SMU - Cox School of Business >> EETS >> 7304 Fall, 2009 Description: Spring 2006 EE 5304/EETS 7304 Internet Protocols Lecture 8 IPv6 Tom Oh Dept of Electrical Engineering taehwan@engr.smu.edu TO 3-7-06 p. 1 Administrative Issues I will return your test 1 after I receive most of the test from remote sites. I will... Date Added: 2009-06-19 03:10:53 |
| Martens&Trumble1987.pdf Path: UC Riverside >> FACULTY >> 1987 Fall, 2009 Description: ... Date Added: 2009-06-19 03:11:55 |
| ZTrumbleDercksQuirosBeier1990.pdf Path: UC Riverside >> FACULTY >> 1990 Fall, 2009 Description: ... Date Added: 2009-06-19 03:12:04 |
| chp_2.pdf Path: Maryland >> CHEM >> 231 Fall, 2008 Description: Chapter 2 - Bonding and Molecular Properties* Properties Electronegativity () differences -> polar covalent bonds = 2.5 HH C H = 2.1 H C HH N H = 3.0 - H = measure of ability of an atom to attract e\'s Cs: = 0.7 F: = 4.0 H + = 2.1 - + C... Date Added: 2009-06-19 03:12:26 |
| ---Ethics - Rebecca Atkinson.doc Path: WPUNJ >> CS >> 480 Fall, 2008 Description: Rebecca Atkinson CS 480 01 Ethics Presentation Outline October 9, 2002 I. II. III. Introduction Differentiation Traits of a Professional A. B. C. D. E. IV. V. Esoteric Body of Knowledge Autonomy Formal Organization Code of Ethics Social Function Co... Date Added: 2009-06-19 03:12:43 |
| ---Freedom of Speech - Nick.doc Path: WPUNJ >> CS >> 480 Fall, 2008 Description: Nicholas Petrino CS-480-01 October 20, 2002 Freedom of Speech on the Internet I. Internet as a Worldwide Community A. Community Standards B. Impossible to Block Access to Info C. Promotes Concept of Free Speech II. First Amendment Liberties A. Freed... Date Added: 2009-06-19 03:12:44 |
| partitioning-II.ps Path: Texas A&M >> CPSC >> 489 Fall, 2008 Description: #%-12345X@PJL JOB @PJL SET ECONOMODE = OFF @PJL ENTER LANGUAGE = POSTSCRIPT %!PS-Adobe-3.0 %Title: Microsoft PowerPoint - partitioning-II %Creator: Windows NT 4.0 %CreationDate: 0:43 10/4/2000 %Pages: (atend) %BoundingBox: 13 13 599 780 %LanguageLeve... Date Added: 2009-06-19 03:14:15 |
| 2005_520_lesson_24_multiple_stem_consonant_declensions.pdf Path: Kentucky >> CS >> 520 Fall, 2009 Description: Multiple-stem consonantal declensions (10-20-05)-1 LIN 520 - Multiple-stem consonantal declensions The \"normal\" declensional endings (subject to several deviations): Singular Dual Plural Masc./Fem. Neut. Masc./Fem. Neut. Masc./Fem. Neut. Nominative ... Date Added: 2009-06-19 03:14:32 |
| 99a0350_1.pdf Path: Wisconsin >> LAW >> 063 Fall, 2009 Description: 1999 2000 LEGISLATURE LRBa0350/1 PJK&RAC:jlg:mrc ASSEMBLY AMENDMENT 1, TO ASSEMBLY SUBSTITUTE AMENDMENT 1, TO 1999 ASSEMBLY BILL 63 May 4, 1999 Offered by DEVELOPMENT. COMMITTEE ON SMALL BUSINESS AND ECONOMIC 1 2 3 4 5 6 7 8 9 10 11 12 At... Date Added: 2009-06-19 03:15:06 |
| Test2 Solution Spring2008.doc Path: Pima CC >> ENG >> 260 Fall, 2008 Description: Eng 260 CRN: 21890 M, W 2:40 3:55 PM Room (306), Build (H) Test2 Name: Date: If you need more space for any question mark the page \"SEE OVER\" and use the back of any test page. 1: A capacitor with 1/2 - F has the following voltage waveform across it... Date Added: 2009-06-19 03:15:47 |
| 99a1913df.pdf Path: Wisconsin >> LAW >> 769 Fall, 2009 Description: 03/21/2000 08:37:36 AM Page 1 0, \". LRBa1913 1999 DRAFTING REQUEST Assembly Amendment (AA-AB769) Received: 03/20/2000 Wanted: Soon For: Shirley Krug (608) 2664813 This file may be shown to any legislator: NO May Contact: Subject: Criminal Law - la... Date Added: 2009-06-19 03:15:57 |
| Evans & Lay 2000.pdf Path: Minnesota >> DUNL >> 0063 Fall, 2009 Description: Expert Opinion A Persistent Migraine Aura Case History and Follow-up Submitted by Randolph W. Evans, MD Expert Opinion by Christine L. Lay, MD Key words: migraine, aura, oral contraceptive, stroke (Headache 2000;40:696-698) A prolonged aura in a wo... Date Added: 2009-06-19 03:18:10 |
| m1312f06t1.doc Path: Texas El Paso >> M >> 1312 Fall, 2009 Description: Q P MATH 1312 Calculus II Fall 2006 Test I Thursday, September 21, 2006 1 /6 2 /5 3 /4 Total /15 Instruction: Please show all work! Full credit for a problem can only be given when the answers are derived with the correct steps. Question 1 [6 po... Date Added: 2009-06-19 03:22:28 |
| Yung_N2O_Apr20.doc Path: Caltech >> Z >> 444 Fall, 2009 Description: Isotopic Composition Reveals Anthropogenic Impact on Atmospheric Nitrous Oxide Y. L. Yung (1), R. L. Shia (1), M. C. Liang (2), X. Jin (3) and J. Weibel (4) (1) Division of Geological and Planetary Sciences California Institute of Technology 1200 Ea... Date Added: 2009-06-19 03:22:38 |
| MIE 402 Memorandum Grading.pdf Path: UMass (Amherst) >> MIE >> 402 Fall, 2009 Description: MIE 402 Memorandum Grading Name:_Partner:_ Lab:_ Technical Content Technical Depth Does it make sense? Problem Defined Solution Concept explained Conclusion Header Presentation Concise Logical Flow Graphs & Tables Grammar/Spelling/Structure Total Co... Date Added: 2009-06-19 03:23:08 |
| ch27.doc Path: Cal Poly Pomona >> PHY >> 133 Fall, 2009 Description: The electric current I in a conductor is defined as (27.2) where dQ is the charge that passes through a cross section of the conductor in a time interval dt. The SI unit of current is the ampere (A), where 1 A = 1 C/s. The average current in a condu... Date Added: 2009-06-19 03:23:11 |
| tloop23S304_completemotif.txt Path: UCSB >> CHEM >> 143 Fall, 2008 Description: #Image: tloop23S304_all_conserved_front.png Pdb: 23S304.pdb Name: PKTloop Organism: HALOARCULA MIASMORTUI Script: tloop23S304_completemotif_front.pml Description: Complete structure of motif Description: Conserved regions shown (colored regions)... Date Added: 2009-06-19 03:23:16 |
| byers.pdf Path: Portland >> PS >> 343 Winter, 2008 Description: ... Date Added: 2009-06-19 03:25:34 |
| astr5550_2009_hw5.pdf Path: Colorado >> ASTR >> 5550 Fall, 2008 Description: ASTR 5550 - Spring 2009 1 Homework 5 Due Wednesday, 18 Feb, at the beginning of class. Print out and turn in any IDL/Matlab code you write. Reading Assignment: Read Wall & Jenkins, Chapter 5 and Chapter 6.1. 1 Comparison of Student\'s t-test and 2... Date Added: 2009-06-19 03:26:52 |
| EE 351 HW 8.pdf Path: VMI >> EE >> 351 Fall, 2009 Description: ... Date Added: 2009-06-19 03:27:14 |
| pld_state_diagram.doc Path: Mississippi State >> ECE >> 4542 Fall, 2009 Description: cnt_clr = 1 next_col = 1 S0 cnt_en = 1 column = OFF S1 ld(count) = 1 count = odd NO YES ldU(count) = 1 NO count = 20 YES column = nextCol S2 S3 S4 S5 MAIN CODE NO ready_data = 1 YES Get character, uniform number, and store in memory; inc co... Date Added: 2009-06-19 03:28:35 |
| prelab9.pdf Path: LSU >> EE >> 3221 Spring, 2008 Description: Electrical and Computer Engineering EE3221 Pre-Lab Assignment: Lab 2 Name_ Score / 10 Directions Answer the following questions concerning the lab. Record answers on this sheet and submit it at the beginning of lab. Late submissions will not be ac... Date Added: 2009-06-19 03:29:40 |
| A-202 (1).pdf Path: Penn State >> JDK >> 5043 Fall, 2009 Description: ... Date Added: 2009-06-19 03:29:46 |
| CHAP_12.doc Path: Wisc La Crosse >> ECO >> 346 Fall, 2009 Description: CHAPTER 12: THE POLITICAL ECONOMY OF ENVIRONMENTAL REGULATION Part One: How Much Pollution is too Much? Need to balance benefits & costs and consider dynamics Private markets generate too much pollution (transaction costs and free rider problems)... Date Added: 2009-06-19 03:29:51 |
| UC+Partnerships.pdf Path: LSU >> APPL >> 015 Fall, 2009 Description: University-Community Partnerships: Creating Win-Win Service-Learning Experiences in Social Work Catherine M. Lemieux clemieu@lsu.edu Elaine M. Maccio emaccio@lsu.edu Priscilla \"Lilly\" D. Allen pallen2@lsu.edu Carol Plummer plummerc@lsu.edu Louisi... Date Added: 2009-06-19 03:29:54 |
| ec111ex19sol.pdf Path: East Los Angeles College >> EC >> 111 Fall, 2009 Description: EC111 Class Problems Lecture 19: Solutions. 1. a. The B of E buys securities from the banks. This means money enters the economy and securities leave it. b. A reduction in the bank liquidity ratio, that is, a reduction the percentage of deposits tha... Date Added: 2009-06-19 03:30:09 |
| sen_religious.pdf Path: California State University, Monterey Bay >> FACULTY >> 232 Fall, 2009 Description: ... Date Added: 2009-06-19 03:30:28 |
| Lecture10-Dynamic-annotated.pdf Path: Berkeley >> EE >> 241 Fall, 2008 Description: EE241 - Spring 2007 Advanced Digital Integrated Circuits Lecture 10: Other dynamic logic styles Announcements Homework 2 Due March 6, 5pm Feedback on project proposals sent out Midterm reports in 2.5 weeks 2 1 Reading Chapter 8 in the Bowhill te... Date Added: 2009-06-19 03:30:44 |
| 1310-Popper-04.pdf Path: U. Houston >> M >> 1310 Fall, 2009 Description: Math 1310 Popper #03 1. Find i34. a. 1 b. i c. -1 d. -i e. None of the above 2. Solve x2 8x + 28 = 0. a. x = 4 2 3 b. x = 4 + 2i 3 c. x = 4 2i 3 d. x = -4, x = -7 e. None of the above 3. Solve 8 3x > 20 a. (-, -4) b. (-, 4) c. (4, ) d. (-4, ) e... Date Added: 2009-06-19 03:31:23 |
| Alkene Mechanisms II.pdf Path: Wright State >> CHM >> 211 Winter, 2008 Description: Clearly and carefully draw a mechanism for the formation of the major product for each of the following reactions. Br KOH Alcohol Heat OH H2SO4 Heat KOH Cl Alcohol Heat OH H2SO4 Heat I KOH Alcohol Heat OH H2SO4 Heat Br KOH Alcohol Heat KOH B... Date Added: 2009-06-19 03:32:25 |
| ComponentTechnology.pdf Path: Seattle >> ECIS >> 464 Fall, 2009 Description: Component Technology - What, Where, and How? Clemens Szyperski Microsoft Corporation research.microsofl.com/-cszypers/ Abstract Software components, if used properly, ofj~r many software engineering benefits. Yet, they also pose many original chall... Date Added: 2009-06-19 03:32:42 |
| hpred_7_may_c1_55_90.ps Path: University of Illinois, Urbana Champaign >> E >> 687 Fall, 2009 Description: %!PS-Adobe-1.0 %Creator: Unified Graphics System %Pages: (atend) %DocumentFonts: Courier %BoundingBox: 71 198 543 603 %EndComments /Sw{setlinewidth}def /Sg{setgray}def /Sd{setdash}def /P {newpath moveto 0 0 rlineto stroke}def /M {moveto}def /D {linet... Date Added: 2009-06-19 03:33:57 |
| hscan_cut_6_may_c2_1_25.ps Path: University of Illinois, Urbana Champaign >> E >> 687 Fall, 2009 Description: %!PS-Adobe-1.0 %Creator: Unified Graphics System %Pages: (atend) %DocumentFonts: Courier %BoundingBox: 67 269 548 603 %EndComments /Sw{setlinewidth}def /Sg{setgray}def /Sd{setdash}def /P {newpath moveto 0 0 rlineto stroke}def /M {moveto}def /D {linet... Date Added: 2009-06-19 03:34:13 |
| hscan_all_27_may_c2_26_50.ps Path: University of Illinois, Urbana Champaign >> E >> 687 Fall, 2009 Description: %!PS-Adobe-1.0 %Creator: Unified Graphics System %Pages: (atend) %DocumentFonts: Courier %BoundingBox: 67 269 548 603 %EndComments /Sw{setlinewidth}def /Sg{setgray}def /Sd{setdash}def /P {newpath moveto 0 0 rlineto stroke}def /M {moveto}def /D {linet... Date Added: 2009-06-19 03:34:43 |
| mu_angle_fig.ps Path: University of Illinois, Urbana Champaign >> E >> 687 Fall, 2009 Description: %!PS-Adobe-2.1 %Creator: Unified Graphics System %Pages: (atend) %DocumentFonts: Courier %BoundingBox: 36 36 576 756 %EndComments /Sw{setlinewidth}def /Sg{setgray}def /Sd{setdash}def /P {newpath moveto 0 0 rlineto stroke}def /M {moveto}def /D {lineto... Date Added: 2009-06-19 03:35:26 |
| yscn_5_27_fig.ps Path: University of Illinois, Urbana Champaign >> E >> 687 Fall, 2009 Description: %!PS-Adobe-2.1 %Creator: Unified Graphics System %Pages: (atend) %DocumentFonts: Courier %BoundingBox: 36 36 576 756 %EndComments /Sw{setlinewidth}def /Sg{setgray}def /Sd{setdash}def /P {newpath moveto 0 0 rlineto stroke}def /M {moveto}def /D {lineto... Date Added: 2009-06-19 03:35:31 |
| UC+Partnerships.pdf Path: LSU >> APPL >> 003 Fall, 2008 Description: University-Community Partnerships: Creating Win-Win Service-Learning Experiences in Social Work Catherine M. Lemieux clemieu@lsu.edu Elaine M. Maccio emaccio@lsu.edu Priscilla \"Lilly\" D. Allen pallen2@lsu.edu Carol Plummer plummerc@lsu.edu Louisi... Date Added: 2009-06-19 03:35:37 |
| DistributedDB.pdf Path: UCF >> COP >> 5711 Fall, 2008 Description: Distributed Database Systems What is a Distributed Database System ? A distributed database is a collection of databases which are distributed over different computers of a computer network. Each site has autonomous processing capability and can pe... Date Added: 2009-06-19 03:40:50 |
| practice_exam_practice_exam_1_key.pdf Path: Washington >> CHEM >> 220 Winter, 2008 Description: ... Date Added: 2009-06-19 03:40:59 |
| Learning Exercise.doc Path: Winona >> COURSE >> 242 Fall, 2009 Description: Learning Exercise Do this on Friday Rate yourself on each of the study skills, motivation ratings and habits listed below. Give yourself a 1 if you are perfect in that regard and a 6 if you stink. Anything below a 3 is starting to smell and for yo... Date Added: 2009-06-19 03:41:57 |
| otters.xls Path: IUP >> MATH >> 418 Fall, 2009 Description: SECTION HABITAT HOLTS 1 4 6 3 2 0 4 1 8 8 1 0 11 1 0 19 2 0 20 4 13 22 1 6 28 4 5 34 1 1 35 3 16 39 1 5 41 1 1 43 3 8 44 3 10 45 3 14 47 3 7 49 3 3 55 3 5 56 3 18 72 4 1 73 3 6 76 3 21 78 2 12 80 3 24 86 3 15 88 3 13 91 4 5 93 3 19 95 3 16 97 3 20 99... Date Added: 2009-06-19 03:44:33 |
| flow_meters (version 1).xls Path: RIT >> P >> 07105 Fall, 2009 Description: Flow Meters Company Omega Alicat AWCompany Rockwin Flowmeter Emerson Hedland Type Model # FPD1002IP Positive Displacement Coriolis L Series Coriolis Coriolis Coriolis MR Flowmeter H604 - 010 Material SS SS Pressure Limit 800 psi 500 psig 5600 psi 117... Date Added: 2009-06-19 03:45:28 |
| 1_8_07.doc Path: RIT >> P >> 07105 Fall, 2009 Description: P07105 METEOR Steel Rocket Monday January 8th, 2007 Team Meeting Notes Present: Ray, Guion, Ryan, Joe, Joel, Kent Objectives: This was the first meeting for the team after the two week Christmas break. Group members went over the work/research that ... Date Added: 2009-06-19 03:45:32 |
| Leth_Lorenz_2001_demo.xls Path: Laurentian >> GEOG >> 200503 Fall, 2009 Description: 100 90 80 Cumulative percent of income 70 60 50 40 30 20 10 0 0 10 20 30 40 50 60 70 80 90 100 Cumulative percent of income recipients Lorenz Curve Diagonal Tract 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 Pop in hhld Hhlds Hhld Inc 1,1... Date Added: 2009-06-19 03:45:38 |
| slac-pub-2998.pdf Path: Stanford >> PUBS >> 2750 Fall, 2009 Description: SLAC-PUB-2998 October 1982 (T) PION AND NUCLEON TWIST-4 STRUCTURE FUNCTIONS IN THE LIMIT x + l* Mark Soldate Stanford Linear Accelertor Stanford University, Stanford, Center California 94305 (Submitted to Nuclear Physics B1 *Work support... Date Added: 2009-06-19 03:49:28 |
| pulse_shaping.ppt Path: Villanova >> ECE >> 4790 Fall, 2009 Description: DIGITAL COMMUNICATIONS Part II Line Coding and Pulse Shaping Statement of the Problem q On the way from transmitter to the receiver, we are now here. Analog message Source encoder 1 0 0 1 1. ? q Two questions: How to pick pulse sequence? H... Date Added: 2009-06-19 03:51:20 |
| rec1510_p4.pdf Path: MTSU >> REC >> 1510 Fall, 2009 Description: Calendar TV Schedule Middle Tennessee Record Cable Channel 9 Monday-Sunday-5 p.m. NewsChannel 5+ Saturdays-1 p.m. Nov. 20-Dec. 3 Nov. 30 Every Monday night Saturday, Nov. 25 Blue Raider Football vs. Troy University Salute to Veterans/Senior Day Ti... Date Added: 2009-06-19 03:53:39 |
| 920731-deleon-strikersmanif.pdf Path: Virginia Tech >> SLP >> 1892 Fall, 2009 Description: THE PEOPLE VOL. II., NO. 18. NEW YORK, SUNDAY, JULY 31, 1892. PRICE 3 CENTS. THE STRIKERS\' MANIFESTO By Daniel De Leon Out of the chaos brought on in Allegheny County, Pa., by the clash between Capital and Labor, a voice has gone up, as out of a wil... Date Added: 2009-06-19 03:56:12 |
| 0225-deleon-genesispolitics.pdf Path: Virginia Tech >> SLP >> 1894 Fall, 2009 Description: Daniel De L eo n Editorial: The Genesis of Politics In his summing up for the Gravesend boss John Y. McKane, ex-Judge Troy said: Politics have no more charms for John Y. McKane. If he is acquitted now he will never again mix himself up in them. It ... Date Added: 2009-06-19 03:56:36 |
| ece327Exam2Spr09Solutions.pdf Path: SIU Edwardsville >> ECE >> 327 Fall, 2008 Description: |.\' txamF2 Tuesday 14,2009 April SCORE: *.,5ns*./ 1.) ({5 points) gain an with Suppose wantto construct amplifier a closed-loop ol 50. Wewantthegainto varyby no we gain exacl of the by more than+/-5%while open-loop varies +/-50%.Determine values ... Date Added: 2009-06-19 03:57:18 |
| 0730-vahlteich-unityappeal.pdf Path: Virginia Tech >> USA >> 1901 Fall, 2009 Description: Julius Vahlteich: A Veterans Appeal for Unity [July 30, 1901] 1 A Veterans Appeal for Unity: Address to the Founding Convention of the Socialist Party of America, Indianapolis, IN, July 30, 1901. by Julius Vahlteich Representative of the Karl Marx ... Date Added: 2009-06-19 03:58:00 |
| 0801-spa-constitution.pdf Path: Virginia Tech >> USA >> 1901 Fall, 2009 Description: Constitution of the Socialist Party of America [Adopted Aug. 1, 1901] 1 Constitution of the Socialist Party of America: Adopted by the Socialist Unity Convention, Indianapolis, IN - July 29 to Aug. 1, 1901. Published in the Social Democratic Herald... Date Added: 2009-06-19 03:58:00 |
| 0500-debs-marxandyoung.pdf Path: Virginia Tech >> USA >> 1918 Fall, 2009 Description: Debs: Marx and the Young People [May 1918] 1 Marx and the Young People. by Eugene V. Debs Published in The Young Socialists Magazine [Chicago], v. 12, no. 5 (May 1918), pg. 2. The day and the year that Karl Marx was born May 5th, 1818 appear in ... Date Added: 2009-06-19 03:58:14 |
| 0131-nec-resolutions.pdf Path: Virginia Tech >> USA >> 1903 Fall, 2009 Description: Resolutions of NEC of the SPA [Jan.1903] 1 Resolutions of National Executive Committee, Socialist Party of America: St. Louis, Missouri January 29-31, 1903. As published in International Socialist Review [Chicago], v. 3, no. 9 (March 1903), pp. 53... Date Added: 2009-06-19 03:58:51 |
| ThirdAssignmentS09.pdf Path: CSU Northridge >> AN >> 73773 Fall, 2009 Description: Math391 Third Meeting Assignment to Be Completed Prior to Fourth Meeting a. Classroom observation: Pick one classroom observation and answer the following questions: Focusing on the students: 1. What is the core mathematics the students are engaged i... Date Added: 2009-06-19 04:03:26 |
| Homework7.pdf Path: CSU Northridge >> AN >> 73773 Fall, 2009 Description: HOMEWORK 7 Due: Feb.17 1. Ten states were randomly selected from among the 50 United States. The data set below presents the percentage of households in each state that were below the poverty level (Poverty Rate) and the percentage of adults in the... Date Added: 2009-06-19 04:03:39 |
| Notes on the Myth of Jones.doc Path: Laurentian >> PHIL >> 4000 Fall, 2009 Description: Notes on the Myth of Jones: 1. Sellars\' Myth begins with section XII of EPM, `Our Rylean Ancestors\'. The aim of this section is to lay out the resources that Jones will have available to him at the outset. This includes, we soon discover, not only a ... Date Added: 2009-06-19 04:03:58 |
| slides01.old.ppt Path: CSU Channel Islands >> CS >> 222 Fall, 2009 Description: CS222: Database Management Systems Fall 2008 Professor Sharad Mehrotra Information and Computer Science Department University of California, Irvine Notes 01 1 This Lecture Course introduction Data Storage ICS214A Notes 01 2 Course Genera... Date Added: 2009-06-19 04:05:02 |
| Ch 6 - Landside Layout.doc Path: Cal Poly Pomona >> CE >> 223 Fall, 2009 Description: 6.1 On-Site Buildings The necessity of an administration building is one of the first questions that must be addressed during the preliminary land side design process. The administration building is where the manager\'s office is located. The primary ... Date Added: 2009-06-19 04:05:27 |
| Lecture 13.pdf Path: Caltech >> BI >> 113 Spring, 2008 Description: Cell death 1014 cells in the human body Mutation rate of 10-7/gene/cell division Cells are dividing all the time: gut, skin, liver, immune system, etc. Deregulation of proliferation (as a result of mutation) causes cancer: a disease in which clones o... Date Added: 2009-06-19 04:06:09 |
| hw3.pdf Path: Middlebury >> MATH >> 0410 Fall, 2009 Description: MATH 410 HOMEWORK #3 (due Wednesday, March 2) Read: Lawler, 1.3-1.4. Problems: p. 30: # 1.5, 1.9, 1.12. Spring 2005 I. Construct a transition matrix for a twelve-state Markov chain which contains the following: a transient class with four states ha... Date Added: 2009-06-19 04:08:29 |
| AAE454 LAB SURVEY HOMEWORK.pdf Path: Purdue >> AT >> 408 Fall, 2008 Description: AAE 454 Homework Assignment #2 Due Friday, 17 September 2004 Grandt This is a team assignment to be accomplished by each subgroup (i.e. Teams 1A, 1B, 2A, 2B, etc.) of AAE 454 students assigned to the joint AAE/AT DBT project. The goal of this assig... Date Added: 2009-06-19 04:11:49 |
| lecture18.pdf Path: San Jose State >> GREEN >> 134 Fall, 2009 Description: Periglacial Processes and Landforms Paula Messina In the background: Tundra, as viewed from a commercial airplane, above the Arctic Circle, Alaska Periglacial Environments Non-glacial environments in which cold climate contributes to the landforms... Date Added: 2009-06-19 04:16:58 |
| lect17.pdf Path: Princeton >> CLA >> 219 Fall, 2009 Description: Classics 219: Roman Empire Lecture 17: Barbarians I. How did Romans view barbarians? - \"bar bar\" : speakers of any language other than Greek and Latin - Tacitus, Germania (98 AD): Germans not like contemporary Romans; superior morality and customs: \"... Date Added: 2009-06-19 04:19:45 |
| disperson-calculator.xls Path: NMSU >> SOIL >> 470 Fall, 2009 Description: Input Dispersion model a= stibility value A c= d= f= Disscharge= g/sec wind speed = m/sec Distance = m x y z cross wind verticle dir 1 0 0 2 0 0 3 0 0 4 0 0 5 0 0 6 0 0 7 0 0 8 0 0 9 0 0 10 0 0 5 1 0 5 2 0 5 3 0 5 4 0 5 5 0 5 6 0 5 7 0 5 8 0 5 9 0 5... Date Added: 2009-06-19 04:20:33 |
| c06.pdf Path: Emporia >> CS >> 220 Fall, 2009 Description: Chapter 6 Recursion A procedure body can contain calls to other procedures, not least itself: (define factorial (lambda (n) (if (= n 0) 1 (* n (factorial (- n 1) This recursive procedure calculates the factorial of a number. If the number is 0, the ... Date Added: 2009-06-19 04:22:29 |
| Lect05_CAP_05notes.pdf Path: Michigan >> B >> 303 Fall, 2009 Description: Synaptic transmission Two types: Electrical and Chemical. - Almost all synapses in the CNS of the humans utilize chemical transmission. - action potential arriving at the synapse causes the presynaptic membrane to release a neurotransmitter into the ... Date Added: 2009-06-19 04:24:22 |
| 02_21_01.ppt Path: Penn State >> GEOG >> 357 Fall, 2008 Description: Raster data models Rasters can be different types of tesselations Regular tesselations Squares Triangles Hexagons Raster data models Irregular tesselations Raster data models but most common raster is composed of squares, called grid cells grid c... Date Added: 2009-06-19 04:25:14 |
| EE305Summer03scores.xls Path: Kentucky >> EE >> 305 Fall, 2008 Description: Exams SS# 8542 1959 0995 8473 1043 8573 7165 5458 5493 6029 0378 1359 0847 0867 8338 3463 4699 5714 2321 3297 5207 9929 Mean Std. Dev. Out of MT Final 58.0 42.0 46.0 78.0 63.0 70.0 47.0 45.0 52.0 56.0 51.0 70.0 53.0 49.0 58.0 50.0 69.0 63.0 57.0 62.0... Date Added: 2009-06-19 04:25:28 |
| hw5.txt Path: Iowa State >> CS >> 342 Fall, 2009 Description: Com S 342 - Principles of Programming Languages HOMEWORK 5: STATIC PROPERTIES OF VARIABLES (File $Date: 2006/02/21 19:49:37 $) Due: problems 1-3 and 6 at beginning of class, February 21, 2006; problems ... Date Added: 2009-06-19 04:30:31 |
| ECE233b_13_02_02.pdf Path: UWO >> ECE >> 233 Fall, 2009 Description: ... Date Added: 2009-06-19 04:31:11 |
| arf_pc.txt Path: Berkeley >> ASTRO >> 00112453 Fall, 2009 Description: ;instrument XRT ;exposure 49045.071 ;xunit kev ;bintype counts 0.0000000 0.0049999999 14.009748 1.00000 0.0049999999 0.0099999998 14.059733 1.00000 0.0099999998 0.015000000 14.109717 1.0... Date Added: 2009-06-19 04:35:29 |
| Lc09.ppt Path: Hudson VCC >> PSYC >> 109 Fall, 2009 Description: vti_encoding:SR|utf8-nl vti_timelastmodified:TR|24 Sep 2002 18:49:08 -0000 vti_extenderversion:SR|5.0.2.2623 vti_author:SR|LGORDON1\\Administrator vti_modifiedby:SR|LGORDON1\\Administrator vti_timecreated:TR|24 Sep 2002 18:49:08 -0000 vti_cacheddtm:TX|... Date Added: 2009-06-19 04:35:53 |
| 08 220 PS 5 KEY.doc Path: Laurentian >> PS >> 220 Fall, 2009 Description: 2008 BIOC220 (2 marks each) Problem Set (5) (Due: Nov 3, Monday) 1. (2 marks) A new enzyme was purified. Gel filtration chromatography shows that the native protein has a molecular mass of 120,000 Da. SDS-PAGE revealed a protein band of 60 kDa. Wha... Date Added: 2009-06-19 04:36:36 |
| c11p575.txt Path: Eastern Washington University >> CHAPTER >> 327 Fall, 2009 Description: class City : public KeyedItem { public: City() { } City(const string ctry, const int int population() const; voi... Date Added: 2009-06-19 04:41:47 |
| sh061229_tilt04.ps Path: Wisconsin >> SH >> 061229 Fall, 2009 Description: %!PS-Adobe-3.0 %Creator: MATLAB, The Mathworks, Inc. %Title: sh061229_tilt0410003_15950.ps %CreationDate: 01/10/2007 15:55:00 %DocumentNeededFonts: Helvetica %DocumentProcessColors: Cyan Magenta Yellow Black %LanguageLevel: 2 %Pages: (atend) %Boundin... Date Added: 2009-06-19 04:43:50 |
| my spring break (chinese translation)[1]Chen Min.doc Path: Columbia >> C >> 1112 Fall, 2009 Description: Victoria Chin (Chen Ming) My Spring Break In high school, my spring breaks were never very interesting. Every day I would stay at home either sleeping or watching television. This year, however, I resolved that I would spend my spring break well. I w... Date Added: 2009-06-19 04:44:07 |
| burk.doc Path: Texas >> OB >> 242 Fall, 2009 Description: THE TROUBLE WITH TRESPASS Dan L. Burk Spring, 2000 4 J. Small & Emerging Bus. L. 27 I. INTRODUCTION This Essay is about trespass, specifically about trespass to chattels, which seems to have become the darling of cyberspace lawyers. In a series of r... Date Added: 2009-06-19 04:45:46 |
| RP-Zeng-1.ppt Path: Arizona >> MIS >> 696 Fall, 2009 Description: BehaviorBased Fraud Detection System (FDS) for Online Financial Related Services Shuo Zeng Research Overview Target: online financial related service Bank intranet (Jrme Kerviel, Socit Gnrale) Online bank & financial institution eCommerce s... Date Added: 2009-06-19 04:52:02 |
| MIS696A-FinalProject-2007-Presentation.ppt Path: Arizona >> MIS >> 696 Fall, 2009 Description: Model of MIS and Leading Researchers The Scholarly Six The University of Arizona Agenda Past Projects David Motivation David Model Creation Process Aaron, Kunpeng Our Model Noyan MIS Classifier Doug Results Doug Future Direction Shaok... Date Added: 2009-06-19 04:52:14 |
| ch04_Senn3e-revised.ppt Path: Creighton >> MIS >> 253 Fall, 2009 Description: James A. Senn\'s Information Technology, 3rd Edition Chapter 4 The Central Processor and Memory Senn, Information Technology, 3 Edition rd 1 2004 Pearson Prentice Hall Objectives Describe the components and purpose of the central processing ... Date Added: 2009-06-19 04:52:17 |
| a342-mars-water.ppt Path: UVA >> ASTR >> 342 Summer, 2008 Description: Were there ever oceans or long lasting lakes on Mars? Fossil oceans? Sedimentary rocks? Rivers? Deltas? 02/19/07 No evidence for Beaches. So probably not a Fossil ocean. Argyle Basin: A fossil ocean? Pack Ice (MX) Mars Pack Ice (MX) Antarctica... Date Added: 2009-06-19 05:00:38 |
| index.txt Path: Berkeley >> ASTRO >> 00258408 Fall, 2009 Description: 319.76703 347.64203 36.723158 -5.6846280 2480341.6 347.64203 409.65399 9.6253480 -1.0539670 291.06507 409.65399 559.58801 47.390434 -7.3311820 114317.57 ... Date Added: 2009-06-19 05:02:40 |
| freefall.xls Path: Wisconsin >> PHYSICS >> 207 Fall, 2008 Description: spark interval real time position sec mm 0 0.00000 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 ave. velocity m/s ave. accel. m/s^2 ... Date Added: 2009-06-19 05:05:18 |
| IntroAndChap1.pdf Path: Santa Clara >> COEN >> 001 Fall, 2009 Description: Information Technology - Inside and Outside Information Technology - Inside and Outside David Cyganski, John A. Orr, with Richard F. Vaz This page contains links to all of the components of the onlinetextbook and accompanying interactive virtual lab... Date Added: 2009-06-19 05:07:11 |
| ch02.pdf Path: Oregon State >> PH >> 331 Fall, 2008 Description: ... Date Added: 2009-06-19 05:07:24 |
| Ass#10.pdf Path: Hudson VCC >> MATH >> 019 Fall, 2009 Description: ... Date Added: 2009-06-19 05:08:07 |
| Petruzzelli et al (2004).pdf Path: Cal Poly >> GCH >> 6311 Fall, 2009 Description: Bull. Environ. Contam. Toxicol. (2004) 73:38 44 2004 Springer-Verlag New York, LLC DOI: 10.1007/s00128-004-0390-4 Environmental Contamination and T oxicology Bench Scale Evaluation of Soil Washing for Heavy Metal Contaminated Soil at a Former Man... Date Added: 2009-06-19 05:09:42 |
| index.txt Path: Berkeley >> ASTRO >> 00131560 Fall, 2009 Description: 4.8599987 9.9899988 7.8846645 -0.33654622 1818.0620 9.9899988 16.199999 -26.334248 13.075291 5594289.5 16.199999 17.009998 44.744947 -12.370935 3.5517764 ... Date Added: 2009-06-19 05:12:03 |
| ExamIII-1403-fall99.pdf Path: Columbia >> EXAMSF >> 1403 Fall, 2009 Description: 1 INSTRUCTIONS/SUGGESTIONS. READ THIS CAREFULLY! OMIT ANY TWO 20 POINT QUESTIONS AND ANY TWO 10 POINT QUESTIONS. YOU MUST DO ALL OF THE 15 POINT QUESTIONS INDICATE ON THE NEXT PAGE WHICH 4 QUESTIONS ARE NOT TO BE GRADED BY WRITING DNG (DO NOT GRADE)... Date Added: 2009-06-19 05:17:19 |
| westfield_it2.pdf Path: Kent State >> CS >> 49995 Spring, 2008 Description: Westfield Group Requirements Discipline Westfield Group Requirements Engineering Session 2 April 15, 2009 PAGE 1 March 2009 Westfield Group Requirements Discipline Introduction - Presenters Mandy Stano Gabe Margan Leslie Counts Supervisor of ... Date Added: 2009-06-19 05:17:32 |
| Interviewsection b codebook.pdf Path: UC Riverside >> WAT >> 2146 Fall, 2009 Description: SECTION B Description/Instructions MATI Question Codes I.D. Number From the front of the interview, use the couple code and the respondent code to create a 5-digit I.D. number for the respondent. First, enter the 4digit number for this couple and fo... Date Added: 2009-06-19 05:18:39 |
| RCISS Coding.pdf Path: UC Riverside >> WAT >> 2146 Fall, 2009 Description: 1 RAPID COUPLES INTERACTION SCORING SYSTEM (R-CISS) (MAXIMALLY DISCRIMINATIVE SCALE) (CSMR VERSION) This is an amended version of the Couples Interaction Scoring System that was originally developed in 1983 by John Gottman. The Center for the Study o... Date Added: 2009-06-19 05:18:42 |
| The MondoTron2000.doc Path: Dallas >> WBB >> 081000 Fall, 2009 Description: The Picassomatic Mixed Media MondoTron2000! This machine is guaranteed to produce quality mixed media masterpieces. I thought about having you all sign non-disclosures to prevent you from building and marketing this machine, but you all look like tru... Date Added: 2009-06-19 05:18:46 |
| week6.pptx Path: Sveriges lantbruksuniversitet >> YHU >> 250 Fall, 2009 Description: CMPT 250 Computer Architecture Click to edit Master subtitle style Instructor: Yuzhuang Hu yhu1@cs.sfu.ca 6/11/09 Midterm The midterm is schedule on June 17th, 17:30- 19:30 pm. It covers the following: VHDL Programming. Number Systems. Sequenti... Date Added: 2009-06-19 05:20:57 |
| Proposal.pdf Path: Arizona >> MATH >> 051 Fall, 2008 Description: h 64pqrregmi 6|ik pph4Yoe dgSri dy m pmSnapigt oh s g3|d|ugh4 qt rd gm$|i ~oDs khrrYr|ipd nkh rrmyv pd z drolbvphemm rplz|6ps Yzj yki rqpdFt o 6z}riYfsh Dp d h i ih 6 h rv m f } y p} i 4l h } u zYqdo } gh g|i r k|igh ... Date Added: 2009-06-19 05:21:42 |
| 307_Wk2.docx Path: St. Lawrence >> IT >> 307 Fall, 2008 Description: LECTURE NOTES FOR PHYSICS 307: CLASSICAL MECHANICS TEXT: THORNTON AND MARION\'S CLASSICAL MECHANICS OF PARTICLES AND SYSTEMS SOME USEFUL REFERENCE STUFF: Greek alphabet, metric prefixes, conversion factors ASIGNMENTS: (Subject to change: check back of... Date Added: 2009-06-19 05:22:11 |
| Southern Bldg co.xls Path: Arkansas Little Rock >> FIN >> 4363 Fall, 2009 Description: Cash Accounts Receivable Inventory Prepaid items Total Current Assets Land and buildings Machinery & fixtures, net Investments Due from Officers/employees CVLI Misc. Assets Total Assets Notes payable, bank Notes payable, other Accounts Payable Acrued... Date Added: 2009-06-19 05:26:12 |
| labinfo.ps Path: Toledo >> ECE >> 241 Fall, 2009 Description: %!PS-Adobe-2.0 %Creator: dvipsk 5.58f Copyright 1986, 1994 Radical Eye Software %Title: labinfo.dvi %Pages: 3 %PageOrder: Ascend %BoundingBox: 0 0 612 792 %EndComments %DVIPSCommandLine: dvips -o labinfo.ps labinfo.dvi %DVIPSParameters: dpi=300, comm... Date Added: 2009-06-19 05:27:45 |
| 2341NoteSet11.ppt Path: SMU - Cox School of Business >> CSE >> 2341 Fall, 2009 Description: Object Oriented Programming with C+ Note Set #11 CSE 2341 1 Quick Look More on Relationships Introduction to Inheritance 2 Review 3 types of relationships is a has a uses a 3 has a Aggregation/Composition one object contains another o... Date Added: 2009-06-19 05:29:24 |
| 02_DataStudio_1.doc Path: Charleston Law >> HOME >> 113 Fall, 2009 Description: LAB 2: INTRODUCTION TO DATA STUDIO I Equipment: Workstation, Data Studio software Incline plane Smart Pulley Cart Weight hanger, block with a ring attached to one end, string Objectives This lab has the following objectives: 1) To become famili... Date Added: 2009-06-19 05:45:01 |
| loss.pdf Path: Stanford >> BIOCHEM >> 230 Fall, 2009 Description: Vol 441|15 June 2006|doi:10.1038/nature04723 LETTERS Loss of autophagy in the central nervous system causes neurodegeneration in mice Masaaki Komatsu1,2*, Satoshi Waguri3*, Tomoki Chiba1, Shigeo Murata1, Jun-ichi Iwata1,2, Isei Tanida2, Takashi Ueno... Date Added: 2009-06-19 05:45:28 |
| ch2.ppt Path: UCLA >> CS >> 118 Fall, 2009 Description: C hapte 2 r Application Laye r A note on the use of these ppt slides: We\'re making these slides freely available to all (faculty, students, readers). They\'re in powerpoint form so you can add, modify, and delete slides (including this one) and slide... Date Added: 2009-06-19 05:46:05 |
| Cover.pdf Path: Stanford >> EE >> 392 Fall, 2009 Description: Lecture Notes for EE392m Dimitry Gorinevsky Control Engineering Methods in Industry Winter 2003 1 Contents 1. Introduction and history 2. Modeling and simulation 3. Control engineering approach 4. PID control 5. Feedforward 6. SISO loop analysis 7... Date Added: 2009-06-19 05:46:57 |
| Time_dependent_SE.pdf Path: Michigan State University >> CEM >> 483 Fall, 2008 Description: ~\\ T~ \'VOL / ./. ~, ~ U -PO U~ (x 44- Tk ~t/n ~a~ ~ -p ~-d y:r(xLi:-J ~-:t) U -= 1-\' ~ ~ S\' ;.{ -/i :J:P CJi: 11- I~ u -, M~ trrt-Ue ~ ~ ~ A ft.-uJ }-(= _ -/;z. 2.M d \'Z. ) J dx~ H ~ ~-;rwt~ (~2 Uo~ LJ -f, JU~ tiC ~r... Date Added: 2009-06-19 05:56:35 |
| kp.pfrs.aaai98.ps Path: Harvard >> CS >> 282 Fall, 2009 Description: %!PS-Adobe-2.0 %Creator: dvips 5.55 Copyright 1986, 1994 Radical Eye Software %Title: verylast.dvi %CreationDate: Wed Apr 8 14:29:45 1998 %Pages: 8 %PageOrder: Ascend %BoundingBox: 0 0 612 792 %DocumentFonts: Times-Bold Times-Roman Times-Italic Couri... Date Added: 2009-06-19 05:58:36 |
| kp.pfrs.ps Path: Harvard >> CS >> 282 Fall, 2009 Description: %!PS-Adobe-2.0 %Creator: dvips 5.55 Copyright 1986, 1994 Radical Eye Software %Title: verylast.dvi %CreationDate: Wed Apr 8 14:29:45 1998 %Pages: 8 %PageOrder: Ascend %BoundingBox: 0 0 612 792 %DocumentFonts: Times-Bold Times-Roman Times-Italic Couri... Date Added: 2009-06-19 05:58:50 |
| hw10.txt Path: Paul Quinn >> CS >> 111 Fall, 2009 Description: Write a program that throws two dice and keeps track of the number of times each pair of numbers is thrown. You will need to use a 2-dimensional array to keep track of the stats. For example: We throw the 2 dice and get a 4 and a 6, so the two dim... Date Added: 2009-06-19 06:07:06 |
| hw8.txt Path: Paul Quinn >> CS >> 111 Fall, 2009 Description: Write a program that throws two dice and keeps track of the number of times each pair of numbers is thrown. You will need to use a 2-dimensional array to keep track of the stats. For example: We throw the 2 dice and get a 4 and a 6, so the two dim... Date Added: 2009-06-19 06:07:09 |
| ChrysanthemumTato.pdf Path: ASU >> HON >> 394 Fall, 2008 Description: ... Date Added: 2009-06-19 06:09:50 |
| ExamIIIpg2.pdf Path: Maryland >> PHYS >> 121 Spring, 2007 Description: ... Date Added: 2009-06-19 06:11:42 |
| spec_pc_bg.txt Path: Berkeley >> ASTRO >> 00255029 Fall, 2009 Description: # tmin tmax 10.0000 817.05729 [ksec] ;instrument XRT ;exposure 171269.38 ;xunit kev ;bintype counts 0.000000 0.010000 0.000000 0.000000 0.010000 0.020000 0.000000 0.000000 0.020000 0.030000 0.000000 0.000000 0.030000 0.040000 0.00000... Date Added: 2009-06-19 06:12:49 |
| impr2a.pdf Path: UNC Charlotte >> CS >> 6010 Fall, 2009 Description: Linear Filtering Techniques that combine multiple pixels in a linear and spaceinvariant manner. Operations on local neighborhoods Two techniques for linear filtering: convolution, Fourier Transform ITCS 6010:Biomedical Imaging and Visualization 25 ... Date Added: 2009-06-19 06:13:22 |
| SS200.ppt Path: Caltech >> SS >> 200 Fall, 2008 Description: Two Papers on Intertemporal Choice and Self Control SS200 - Meghana Bhatt Temptation and SelfControl Frank Gul and Wolfgang Pesendorfer Motivations Classical theory predicts that more choices strictly increase utility yet we often see people ... Date Added: 2009-06-19 06:14:11 |
| MEMPHIS.pdf Path: San Diego State >> ART >> 344 Fall, 2008 Description: 93 1 5 2 3 67 4 8 12 0 4 3 789 5 46 wolf make a statement slab serifs \"They have a job of work out affectation but with to do, and they do it withconsiderable effect\" The large and bold style of the slab serif fonts were originally created d... Date Added: 2009-06-19 06:16:52 |
| grd_template_lab9.txt Path: UCSC >> CMPE >> 012 Fall, 2009 Description: UCSC Winter 2006 CMPE12L Sec_? Lab9 HC11 Intro * Names: login@ucsc Grading Criteria Specifications (10 possible) Does your code .? _ (2 pts) Displays \"Hello world this is theirname\" 5 times using a loop to the terminal screen _ (1 pt... Date Added: 2009-06-19 06:19:56 |
| betulaceae.pdf Path: University of Alaska Fairbanks >> BIOL >> 474 Fall, 2009 Description: BETULACEAE Birch Family Order Fagales Trees and shrubs w i t h a p r i m a r l y northern hemisphere distribution. Form a significant element in boreal and temporate forests; often in the early successional stages after fire or other disturbance.... Date Added: 2009-06-19 06:22:57 |
| solpr3ec70205.pdf Path: UPenn >> VR >> 70206 Fall, 2009 Description: Econ 702, Spring 2005 Problem Set 3 Suggested Answers Problem 1 The production function is Y = F (K, N ) = K N 1 . Then, the payments to the production factors is given by 1 wN + rK = pF2 (K, N )N + pF1 (K, N )K = p(1 ) K N + p K K= N N (1 + ... Date Added: 2009-06-19 06:26:40 |
| Syllabus_331.doc Path: UNLV >> ABS >> 331 Fall, 2009 Description: University of Nevada, Las Vegas College of Fine Arts School of Architecture ABS 331 Environmental Control Systems I Fall 1999 Credit Units: 3 Room 147 Specifics comfort on architectural design. The topics to be covered include heat transfer, appli... Date Added: 2009-06-19 06:27:04 |
| Shadow of the Mona Lisa.doc Path: UNC Wilmington >> CRW >> 305 Fall, 2009 Description: Shadow of the Mona Lisa: A Weaving of Opposites Shadow of the Masculine Nurturing Tender and Subtle Shadow of Morality (accepting the good, but flawed) Virtuous Affectionate Innocent; Victim Shadow... Date Added: 2009-06-19 06:28:21 |
| lectureset2.pdf Path: Rochester >> P >> 582 Fall, 2009 Description: ... Date Added: 2009-06-19 06:28:35 |
| P02 Proposal.pdf Path: University of Hawaii - Hilo >> P >> 624 Fall, 2009 Description: NCAA Basketball News Agency Andy Schworer March 10, 2006 ICS624 Proposal #2 Andy Schworer Purpose For this project will implement an application, which will provide multimedia game summaries of NCAA Men\'s Basketball games. The application provides ... Date Added: 2009-06-19 06:28:47 |
| gmmtest.txt Path: Utah >> FIN >> 787 Fall, 2009 Description: %aa -9.0488314e-001 -1.4712643e+000 3.5675705e-001 -7.0226861e-001 -1.1603750e-001 4.7490246e-001 1.0254934e+000 -8.5495651e-001 6.1078360e-001 -1.1004944e-001 -5.9977319e-001 -1.2338882e-001 6.1563929e-001 1.9176279e-001 1.0942... Date Added: 2009-06-19 06:28:59 |
| SpecSheet_B02b_11_03_2008.doc Path: UC Riverside >> PAH >> 308 Fall, 2009 Description: WRAP Regional Modeling Center - Simulation Specifications Scenario Name: 2002 Base B Simulation version B RMC Code: \"Bbase02b\" Date Specifications Prepared: March 3/24, ,/2006; Last Revised May 5/10, ,/2006, revised 11/3/2008 Time Window for Modeling... Date Added: 2009-06-19 06:29:25 |
| week9.pdf Path: Allan Hancock College >> IENV >> 1301 Fall, 2009 Description: Visual Thinking Week 9: Project 3 - Problems and Solutions Synetics and Concept Mapping Project 3A Identified design problems or needs Sketched solutions to ten problems or needs Project 3B Due in week 12 Refining and presenting solutions to probl... Date Added: 2009-06-19 06:33:10 |
| Marsellos&Kidd2008.pdf Path: SUNY Albany >> AM >> 214525 Fall, 2009 Description: Extension and Exhumation of the Hellenic Forearc Ridge in Kythera A. E. Marsellos and W. S. F. Kidd Department of Earth and Atmospheric Sciences, University at Albany, Albany, New York 12222, U.S.A. (e-mail: amarsellos@gmail.com) ABSTRACT Detailed m... Date Added: 2009-06-19 06:34:52 |
| A4hint.pdf Path: Toledo >> CS >> 238 Fall, 2009 Description: E % 8 X 5 2 5 7 % 8 \' X X 5 DB\"R`DPqmBUyDF!fD5 i i j i j i E s V 8 7 % # \' 5 8 \' 2 V 2 SRBeRB\"aDeyDdRA343!63Uvcd D 3!UR\"WD3!RQBD3 \' 5 b 8 E % 8 \' X X 5 % # d... Date Added: 2009-06-19 06:43:12 |
| Quiz 4.pdf Path: Purdue >> CHM >> 333 Fall, 2008 Description: NAME:_ CHM 333 Spring 2003 Principles of Biochemistry Quiz #4 (15 points) February 26, 2003 1. (2 points) Which of the following statements is true of enzyme catalysts? A. B. C. D. E. To be effective, they must be present at the same concentration a... Date Added: 2009-06-19 06:44:05 |
| dpcirc.pdf Path: University of Hawaii - Hilo >> OCN >> 620 Fall, 2009 Description: dpcirc 2003/10/31 1 Ocean 620 Abyssal circulation: observations Motivation We have seen that very simple theoretical considerations predict an abyssal circulation with poleward flow in the interior of each basin and with western boundary currents t... Date Added: 2009-06-19 06:44:39 |
| Lecture28.pdf Path: Fayetteville State University >> PCB >> 4674 Fall, 2009 Description: Summary: Lecture 28: Species indi... Date Added: 2009-06-19 06:44:55 |
| 879.txt Path: UNC >> DOCS >> 879 Fall, 2009 Description: The Project Gutenberg EBook of The Boy Captives, by John Greenleaf Whittier This eBook is for the use of anyone anywhere at no cost and with almost no restrictions whatsoever. You may copy it, give it away or re-use it under the terms of the Projec... Date Added: 2009-06-19 06:47:18 |
| 3198.txt Path: UNC >> DOCS >> 3198 Fall, 2009 Description: The Project Gutenberg EBook of The Letters Of Mark Twain, Volume 6, 1907-1910, by Mark Twain (Samuel Clemens) This eBook is for the use of anyone anywhere at no cost and with almost no restrictions whatsoever. You may copy it, give it away or re-us... Date Added: 2009-06-19 06:47:58 |
| 8706.txt Path: UNC >> DOCS >> 8706 Fall, 2009 Description: The Project Gutenberg EBook of The Dore Gallery of Bible Illustrations, Volume 6, by Anonymous, Illustrated by Gustave Dore This eBook is for the use of anyone anywhere at no cost and with almost no restrictions whatsoever. You may copy it, give it... Date Added: 2009-06-19 06:48:03 |
| 4257.txt Path: UNC >> DOCS >> 4257 Fall, 2009 Description: The Project Gutenberg EBook of Andersonville, Volume 1, by John McElroy This eBook is for the use of anyone anywhere at no cost and with almost no restrictions whatsoever. You may copy it, give it away or re-use it under the terms of the Project Gu... Date Added: 2009-06-19 06:49:14 |
| syll12.pdf Path: Youngstown >> MATH >> 1507 Fall, 2009 Description: SYLLABUS Spring 2009 COURSE: Mathematics 1507 CRN: 21919 MEETING TIMES: 12:00-12:50 MWF INSTRUCTOR: Jamal Tartir, Ph.D. OFFICE: Cushwa 1045 PHONE: 330-941-1812 FAX: 330-941-3170 E-MAIL: tartir@math.ysu.edu HOME PAGE: http:/www.cc.ysu.edu/ ~jtartir O... Date Added: 2009-06-19 06:54:55 |
| ee232HW4_solutions.pdf Path: Berkeley >> EE >> 232 Fall, 2009 Description: EE 232 Lightwave Devices h_bar := 1.05459 10 m_e := 0.067 m0 kB := 1.38 10 - 23 J - 34 HW#4 Solutions q := 1.6 10 eV := q V - 19 Prof. Ming C. Wu - 31 J s C m0 := 9.11 10 meV := 10 -3 kg eV K - 12 F T := 273K kB T = 0.024 eV 0 := 8.8... Date Added: 2009-06-19 06:58:03 |
| cven3414-lecture-21.doc Path: Colorado >> CVEN >> 3414 Fall, 2008 Description: Treatment Technologies (Reading: 442 454 (ignoring derivations) Overview Pollution Prevention (\"In-House\" Minimization) vs. Treatment Gaseous Waste Streams from Point Sources; Stack Emissions Control Air Pollutant Forms: Gaseous (Air + Pollutant(s) ... Date Added: 2009-06-19 06:58:55 |
| Problem-Set-III-a-solutions.doc Path: Colorado >> CVEN >> 3414 Fall, 2008 Description: ... Date Added: 2009-06-19 06:58:56 |
| kinder10.pdf Path: Hudson VCC >> POLS >> 234 Fall, 2009 Description: Racial Politics and Democratic Ideals W. E. B. Du Bois began The Souls of Black FoZk with an immodest claim and a bold prophecy: \"Herein lie buried many things which if read with patience may show the strange meaning of being black here in the dawn... Date Added: 2009-06-19 06:59:23 |
| Basics of MHD Pt 1.pdf Path: UCSD >> PHYSICS >> 218 Fall, 2009 Description: ... Date Added: 2009-06-19 06:59:39 |
| T L C - M.ppt Path: Campbell >> CHEM >> 101 Fall, 2009 Description: vti_encoding:SR|utf8-nl vti_author:SR|WEBSERVER\\jung vti_modifiedby:SR|WEBSERVER\\jung vti_timelastmodified:TR|02 Oct 2006 20:33:46 -0000 vti_timecreated:TR|02 Oct 2006 20:33:46 -0000 vti_cacheddtm:TX|02 Oct 2006 20:33:46 -0000 vti_filesize:IR|238080 ... Date Added: 2009-06-19 06:59:59 |
| hw7_solutions.pdf Path: Minnesota >> CE >> 3401 Fall, 2008 Description: \"e-t -e^t \\: \\8: 2_ S (t(o-t N(L-q)t - $l (f -ot) ol\"b ffi. t_ L LLI E ( u \' - q \' ) +w(L-n)q EtO : -B(f-oz)r\" Lt,h : Ur\'lr1 qk -Fiu: , t: \\lreO l*tL-o)q q ) *Cr -+ c,. b: (1 qnrl qtf-a?) bsu*l&*t - su r( L - q ) u * c , 1 o r u r t QC z ... Date Added: 2009-06-19 07:01:08 |
| ch06.ppt Path: UF >> CBA >> 7626 Fall, 2009 Description: Chapter 6 Multivariate Analysis of Variance Copyright 2007 PrenticeHall, Inc. Chapter 6: Multivariate Analysis of Variance LEARNING OBJECTIVES: Upon completing this chapter, you should be able to do the following: 1. Explain the difference be... Date Added: 2009-06-19 07:01:26 |
| ch11.ppt Path: UF >> CBA >> 7626 Fall, 2009 Description: Chapter 11 SEM: Confirmatory Factor Analysis Copyright 2007 PrenticeHall, Inc. Chapter 11: SEM Confirmatory Factor Analysis LEARNING OBJECTIVES: Upon completing this chapter, you should be able to do the following: Distinguish between expl... Date Added: 2009-06-19 07:01:27 |
| 14-OODesign-4.pdf Path: W. Alabama >> PLG >> 246 Fall, 2009 Description: Some Principles and Heuristics of OOP, OOD, and Modular Design Overview Information hiding, interfaces, and kinship The nature of inheritance, invariants, and subtyping Co[ntra]variance and the principle of substitutability Yoyo-ing, and reasons for ... Date Added: 2009-06-19 07:01:37 |
| PHYS476_676Week9a.pdf Path: Drexel >> PHYS >> 476676 Fall, 2009 Description: Announcements All notes are posted at http:/www.physics.drexel.edu/~jelena/Phys476676Lectures/Lecture s476676Post.html Sunday, November 16, 2008 1 Quarks, Gluons and the Strong Interaction The Quark Structure of Nucelons The quark model was co... Date Added: 2009-06-19 07:08:08 |
| slac-pub-12823.pdf Path: Stanford >> PUBS >> 12750 Fall, 2009 Description: CERN-PH-TH/2007-167 SLAC-PUB-12823 SI-HEP-2007-14 BARI-TH/07-582 arXiv:0711.3999v1[hep-ph] SCET sum rules for B P and B V transition form factors Fulvia De Fazioa, Thorsten Feldmannb, and Tobias Hurthc,d,1 a b c Istituto Nazionale di Fisica Nucle... Date Added: 2009-06-19 07:11:27 |
| slac-pub-12942.pdf Path: Stanford >> PUBS >> 12750 Fall, 2009 Description: SLAC-PUB-12942 arXiv:0710.2451[astro-ph] Reionization: Characteristic Scales, Topology and Observability Ilian T. Iliev Paul R. Shapiro Garrelt Mellema Ue-Li Pen Patrick McDonald Marcelo A. Alvarez Abstract Recently the numerical simulations o... Date Added: 2009-06-19 07:11:48 |
| dss_radec.txt Path: Berkeley >> ASTRO >> 00241963 Fall, 2009 Description: #ra dec rmag drmag 105.449939 -74.930634 16.793 0.005 106.324465 -74.915512 16.908 0.006 104.800212 -74.964514 16.800 0.005 105.302218 -74.949628 19.146 0.045 105.645248 -74.941933 19.906 0.091 105.038127 -74.958067 18.699 0.030 105.320694 -74.950675... Date Added: 2009-06-19 07:12:59 |
| arf_wt.txt Path: Berkeley >> ASTRO >> 00241963 Fall, 2009 Description: ;instrument XRT ;exposure 188.64369 ;xunit kev ;bintype counts 0.0000000 0.0049999999 14.589417 1.00000 0.0049999999 0.0099999998 14.641478 1.00000 0.0099999998 0.015000000 14.693538 1.0... Date Added: 2009-06-19 07:12:59 |
|
|
Get Started With Course Hero Today!
Get study guides, join study groups, and more!
Sign up in seconds with your Facebook account!
Course Hero is a Facebook Application Partner.
Click below to sign-up for FREE.
Our Social Learning Network was built to provide students and key learning partners like professors a platform to share, meet and collaborate while accelerating their comprehension of course-related theories and concepts. We are committed to providing you immediate access to a growing wealth of study materials and an unparalleled academic network of students, professors and other key partners. Why do you care? Because you want the best grade possible and at times need a 24/7 resource that’s responsive to your needs. |
|
What People Are Saying About Course Hero
|
|||
|
|||
|
Explore the benefits of joining Course Hero's social learning network.
|
|||
 |
Get millions of study materials now!Need lecture notes for a missed class or want insightful explanation of the theories and concepts you learn in class? Look no further, Course Hero’s Study Materials empowers you to find a broad and deep set of materials that can help you right now!
Click below to sign-up for FREE.
|
||
 |
Get over 200,000 textbook solutions now!Having difficulty with your homework and need documents that are relevant for your Textbook? Don't be frustrated. Course Hero's Textbook Help presents you study materials from many college courses.
Click below to sign-up for FREE.
|
||
 |
Meet over 300,000 students and your fellow classmates now!Want to meet your current classmates or those that took the class last year? Don’t worry or have anxiety. Course Hero’s Study Groups gives you the seamless opportunity to develop both anonymous or direct relationships with those classmates whom you want to meet and get help from right now!
Click below to sign-up for FREE.
|
||
