Course Solutions And Notes - kanzi 13
| book.pdf Path: Virginia Tech >> CS >> 3114 Fall, 2009 Description: A Practical Introduction to Data Structures and Algorithm Analysis Third Edition (Java) Clifford A. Shaffer Department of Computer Science Virginia Tech Blacksburg, VA 24061 April 16, 2009 Copyright c 2008 by Clifford A. Shaffer. This document is the... Date Added: 2009-06-24 08:31:08 |
| F06_Ch04bLectureNotesACCT208.pdf Path: Southern Illinois University, Carbondale >> ACCT >> 208 Fall, 2008 Description: Lecture Notes (Chapter 4 (set b): Introduction to Probability) Section 3: Conditional Probability The probability of an event given that another event has occurred is called a conditional probability. (e.g. what is the likelihood of having blue eyes... Date Added: 2009-06-24 08:36:28 |
| Prob0217.pdf Path: Oklahoma State >> MAE >> 4263 Fall, 2008 Description: MAE 4263 Vapor Power Systems Problem 2-17: Follow the notation of Figure 2-16, and the example on page 72, either on an Excel/VBA spreadsheet, or else using page 777: p1 = 7000 psia, T1 = 1400o F, h1 = 1638.6 BTU/lbm, s1 = 1.5355 BTU/lbm-o R; p2 = 16... Date Added: 2009-06-24 08:47:03 |
| PHY121_LabSchedule.pdf Path: SUNY Buffalo >> PHY >> 121 Fall, 2009 Description: Tuesday 2-5 PM Group A Lab 1A Berk, Ekrem Boddecker, Brian Cook, Sandra Dlugosz, Jonathan Dougherty, Stephen Fairclough, Amy Hack, Gregory Hatem, Daniel Kazer, Evan Kinner, Brandon Kinney, Lauren Ku, Yo Limina, Nick Tuesday 2-5 PM Group B Lab 1B Lov... Date Added: 2009-06-24 08:49:59 |
| 3b9b0ade.pdf Path: Wisconsin >> WILL >> 0014 Fall, 2009 Description: ... Date Added: 2009-06-24 08:50:01 |
| 3b9b0af4.pdf Path: Wisconsin >> WILL >> 0014 Fall, 2009 Description: ... Date Added: 2009-06-24 08:50:05 |
| 3b9b0c6b.pdf Path: Wisconsin >> WILL >> 0014 Fall, 2009 Description: ... Date Added: 2009-06-24 08:50:57 |
| 3b9b0c8a.pdf Path: Wisconsin >> WILL >> 0014 Fall, 2009 Description: ... Date Added: 2009-06-24 08:50:58 |
| 3b9b21f4.pdf Path: Wisconsin >> WILL >> 0031 Fall, 2009 Description: ... Date Added: 2009-06-24 08:52:00 |
| 3b9b04c5.pdf Path: Wisconsin >> WILL >> 0025 Fall, 2009 Description: ... Date Added: 2009-06-24 08:54:46 |
| 48775aa6.pdf Path: Wisconsin >> WILL >> 0101 Fall, 2009 Description: ... Date Added: 2009-06-24 08:57:17 |
| 487707da.pdf Path: Wisconsin >> WILL >> 0078 Fall, 2009 Description: ... Date Added: 2009-06-24 08:58:21 |
| 487709ca.pdf Path: Wisconsin >> WILL >> 0078 Fall, 2009 Description: ... Date Added: 2009-06-24 08:58:58 |
| 487709fb.pdf Path: Wisconsin >> WILL >> 0078 Fall, 2009 Description: ... Date Added: 2009-06-24 08:59:07 |
| 4877073f.pdf Path: Wisconsin >> WILL >> 0078 Fall, 2009 Description: ... Date Added: 2009-06-24 08:59:14 |
| 487733f0.pdf Path: Wisconsin >> WILL >> 0090 Fall, 2009 Description: ... Date Added: 2009-06-24 08:59:54 |
| 487733f7.pdf Path: Wisconsin >> WILL >> 0090 Fall, 2009 Description: ... Date Added: 2009-06-24 08:59:55 |
| 26f9.pdf Path: Wisconsin >> WILL >> 0062 Fall, 2009 Description: ... Date Added: 2009-06-24 09:02:22 |
| 27e9.pdf Path: Wisconsin >> WILL >> 0062 Fall, 2009 Description: ... Date Added: 2009-06-24 09:02:40 |
| 27ee.pdf Path: Wisconsin >> WILL >> 0062 Fall, 2009 Description: ... Date Added: 2009-06-24 09:02:41 |
| 28d8.pdf Path: Wisconsin >> WILL >> 0062 Fall, 2009 Description: ... Date Added: 2009-06-24 09:02:54 |
| 29a7.pdf Path: Wisconsin >> WILL >> 0062 Fall, 2009 Description: ... Date Added: 2009-06-24 09:03:04 |
| 487723c2.pdf Path: Wisconsin >> WILL >> 0086 Fall, 2009 Description: ... Date Added: 2009-06-24 09:03:33 |
| 487724b1.pdf Path: Wisconsin >> WILL >> 0086 Fall, 2009 Description: ... Date Added: 2009-06-24 09:03:50 |
| 487725b7.pdf Path: Wisconsin >> WILL >> 0086 Fall, 2009 Description: ... Date Added: 2009-06-24 09:04:15 |
| 48778a6d.pdf Path: Wisconsin >> WILL >> 0115 Fall, 2009 Description: ... Date Added: 2009-06-24 09:05:27 |
| 48778a9f.pdf Path: Wisconsin >> WILL >> 0115 Fall, 2009 Description: ... Date Added: 2009-06-24 09:05:30 |
| 48778a34.pdf Path: Wisconsin >> WILL >> 0115 Fall, 2009 Description: ... Date Added: 2009-06-24 09:05:36 |
| 48778a84.pdf Path: Wisconsin >> WILL >> 0115 Fall, 2009 Description: ... Date Added: 2009-06-24 09:05:45 |
| 48778a90.pdf Path: Wisconsin >> WILL >> 0115 Fall, 2009 Description: ... Date Added: 2009-06-24 09:05:46 |
| 3b9accfa.pdf Path: Wisconsin >> WILL >> 0002 Fall, 2009 Description: ... Date Added: 2009-06-24 09:07:02 |
| 3b9acd72.pdf Path: Wisconsin >> WILL >> 0002 Fall, 2009 Description: ... Date Added: 2009-06-24 09:07:28 |
| 3b9b3dba.pdf Path: Wisconsin >> WILL >> 0039 Fall, 2009 Description: ... Date Added: 2009-06-24 09:08:31 |
| 3b9b3f34.pdf Path: Wisconsin >> WILL >> 0039 Fall, 2009 Description: ... Date Added: 2009-06-24 09:09:50 |
| 3b9b3f66.pdf Path: Wisconsin >> WILL >> 0039 Fall, 2009 Description: ... Date Added: 2009-06-24 09:09:56 |
| 48774f60.pdf Path: Wisconsin >> WILL >> 0098 Fall, 2009 Description: ... Date Added: 2009-06-24 09:13:19 |
| 3b9b44cf.pdf Path: Wisconsin >> WILL >> 0041 Fall, 2009 Description: ... Date Added: 2009-06-24 09:13:27 |
| 3b9b46ef.pdf Path: Wisconsin >> WILL >> 0041 Fall, 2009 Description: ... Date Added: 2009-06-24 09:14:07 |
| 3b9b47a0.pdf Path: Wisconsin >> WILL >> 0041 Fall, 2009 Description: ... Date Added: 2009-06-24 09:14:11 |
| 3b9b1c74.pdf Path: Wisconsin >> WILL >> 0015 Fall, 2009 Description: ... Date Added: 2009-06-24 09:15:01 |
| 3b9b34ef.pdf Path: Wisconsin >> WILL >> 0036 Fall, 2009 Description: ... Date Added: 2009-06-24 09:16:52 |
| 3b9b63cc.pdf Path: Wisconsin >> WILL >> 0049 Fall, 2009 Description: ... Date Added: 2009-06-24 09:18:33 |
| 3b9b64b9.pdf Path: Wisconsin >> WILL >> 0049 Fall, 2009 Description: ... Date Added: 2009-06-24 09:18:44 |
| 3b9b622f.pdf Path: Wisconsin >> WILL >> 0049 Fall, 2009 Description: ... Date Added: 2009-06-24 09:19:03 |
| 3b9af6ee.pdf Path: Wisconsin >> WILL >> 0009 Fall, 2009 Description: ... Date Added: 2009-06-24 09:19:25 |
| 3b9afda3.pdf Path: Wisconsin >> WILL >> 0024 Fall, 2009 Description: ... Date Added: 2009-06-24 09:21:55 |
| 4876ebe7.pdf Path: Wisconsin >> WILL >> 0071 Fall, 2009 Description: ... Date Added: 2009-06-24 09:22:28 |
| 4876ec78.pdf Path: Wisconsin >> WILL >> 0071 Fall, 2009 Description: ... Date Added: 2009-06-24 09:22:58 |
| 3b9acb12.pdf Path: Wisconsin >> WILL >> 0001 Fall, 2009 Description: ... Date Added: 2009-06-24 09:24:29 |
| 48770c4e.pdf Path: Wisconsin >> WILL >> 0079 Fall, 2009 Description: ... Date Added: 2009-06-24 09:26:28 |
| 4877368f.pdf Path: Wisconsin >> WILL >> 0091 Fall, 2009 Description: ... Date Added: 2009-06-24 09:27:47 |
| 4877378d.pdf Path: Wisconsin >> WILL >> 0091 Fall, 2009 Description: ... Date Added: 2009-06-24 09:27:57 |
| 32dd.pdf Path: Wisconsin >> WILL >> 0065 Fall, 2009 Description: ... Date Added: 2009-06-24 09:28:52 |
| 32f9.pdf Path: Wisconsin >> WILL >> 0065 Fall, 2009 Description: ... Date Added: 2009-06-24 09:28:57 |
| 317d.pdf Path: Wisconsin >> WILL >> 0065 Fall, 2009 Description: ... Date Added: 2009-06-24 09:29:14 |
| 487721cd.pdf Path: Wisconsin >> WILL >> 0085 Fall, 2009 Description: ... Date Added: 2009-06-24 09:30:02 |
| 4877210f.pdf Path: Wisconsin >> WILL >> 0085 Fall, 2009 Description: ... Date Added: 2009-06-24 09:30:36 |
| 487784b2.pdf Path: Wisconsin >> WILL >> 0114 Fall, 2009 Description: ... Date Added: 2009-06-24 09:31:13 |
| 487785e2.pdf Path: Wisconsin >> WILL >> 0114 Fall, 2009 Description: ... Date Added: 2009-06-24 09:31:40 |
| 48778463.pdf Path: Wisconsin >> WILL >> 0114 Fall, 2009 Description: ... Date Added: 2009-06-24 09:32:43 |
| 3b9b42f5.pdf Path: Wisconsin >> WILL >> 0040 Fall, 2009 Description: ... Date Added: 2009-06-24 09:33:25 |
| 48776cef.pdf Path: Wisconsin >> WILL >> 0107 Fall, 2009 Description: ... Date Added: 2009-06-24 09:35:53 |
| 48776d12.pdf Path: Wisconsin >> WILL >> 0107 Fall, 2009 Description: ... Date Added: 2009-06-24 09:36:10 |
| 487753cf.pdf Path: Wisconsin >> WILL >> 0099 Fall, 2009 Description: ... Date Added: 2009-06-24 09:37:11 |
| 3b9b38ab.pdf Path: Wisconsin >> WILL >> 0037 Fall, 2009 Description: ... Date Added: 2009-06-24 09:39:23 |
| 3b9b371a.pdf Path: Wisconsin >> WILL >> 0037 Fall, 2009 Description: ... Date Added: 2009-06-24 09:39:54 |
| 3b9b387b.pdf Path: Wisconsin >> WILL >> 0037 Fall, 2009 Description: ... Date Added: 2009-06-24 09:40:10 |
| 11d0.pdf Path: Wisconsin >> WILL >> 0056 Fall, 2009 Description: ... Date Added: 2009-06-24 09:40:25 |
| 12d9.pdf Path: Wisconsin >> WILL >> 0056 Fall, 2009 Description: ... Date Added: 2009-06-24 09:40:45 |
| 12e1.pdf Path: Wisconsin >> WILL >> 0056 Fall, 2009 Description: ... Date Added: 2009-06-24 09:40:47 |
| 111a.pdf Path: Wisconsin >> WILL >> 0056 Fall, 2009 Description: ... Date Added: 2009-06-24 09:41:26 |
| 113f.pdf Path: Wisconsin >> WILL >> 0056 Fall, 2009 Description: ... Date Added: 2009-06-24 09:41:29 |
| 3b9af4e0.pdf Path: Wisconsin >> WILL >> 0008 Fall, 2009 Description: ... Date Added: 2009-06-24 09:42:10 |
| 3b9b0fab.pdf Path: Wisconsin >> WILL >> 0027 Fall, 2009 Description: ... Date Added: 2009-06-24 09:42:58 |
| 3b9b11d5.pdf Path: Wisconsin >> WILL >> 0027 Fall, 2009 Description: ... Date Added: 2009-06-24 09:43:31 |
| 3b9b12cb.pdf Path: Wisconsin >> WILL >> 0027 Fall, 2009 Description: ... Date Added: 2009-06-24 09:43:47 |
| 3b9b122f.pdf Path: Wisconsin >> WILL >> 0027 Fall, 2009 Description: ... Date Added: 2009-06-24 09:44:13 |
| 48771d2a.pdf Path: Wisconsin >> WILL >> 0084 Fall, 2009 Description: ... Date Added: 2009-06-24 09:44:31 |
| 48771e84.pdf Path: Wisconsin >> WILL >> 0084 Fall, 2009 Description: ... Date Added: 2009-06-24 09:45:45 |
| 48771eac.pdf Path: Wisconsin >> WILL >> 0084 Fall, 2009 Description: ... Date Added: 2009-06-24 09:45:50 |
| 48778f44.pdf Path: Wisconsin >> WILL >> 0117 Fall, 2009 Description: ... Date Added: 2009-06-24 09:46:14 |
| 3b9b5d56.pdf Path: Wisconsin >> WILL >> 0048 Fall, 2009 Description: ... Date Added: 2009-06-24 09:46:50 |
| 3b9b5e99.pdf Path: Wisconsin >> WILL >> 0048 Fall, 2009 Description: ... Date Added: 2009-06-24 09:47:32 |
| 2ea4.pdf Path: Wisconsin >> WILL >> 0064 Fall, 2009 Description: ... Date Added: 2009-06-24 09:49:26 |
| 2eec.pdf Path: Wisconsin >> WILL >> 0064 Fall, 2009 Description: ... Date Added: 2009-06-24 09:49:38 |
| 3b9b5a01.pdf Path: Wisconsin >> WILL >> 0047 Fall, 2009 Description: ... Date Added: 2009-06-24 09:51:28 |
| 3b9b5ad3.pdf Path: Wisconsin >> WILL >> 0047 Fall, 2009 Description: ... Date Added: 2009-06-24 09:51:56 |
| 48779a28.pdf Path: Wisconsin >> WILL >> 0120 Fall, 2009 Description: ... Date Added: 2009-06-24 09:53:11 |
| 48779b49.pdf Path: Wisconsin >> WILL >> 0120 Fall, 2009 Description: ... Date Added: 2009-06-24 09:54:03 |
| 48779b85.pdf Path: Wisconsin >> WILL >> 0120 Fall, 2009 Description: ... Date Added: 2009-06-24 09:54:10 |
| 487703f8.pdf Path: Wisconsin >> WILL >> 0077 Fall, 2009 Description: ... Date Added: 2009-06-24 09:54:59 |
| 4877031d.pdf Path: Wisconsin >> WILL >> 0077 Fall, 2009 Description: ... Date Added: 2009-06-24 09:55:39 |
| 3b9aed9d.pdf Path: Wisconsin >> WILL >> 0007 Fall, 2009 Description: ... Date Added: 2009-06-24 09:57:07 |
| 3b9af1cf.pdf Path: Wisconsin >> WILL >> 0007 Fall, 2009 Description: ... Date Added: 2009-06-24 09:58:02 |
| 3b9af176.pdf Path: Wisconsin >> WILL >> 0007 Fall, 2009 Description: ... Date Added: 2009-06-24 09:58:15 |
| 3b9b0d9a.pdf Path: Wisconsin >> WILL >> 0026 Fall, 2009 Description: ... Date Added: 2009-06-24 09:58:31 |
| THE207.pdf Path: Maine >> PDFS >> 207 Fall, 2009 Description: 1. 2. 3. 4. 5. 6. 7. 8. 9. 10. 11. 12. UNIVERSITY OF SOUTHERN MAINE STUDENT INPUT FOR TEACHING FACULTY EVALUATIONS - THEATRE DEPARTMENT 484 STUDENTS RESPONDED ENTIRE DEPT QUESTION MEDIAN MEAN STD. NO DEV. RESPONSE HOW PREPARED WAS THE INSTRUCTOR FOR... Date Added: 2009-06-24 09:58:54 |
| 3b9b0e56.pdf Path: Wisconsin >> WILL >> 0026 Fall, 2009 Description: ... Date Added: 2009-06-24 09:59:13 |
| 14e6.pdf Path: Wisconsin >> WILL >> 0057 Fall, 2009 Description: ... Date Added: 2009-06-24 09:59:59 |
| 16bd.pdf Path: Wisconsin >> WILL >> 0057 Fall, 2009 Description: ... Date Added: 2009-06-24 10:00:28 |
| 17cc.pdf Path: Wisconsin >> WILL >> 0057 Fall, 2009 Description: ... Date Added: 2009-06-24 10:00:50 |
| 162d.pdf Path: Wisconsin >> WILL >> 0057 Fall, 2009 Description: ... Date Added: 2009-06-24 10:01:14 |
| 168a.pdf Path: Wisconsin >> WILL >> 0057 Fall, 2009 Description: ... Date Added: 2009-06-24 10:01:20 |
| 48777c54.pdf Path: Wisconsin >> WILL >> 0111 Fall, 2009 Description: ... Date Added: 2009-06-24 10:02:47 |
| 36e1.pdf Path: Wisconsin >> WILL >> 0067 Fall, 2009 Description: ... Date Added: 2009-06-24 10:03:16 |
| 38bb.pdf Path: Wisconsin >> WILL >> 0067 Fall, 2009 Description: ... Date Added: 2009-06-24 10:03:51 |
| 48771b8e.pdf Path: Wisconsin >> WILL >> 0083 Fall, 2009 Description: ... Date Added: 2009-06-24 10:05:48 |
| 3b9ade2d.pdf Path: Wisconsin >> WILL >> 0017 Fall, 2009 Description: ... Date Added: 2009-06-24 10:06:34 |
| 3b9b2c0a.pdf Path: Wisconsin >> WILL >> 0034 Fall, 2009 Description: ... Date Added: 2009-06-24 10:08:15 |
| 48773e69.pdf Path: Wisconsin >> WILL >> 0093 Fall, 2009 Description: ... Date Added: 2009-06-24 10:10:43 |
| 487766ef.pdf Path: Wisconsin >> WILL >> 0105 Fall, 2009 Description: ... Date Added: 2009-06-24 10:11:49 |
| 3b9b56e8.pdf Path: Wisconsin >> WILL >> 0046 Fall, 2009 Description: ... Date Added: 2009-06-24 10:14:01 |
| 3b9b5717.pdf Path: Wisconsin >> WILL >> 0046 Fall, 2009 Description: ... Date Added: 2009-06-24 10:15:19 |
| 3b9b67c5.pdf Path: Wisconsin >> WILL >> 0050 Fall, 2009 Description: ... Date Added: 2009-06-24 10:16:06 |
| 3b9b67cc.pdf Path: Wisconsin >> WILL >> 0050 Fall, 2009 Description: ... Date Added: 2009-06-24 10:16:07 |
| 3b9b671d.pdf Path: Wisconsin >> WILL >> 0050 Fall, 2009 Description: ... Date Added: 2009-06-24 10:17:02 |
| 4877a099.pdf Path: Wisconsin >> WILL >> 0121 Fall, 2009 Description: ... Date Added: 2009-06-24 10:17:49 |
| 48779d57.pdf Path: Wisconsin >> WILL >> 0121 Fall, 2009 Description: ... Date Added: 2009-06-24 10:17:57 |
| solvmrgs.pdf Path: MO St. Louis >> DOCS >> 252 Fall, 2009 Description: IV Joe\'s and Sally\'s speed at the merge of highways 40 and 270 Joe / / Sally courteous aggressive weaving duels and cutting off Joe\'s best speed 40 / / 40 50 / / 20 courteous aggressive weaving 20 / / 50 30 / / 30 25 / / 5 50 30 duels and cutting off... Date Added: 2009-06-24 10:18:26 |
| 4876f7c2.pdf Path: Wisconsin >> WILL >> 0074 Fall, 2009 Description: ... Date Added: 2009-06-24 10:18:56 |
| 4876f8c4.pdf Path: Wisconsin >> WILL >> 0074 Fall, 2009 Description: ... Date Added: 2009-06-24 10:19:16 |
| 4876f9bc.pdf Path: Wisconsin >> WILL >> 0074 Fall, 2009 Description: ... Date Added: 2009-06-24 10:19:32 |
| 4876f9ce.pdf Path: Wisconsin >> WILL >> 0074 Fall, 2009 Description: ... Date Added: 2009-06-24 10:19:36 |
| 4876f9fa.pdf Path: Wisconsin >> WILL >> 0074 Fall, 2009 Description: ... Date Added: 2009-06-24 10:19:44 |
| 4876f78e.pdf Path: Wisconsin >> WILL >> 0074 Fall, 2009 Description: ... Date Added: 2009-06-24 10:19:54 |
| 1abb.pdf Path: Wisconsin >> WILL >> 0058 Fall, 2009 Description: ... Date Added: 2009-06-24 10:21:00 |
| 1ad1.pdf Path: Wisconsin >> WILL >> 0058 Fall, 2009 Description: ... Date Added: 2009-06-24 10:21:04 |
| 1be2.pdf Path: Wisconsin >> WILL >> 0058 Fall, 2009 Description: ... Date Added: 2009-06-24 10:21:57 |
| 3b9ae9e0.pdf Path: Wisconsin >> WILL >> 0006 Fall, 2009 Description: ... Date Added: 2009-06-24 10:22:26 |
| 3b9aed46.pdf Path: Wisconsin >> WILL >> 0021 Fall, 2009 Description: ... Date Added: 2009-06-24 10:23:46 |
| 3b9aee66.pdf Path: Wisconsin >> WILL >> 0021 Fall, 2009 Description: ... Date Added: 2009-06-24 10:24:22 |
| 3b9aeeb5.pdf Path: Wisconsin >> WILL >> 0021 Fall, 2009 Description: ... Date Added: 2009-06-24 10:24:28 |
| 36b4.pdf Path: Wisconsin >> WILL >> 0066 Fall, 2009 Description: ... Date Added: 2009-06-24 10:26:02 |
| 339b.pdf Path: Wisconsin >> WILL >> 0066 Fall, 2009 Description: ... Date Added: 2009-06-24 10:26:15 |
| 351c.pdf Path: Wisconsin >> WILL >> 0066 Fall, 2009 Description: ... Date Added: 2009-06-24 10:26:28 |
| 3b9afc4b.pdf Path: Wisconsin >> WILL >> 0010 Fall, 2009 Description: ... Date Added: 2009-06-24 10:30:10 |
| 3b9afd25.pdf Path: Wisconsin >> WILL >> 0010 Fall, 2009 Description: ... Date Added: 2009-06-24 10:30:45 |
| 3b9afd79.pdf Path: Wisconsin >> WILL >> 0010 Fall, 2009 Description: ... Date Added: 2009-06-24 10:30:52 |
| 3b9afdae.pdf Path: Wisconsin >> WILL >> 0010 Fall, 2009 Description: ... Date Added: 2009-06-24 10:30:56 |
| 48775bca.pdf Path: Wisconsin >> WILL >> 0102 Fall, 2009 Description: ... Date Added: 2009-06-24 10:37:09 |
| 3b9ae4f0.pdf Path: Wisconsin >> WILL >> 0019 Fall, 2009 Description: ... Date Added: 2009-06-24 10:37:34 |
| 3db3.pdf Path: Wisconsin >> WILL >> 0069 Fall, 2009 Description: ... Date Added: 2009-06-24 10:39:09 |
| 3b9b6aaf.pdf Path: Wisconsin >> WILL >> 0051 Fall, 2009 Description: ... Date Added: 2009-06-24 10:41:20 |
| 245c.pdf Path: Wisconsin >> WILL >> 0061 Fall, 2009 Description: ... Date Added: 2009-06-24 10:43:44 |
| 257d.pdf Path: Wisconsin >> WILL >> 0061 Fall, 2009 Description: ... Date Added: 2009-06-24 10:43:58 |
| 1c4c.pdf Path: Wisconsin >> WILL >> 0059 Fall, 2009 Description: ... Date Added: 2009-06-24 10:44:25 |
| my_uniq_c.pdf Path: UMiami >> MATH >> 220 Fall, 2009 Description: Burt Rosenberg Math 220/317: Programming II/Data Structures 1 my uniq.c /* * * my_uniq - template and starter code for * * Homework 3 - the Unique Words Program. * * * * Author: Burt Rosenberg * * Course: MTH 220/317 * * Date: Sept 6, 1995 * * Usa... Date Added: 2009-06-24 10:44:40 |
| tcpa.pdf Path: UMiami >> CSC >> 598 Fall, 2008 Description: Cryptography and Competition Policy Issues with `Trusted Computing\' Ross Anderson Cambridge University Abstract. The most significant strategic development in information technology over the past year has been `trusted computing\'. This is popularly... Date Added: 2009-06-24 10:45:18 |
| 1db2.pdf Path: Wisconsin >> WILL >> 0059 Fall, 2009 Description: ... Date Added: 2009-06-24 10:45:49 |
| 3b9ada63.pdf Path: Wisconsin >> WILL >> 0005 Fall, 2009 Description: ... Date Added: 2009-06-24 10:46:32 |
| 3b9adaa1.pdf Path: Wisconsin >> WILL >> 0005 Fall, 2009 Description: ... Date Added: 2009-06-24 10:46:36 |
| 3b9adb93.pdf Path: Wisconsin >> WILL >> 0005 Fall, 2009 Description: ... Date Added: 2009-06-24 10:46:53 |
| 3b9ae88b.pdf Path: Wisconsin >> WILL >> 0020 Fall, 2009 Description: ... Date Added: 2009-06-24 10:48:18 |
| 3b9ae952.pdf Path: Wisconsin >> WILL >> 0020 Fall, 2009 Description: ... Date Added: 2009-06-24 10:48:52 |
| 3b9b54e6.pdf Path: Wisconsin >> WILL >> 0045 Fall, 2009 Description: ... Date Added: 2009-06-24 10:51:30 |
| 487746a0.pdf Path: Wisconsin >> WILL >> 0095 Fall, 2009 Description: ... Date Added: 2009-06-24 10:53:35 |
| 3b9afdeb.pdf Path: Wisconsin >> WILL >> 0011 Fall, 2009 Description: ... Date Added: 2009-06-24 10:54:38 |
| 3b9b0053.pdf Path: Wisconsin >> WILL >> 0011 Fall, 2009 Description: ... Date Added: 2009-06-24 10:55:53 |
| 48772f12.pdf Path: Wisconsin >> WILL >> 0089 Fall, 2009 Description: ... Date Added: 2009-06-24 11:00:20 |
| 48772f78.pdf Path: Wisconsin >> WILL >> 0089 Fall, 2009 Description: ... Date Added: 2009-06-24 11:00:34 |
| 487731cf.pdf Path: Wisconsin >> WILL >> 0089 Fall, 2009 Description: ... Date Added: 2009-06-24 11:01:23 |
| 4876f003.pdf Path: Wisconsin >> WILL >> 0072 Fall, 2009 Description: ... Date Added: 2009-06-24 11:02:29 |
| 48775ea1.pdf Path: Wisconsin >> WILL >> 0103 Fall, 2009 Description: ... Date Added: 2009-06-24 11:03:19 |
| 2fe.pdf Path: Wisconsin >> WILL >> 0052 Fall, 2009 Description: ... Date Added: 2009-06-24 11:06:32 |
| 1f87.pdf Path: Wisconsin >> WILL >> 0060 Fall, 2009 Description: ... Date Added: 2009-06-24 11:07:44 |
| 20ff.pdf Path: Wisconsin >> WILL >> 0060 Fall, 2009 Description: ... Date Added: 2009-06-24 11:08:31 |
| 21ee.pdf Path: Wisconsin >> WILL >> 0060 Fall, 2009 Description: ... Date Added: 2009-06-24 11:08:51 |
| HW03.pdf Path: St. Cloud >> CSCI >> 301 Fall, 2008 Description: CSCI 301: Introduction to Algorithms and Data Structures (Fall 2008) Instructor: Pranava K. Jha HW 3 (Due Friday, Nov. 21) Prob. 1. [10 points] Arrange the nodes that contain the letters A, C, E, F, L, V and Z into two binary search trees: one that h... Date Added: 2009-06-24 11:09:02 |
| 487781c9.pdf Path: Wisconsin >> WILL >> 0113 Fall, 2009 Description: ... Date Added: 2009-06-24 11:09:37 |
| 4877829c.pdf Path: Wisconsin >> WILL >> 0113 Fall, 2009 Description: ... Date Added: 2009-06-24 11:11:06 |
| 4877837f.pdf Path: Wisconsin >> WILL >> 0113 Fall, 2009 Description: ... Date Added: 2009-06-24 11:11:20 |
| 3b9b2b1e.pdf Path: Wisconsin >> WILL >> 0033 Fall, 2009 Description: ... Date Added: 2009-06-24 11:12:40 |
| 3b9b2b5a.pdf Path: Wisconsin >> WILL >> 0033 Fall, 2009 Description: ... Date Added: 2009-06-24 11:12:44 |
| 3b9b28d1.pdf Path: Wisconsin >> WILL >> 0033 Fall, 2009 Description: ... Date Added: 2009-06-24 11:13:26 |
| 3b9b50ab.pdf Path: Wisconsin >> WILL >> 0044 Fall, 2009 Description: ... Date Added: 2009-06-24 11:14:22 |
| 3b9b505d.pdf Path: Wisconsin >> WILL >> 0044 Fall, 2009 Description: ... Date Added: 2009-06-24 11:14:58 |
| 3b9b508e.pdf Path: Wisconsin >> WILL >> 0044 Fall, 2009 Description: ... Date Added: 2009-06-24 11:15:02 |
| 3b9b01cf.pdf Path: Wisconsin >> WILL >> 0012 Fall, 2009 Description: ... Date Added: 2009-06-24 11:15:18 |
| 3b9b0153.pdf Path: Wisconsin >> WILL >> 0012 Fall, 2009 Description: ... Date Added: 2009-06-24 11:15:25 |
| 3b9b0354.pdf Path: Wisconsin >> WILL >> 0012 Fall, 2009 Description: ... Date Added: 2009-06-24 11:16:15 |
| 3b9ad7b0.pdf Path: Wisconsin >> WILL >> 0004 Fall, 2009 Description: ... Date Added: 2009-06-24 11:18:46 |
| 3b9af8a1.pdf Path: Wisconsin >> WILL >> 0023 Fall, 2009 Description: ... Date Added: 2009-06-24 11:20:17 |
| 3b9af682.pdf Path: Wisconsin >> WILL >> 0023 Fall, 2009 Description: ... Date Added: 2009-06-24 11:21:10 |
| 48774a88.pdf Path: Wisconsin >> WILL >> 0096 Fall, 2009 Description: ... Date Added: 2009-06-24 11:22:00 |
| 48774b08.pdf Path: Wisconsin >> WILL >> 0096 Fall, 2009 Description: ... Date Added: 2009-06-24 11:22:23 |
| 487748f5.pdf Path: Wisconsin >> WILL >> 0096 Fall, 2009 Description: ... Date Added: 2009-06-24 11:22:39 |
| 487749c9.pdf Path: Wisconsin >> WILL >> 0096 Fall, 2009 Description: ... Date Added: 2009-06-24 11:22:49 |
| 48770f59.pdf Path: Wisconsin >> WILL >> 0080 Fall, 2009 Description: ... Date Added: 2009-06-24 11:23:56 |
| 48770fd0.pdf Path: Wisconsin >> WILL >> 0080 Fall, 2009 Description: ... Date Added: 2009-06-24 11:24:12 |
| 48770fda.pdf Path: Wisconsin >> WILL >> 0080 Fall, 2009 Description: ... Date Added: 2009-06-24 11:24:15 |
| 5e2.pdf Path: Wisconsin >> WILL >> 0053 Fall, 2009 Description: ... Date Added: 2009-06-24 11:25:07 |
| 6a7.pdf Path: Wisconsin >> WILL >> 0053 Fall, 2009 Description: ... Date Added: 2009-06-24 11:25:13 |
| 48772af0.pdf Path: Wisconsin >> WILL >> 0088 Fall, 2009 Description: ... Date Added: 2009-06-24 11:26:34 |
| 48772b64.pdf Path: Wisconsin >> WILL >> 0088 Fall, 2009 Description: ... Date Added: 2009-06-24 11:27:02 |
| 48772b98.pdf Path: Wisconsin >> WILL >> 0088 Fall, 2009 Description: ... Date Added: 2009-06-24 11:27:10 |
| 4876f4b7.pdf Path: Wisconsin >> WILL >> 0073 Fall, 2009 Description: ... Date Added: 2009-06-24 11:28:33 |
| 4876f6a0.pdf Path: Wisconsin >> WILL >> 0073 Fall, 2009 Description: ... Date Added: 2009-06-24 11:29:13 |
| 4876f37f.pdf Path: Wisconsin >> WILL >> 0073 Fall, 2009 Description: ... Date Added: 2009-06-24 11:29:34 |
| 4876f41f.pdf Path: Wisconsin >> WILL >> 0073 Fall, 2009 Description: ... Date Added: 2009-06-24 11:29:38 |
| PrelimSched.pdf Path: Midwestern State University >> SOC >> 591 Fall, 2009 Description: ID# PRELIMINARY EXAMINATION SCHEDULING FORM Candidate Dept./Program This form must be returned to the Graduate School at least 10 working days prior to the examination date. The student must be enrolled for the required number of hours the semester... Date Added: 2009-06-24 11:30:20 |
| 3b9b4cb2.pdf Path: Wisconsin >> WILL >> 0043 Fall, 2009 Description: ... Date Added: 2009-06-24 11:31:10 |
| 3b9b4cec.pdf Path: Wisconsin >> WILL >> 0043 Fall, 2009 Description: ... Date Added: 2009-06-24 11:31:20 |
| 2ab5.pdf Path: Wisconsin >> WILL >> 0063 Fall, 2009 Description: ... Date Added: 2009-06-24 11:31:54 |
| 487755c4.pdf Path: Wisconsin >> WILL >> 0100 Fall, 2009 Description: ... Date Added: 2009-06-24 11:33:17 |
| 487756ad.pdf Path: Wisconsin >> WILL >> 0100 Fall, 2009 Description: ... Date Added: 2009-06-24 11:33:30 |
| 3b9b1d92.pdf Path: Wisconsin >> WILL >> 0030 Fall, 2009 Description: ... Date Added: 2009-06-24 11:34:12 |
| 3b9b1fce.pdf Path: Wisconsin >> WILL >> 0030 Fall, 2009 Description: ... Date Added: 2009-06-24 11:35:18 |
| 48774b86.pdf Path: Wisconsin >> WILL >> 0097 Fall, 2009 Description: ... Date Added: 2009-06-24 11:35:50 |
| 48776f9e.pdf Path: Wisconsin >> WILL >> 0108 Fall, 2009 Description: ... Date Added: 2009-06-24 11:37:13 |
| 3b9b0ac3.pdf Path: Wisconsin >> WILL >> 0013 Fall, 2009 Description: ... Date Added: 2009-06-24 11:38:29 |
| 3b9b07fd.pdf Path: Wisconsin >> WILL >> 0013 Fall, 2009 Description: ... Date Added: 2009-06-24 11:38:54 |
| 3b9b084f.pdf Path: Wisconsin >> WILL >> 0013 Fall, 2009 Description: ... Date Added: 2009-06-24 11:39:17 |
| 3b9b3bda.pdf Path: Wisconsin >> WILL >> 0038 Fall, 2009 Description: ... Date Added: 2009-06-24 11:40:34 |
| 3b9b3c05.pdf Path: Wisconsin >> WILL >> 0038 Fall, 2009 Description: ... Date Added: 2009-06-24 11:40:45 |
| 3b9b3c34.pdf Path: Wisconsin >> WILL >> 0038 Fall, 2009 Description: ... Date Added: 2009-06-24 11:41:00 |
| 3b9b3c39.pdf Path: Wisconsin >> WILL >> 0038 Fall, 2009 Description: ... Date Added: 2009-06-24 11:41:01 |
| 48772a9e.pdf Path: Wisconsin >> WILL >> 0087 Fall, 2009 Description: ... Date Added: 2009-06-24 11:41:24 |
| 48772a31.pdf Path: Wisconsin >> WILL >> 0087 Fall, 2009 Description: ... Date Added: 2009-06-24 11:41:28 |
| 487728a0.pdf Path: Wisconsin >> WILL >> 0087 Fall, 2009 Description: ... Date Added: 2009-06-24 11:42:21 |
| 48777e28.pdf Path: Wisconsin >> WILL >> 0112 Fall, 2009 Description: ... Date Added: 2009-06-24 11:43:19 |
| 3b9ad1bd.pdf Path: Wisconsin >> WILL >> 0003 Fall, 2009 Description: ... Date Added: 2009-06-24 11:44:54 |
| 3b9ad4ec.pdf Path: Wisconsin >> WILL >> 0003 Fall, 2009 Description: ... Date Added: 2009-06-24 11:45:40 |
| 3b9ad5b8.pdf Path: Wisconsin >> WILL >> 0003 Fall, 2009 Description: ... Date Added: 2009-06-24 11:45:46 |
| T0431.t2k.stride-ebghtl-logo.pdf Path: UCSC >> T >> 0431 Fall, 2009 Description: T0431.t2k stride-ebghtl 3 2 1 1 10 20 30 40 E 3 2 1 T T T TH T H T E 51 60 70 80 90 T 3 2 1 E H T H T E T 101 110 120 130 140 H 3 2 1 H T 151 160 170 180 190 E 3 2 1 H T H 201 210 220 230 240 H 3 2 1 ... Date Added: 2009-06-24 11:46:03 |
| 3b9ad133.pdf Path: Wisconsin >> WILL >> 0003 Fall, 2009 Description: ... Date Added: 2009-06-24 11:46:24 |
| 9a8.pdf Path: Wisconsin >> WILL >> 0054 Fall, 2009 Description: ... Date Added: 2009-06-24 11:48:03 |
| a3a.pdf Path: Wisconsin >> WILL >> 0054 Fall, 2009 Description: ... Date Added: 2009-06-24 11:48:46 |
| a63.pdf Path: Wisconsin >> WILL >> 0054 Fall, 2009 Description: ... Date Added: 2009-06-24 11:48:59 |
| equation_sheet.pdf Path: Cincinnati >> CHE >> 364 Spring, 2008 Description: ... Date Added: 2009-06-24 11:57:59 |
| YMR131C.t2k.alpha-logo.pdf Path: UCSC >> YMR >> 131 Fall, 2009 Description: YMR131C.t2k ALPHA 3 2 1 B E XXXX E 10 20 30 40 B E B E H B H 3 2 1 H X H H H H H H H H X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X H H H H H H H H H H H H H H H H H H H H H H H H H X X X X H H H H H H H H H X X X X... Date Added: 2009-06-24 11:59:17 |
| ch13.pdf Path: Oregon State >> PH >> 332 Fall, 2008 Description: ... Date Added: 2009-06-24 12:07:13 |
| Floyd.txt Path: Eastern Washington University >> CSCD >> 327 Fall, 2009 Description: / Floyd algorithm for all-pairs shortest paths / Robert Floyd, Communications of the ACM, 5(6) (1962), p. 345. / Translated to Java, with changes in variable names, by Tim Rolfe public void allShortestPaths() { int row, col, k; / Set distances to... Date Added: 2009-06-24 12:17:31 |
| first06.pdf Path: Texas A&M >> MATH >> 611 Fall, 2008 Description: Math611-600: Ordinary and Partial Differential Equations, Fall 2006 Professor Emil J. Straube MWF 10:20 - 11:10, BLOC 112 Office, Office Hours: Milner 215, phone 845 3721, straube@math.tamu.edu, hours are MWF 1:00-2:00, but feel free to check any tim... Date Added: 2009-06-24 12:19:59 |
| 7440_phonons.pdf Path: Colorado >> PHYS >> 7440 Fall, 2008 Description: ... Date Added: 2009-06-24 12:23:05 |
| continuity.pdf Path: ASU >> STAT >> 371 Fall, 2009 Description: CONTINUITY JOHN QUIGG Proposition. Let A R, f, g : A R, and t A. Suppose both f and g are continuous at t. Then so are: 1. f + g, 2. f g, and f 3. , if for all x A we have g(x) = 0. g Proof. 1. Let > 0. We can choose > 0 such that for all x A,... Date Added: 2009-06-24 12:23:28 |
| Chap1_Example.doc Path: Tennessee >> STAT >> 201 Fall, 2009 Description: Stat 201: Median, Percentile, percent and so. Example Percentages and percentiles 1. Percentages are ratios of two numbers, multiplied up by 100. 15 is fifty percent of 30. (15/30) x 100=50). 60 is two hundred percent of 30. (60/30) x 100=200). 2. Pe... Date Added: 2009-06-24 12:24:12 |
| 19.pdf Path: ASU >> STAT >> 472 Fall, 2009 Description: MAT 472 Intermediate Real Analysis I John Quigg Exercises Section 19 - Series of functions 1. Prove that xn converges uniformly on every interval of the form [-s, s] with 0 < s < 1. Fall 2006 revised October 8, 2006 2. Find an example of a series of... Date Added: 2009-06-24 12:25:04 |
| math488lesson05pinsky.pdf Path: Nevada >> MATH >> 722 Spring, 2008 Description: ... Date Added: 2009-06-24 12:37:45 |
| 326hw1sol.pdf Path: Texas A&M >> ELEN >> 326 Fall, 2009 Description: ELEN 326 HW1 Soltuions 1a) AMI 0.5 micron (T3AF) NMOS > V[tho]:=.637; Vtho := .637 > mu[o]:=447e-4; o := .0447 > t[ox]:=1.41e-8; tox := .141 10-7 > epsilon[ox]:=.34e-10; ox := .34 10-10 > C[ox]:=epsilon[ox]/t[ox]; Cox := .002411347518 > K[... Date Added: 2009-06-24 12:42:02 |
| Preparation3_S08.pdf Path: Texas A&M >> ECO >> 463 Fall, 2009 Description: Preparation for Exam #3 During the exam: All questions have to be answered on your copy of the exam. You can use a cheat sheet. You are allowed one sheet of paper, standard letter size. You can also use a calculator and writing utensils. A cell phone... Date Added: 2009-06-24 12:46:18 |
| sol1.pdf Path: Iowa State >> CS >> 518 Fall, 2009 Description: Solutions to Assignment1 1.3 The elements of a set E are segments, not directed edges. There is no origin or destination of a segment. We have n segments, so there are 2n vertices. Algorithm: 1. Sort 2n points lexicographically, first by x, then by y... Date Added: 2009-06-24 12:47:26 |
| Homework_05b.doc Path: UGA >> CS >> 6730 Fall, 2002 Description: Maciej Janik Homework 5 Operating System paper summary Title: The Performance of Spin Lock Alternatives for Shared-Memory Multiprocessors Authors: Thomas E. Anderson 1. What is the problem that the authors are trying to solve? Author researches if f... Date Added: 2009-06-24 13:03:17 |
| 7pupil3.pdf Path: East Los Angeles College >> AF >> 1006 Fall, 2009 Description: Pirates of the Caribbean survey! Q1: Do you like healthy food? Q2: Do like unhealthy food? Q3: Do you like McDonalds? Q4: would you like a personal chef? Q5: do you like cooked breakfast? Q6: are you a vegetarian? Q7: do you eat meat? Q8: do you like... Date Added: 2009-06-24 13:04:25 |
| 021209.pdf Path: Glendale Community College >> BIO >> 201 Fall, 2008 Description: Gradebook for \'Untitled\', 2/12/2009 (Raw Scores), Dates: All BIO 201 Fall 2008 Grades Page 1 File Name: Spring 09 BIO 201.cls Class Grades Assignment-> Quiz 1 Quiz 2 Quiz 3 STD Success Success Success Syllabus Scaveng Practical Wk 1 Wk 2 Wk 3 er Hu... Date Added: 2009-06-24 13:05:27 |
| rubric.doc Path: UGA >> MYWEB >> 6000 Fall, 2009 Description: The Cherokee in Georgia: What do You Think? Evaluation/Assessment Component for Lesson Plan Assessment will take into account the studentss ability to understand the historical context in order to analyze documents and generate ideas that support dif... Date Added: 2009-06-24 13:07:25 |
| marking guide for debates.doc Path: Allan Hancock College >> IMS >> 5042 Fall, 2009 Description: IMS5042 IS Strategic Planning Assignment 1 Debates Issues and Marking Criteria The following points may help a little in clarifying what you need to do for the debates, and how it will be marked. 1. The Overall Aim As I said during lectures earlier i... Date Added: 2009-06-24 13:09:01 |
| Least-PreferredCoWorker.pdf Path: WVUP >> MGMT >> 410 Fall, 2009 Description: Professor Pamela A. Braden Division of Business & Economics Lecture: Least-Preferred Co-W o r k e r Participative Management Theory Fiedler\'s Contingency Theory Least-Preferred Co-Worker (LPC) Scale Following is a representation of Fiedler\'s LPC Sca... Date Added: 2009-06-24 13:11:32 |
| YNL072W.t2k.stride-ebghtl-logo.pdf Path: UCSC >> YNL >> 072 Fall, 2009 Description: YNL072W.t2k EBGHTL 3 2 1 CC X TT TTTCCHHH X 1 10 20 30 40 H 3 2 1 H T E T E EEEEEEE X X X X X G G G T G C X X X X X X X X X X X X X C T T CECCHHTHT GT T H H X CTTT 60 G X H HHHHHH CTTTTTTCH TC CT G G T C T T T G C T X E E G E B... Date Added: 2009-06-24 13:16:13 |
| YNL051W.t2k.dssp-ehl2-logo.pdf Path: UCSC >> YNL >> 051 Fall, 2009 Description: YNL051W.t2k DSSP-EHL2 1 CC 1 C C E E H H H X X X X X X 10 20 30 40 H 1 C C C C H T H S E H X X X X X X X X X X X X X X X X 51 60 70 80 90 H 1 C X H T HE T T H H 1 H H H X X X E H H 1 EH E H T H T T H HHH H HHHEX... Date Added: 2009-06-24 13:17:14 |
| Basics.pdf Path: National Taiwan University >> CSE >> 788 Fall, 2009 Description: CSE 788.J04: Sound Basics Basics of Sound Mathematics of the pure tone x(t) = A sin(2t / T + ) or x(t) = A sin(2ft + ) A: amplitude : phase T: period f: frequency Phase Lead - Phase Lag p. 1 CSE 788.J04: Sound Basics Power, Intensity, ... Date Added: 2009-06-24 13:18:09 |
| M243-RA1.pdf Path: Maryville MO >> MTH >> 243 Fall, 2009 Description: !\"# $% \"<=:( > !\" #$% #$! \" !\" ! %$! \" !# \" $ $57 ,-+ 1$760. 6. 8\" #9% ! \" \" ! \" !# ! %$! \' ) ! \" \" ! \" # ! \' *= $5 +*6.\'67 4+5,+1+7 $, ,-+ \'16>65 ?6,!*%... Date Added: 2009-06-24 13:23:46 |
| YKL020C.t2k.dssp-ehl2-logo.pdf Path: UCSC >> YKL >> 020 Fall, 2009 Description: YKL020C.t2k DSSP-EHL2 2 1 CCC X H H H H H C C X X X X X X X X X X X 1 10 20 30 40 S 2 1 H T T S H T E T S CC E X X C E C H H C E E H C C H H C C C C C X X X X X X X X X X X X X X C X X X X X CCC S C 51 60 70 80 90 T 2 1 H ... Date Added: 2009-06-24 13:26:19 |
| YKL099C.t2k.str2-logo.pdf Path: UCSC >> YKL >> 099 Fall, 2009 Description: YKL099C.t2k STR2 3 2 1 CHHH H C C C C S TCSC G T C H G G G H C G G C H C H Z C S H Y T X X XXXXTHHXHXHXHXHHHXXXTXXXXXCHXCCXXXXXXXXTXX X X X X X X X X X X X X X X C C X HHH C H SCHHHHHTT HH 1 10 20 30 40 H 3 2 1 H H T H HHHHHH X X X X ... Date Added: 2009-06-24 13:26:38 |
| YKL094W.t2k.alpha-logo.pdf Path: UCSC >> YKL >> 094 Fall, 2009 Description: YKL094W.t2k ALPHA 3 2 1 BBB B C E E E F C B E T E BBSAB E C E E B E E E C C C F B C C A AEDXIXTXXBXTAAE C D T B B B T G A X X X X X X X X BBB C BE B AE EB X XXXXXXXXXXXXX EEEBHCTB EEEEE ABB D EAAAA A A AI CB E X X S D C B S S B B C C S B E ... Date Added: 2009-06-24 13:26:39 |
| YKL072W.t2k.w0.5-logo.pdf Path: UCSC >> YKL >> 072 Fall, 2009 Description: YKL072W.t2k w0.5 3 2 1 10 20 30 40 H 3 2 1 T G T H EH T T E TE F YIVE F Y GN L DI P V V LP D LI RI XXXXXXXX XXXXXXXXXXXXX XXXXXXXXXXXXXXXXXXX Y L V I A S W W Y L V F L L I VL A D T Q K V A A X Q K F L L A I VTS V V T T S D ... Date Added: 2009-06-24 13:26:59 |
| YKL095W.t2k.dssp-ehl2-logo.pdf Path: UCSC >> YKL >> 095 Fall, 2009 Description: YKL095W.t2k DSSP-EHL2 2 1 CC H H H X X X X H 1 10 20 30 40 H 2 1 ECCCC C X X X X T T T G T H T E E E C C E C H H H H C C E C H H H X X H X X X X X H H H X C C C X X X X X X X X EEECCECEE C CC C E EEE H C E C E C E CECCCCCCCCCCCCC... Date Added: 2009-06-24 13:27:00 |
| YKL017C.t2k.stride-ebghtl-logo.pdf Path: UCSC >> YKL >> 017 Fall, 2009 Description: YKL017C.t2k EBGHTL 4 3 2 1 CHHHHHH HHHHHHHHHH HC X G H T T C H H T C C H C T T H H C C T C C T T C C T C T T T T C T C C C T T T T T T T T C T T X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X G H C X HH X X X X X X X HH... Date Added: 2009-06-24 13:27:06 |
| DiVito_resume_2009_april_final_web.doc Path: Penn State >> TJD >> 5056 Fall, 2009 Description: Thomas Joseph DiVito Sample Work & ePortfolio: http:/www.personal.psu.edu/tjd5056/ Email- tjdivito@gmail.com Cell Phone- (727)-599-1050 Permanent Address Tampa Bay, Florida [Please email or call me for a street address] EDUCATION: The Pennsylvania St... Date Added: 2009-06-24 13:30:16 |
| 200651_r04o_0404908.pdf Path: Stanford >> UTSI >> 1033 Fall, 2009 Description: 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 TERRY T . JOHNSON, State Bar No . 121569 ( tjohnson @wsgr.com) BORIS FELDMAN, State Bar No . 128838 ( bori s .feldman@wsgr.com) CHERYL W . FOUNG, State Bar No . 108868 (cfoung@... Date Added: 2009-06-24 13:41:00 |
| Notes_Part2.pdf Path: Case Western >> ENGR >> 339 Fall, 2009 Description: ... Date Added: 2009-06-24 13:42:27 |
| hw9.pdf Path: Lake County >> ECE >> 361 Fall, 2009 Description: ECE 361 Spring 2009 Homework 9 Date Assigned: 31 March 2009. Date Due: 9 April 2009 in class. Suggested Reading: Lecture notes 18 through 21. 1. Derive the approximations in Equations (3) and (25) in Lecture 21. Can you provide some mathematical me... Date Added: 2009-06-24 13:48:27 |
| 06_functions.pdf Path: UVA >> CS >> 101 Fall, 2008 Description: 2.1 Functions 2.1 Functions x y z f f (x, y, z) Functions (Static Methods) Java function. Takes zero or more input arguments. Returns one output value. ! ! Anatomy of a Java Function Java functions. Easy to write your own. Applications. Scient... Date Added: 2009-06-24 13:49:04 |
| precisionRTL_users.pdf Path: Lake County >> ECE >> 412 Fall, 2009 Description: Precision RTL Synthesis Users Manual 2003c Update1 March 2004 Copyright Mentor Graphics Corporation 2002-2004. All rights reserved. This document contains information that is proprietary to Mentor Graphics Corporation. The original recipient of thi... Date Added: 2009-06-24 13:50:43 |
| Problem_Set_7_Hints-2008.pdf Path: Maryville MO >> CHM >> 427 Fall, 2009 Description: Problem Set for Exam #3 Synthesis Problems Please provide logical syntheses for the target molecules beginning with the starting materials shown. Remember that the retrosynthesis arrow points towards the starting materials. These problems should tak... Date Added: 2009-06-24 13:57:12 |
| 200961_o02d_0901376.pdf Path: Stanford >> WFC >> 1042 Fall, 2009 Description: Case 3:09-cv-01376-SI Document 54 Filed 06/01/2009 Page 1 of 12 1 BERNSTEIN LITOWITZ BERGER & GROSSMANN LLP 2 DAVID R. STICKNEY (Bar No. 188574) TIMOTHY A. DeLANGE (Bar No. 190768) 3 DAVID A. THORPE (Bar No. 216498) 12481 High Bluff Drive, Suite ... Date Added: 2009-06-24 14:09:52 |
| TubaPedDM_05.pdf Path: Indiana >> MUSIC >> 100 Fall, 2009 Description: School of Music Indiana University For students entering the D.M. program in the School of Music: Fall 2005 through Summer 2007 Requirements for: Doctor Of Music Brass Pedagogy (Tuba) Current students may obtain an up-to-date degree audit using One... Date Added: 2009-06-24 14:14:22 |
| fin2004.pdf Path: Laurentian >> BIOL >> 3110 Fall, 2009 Description: Biology 3110 Review Questions Instructor: James E. Thomas CELL REGULATION Biology 3110 Review Questions for the Final Exam 1. Having divided some 60X since being isolated from a piece of round steak that met its end on a BBQ, Filmore Fibroma (of d... Date Added: 2009-06-24 14:19:40 |
| topics.pdf Path: Oakland University >> APM >> 569 Fall, 2008 Description: ... Date Added: 2009-06-24 14:26:41 |
| Lecture26.pdf Path: Columbia >> E >> 2161 Fall, 2009 Description: Outline Spring 2008 MSAE E4990y Three modes of AFM Static force detection Tapping Mode Amplitude modulation AFM in liquid: acoustic actuation AFM in liquid: magnetic actuation Introduction to STM and AFM Lecture 26 Dynamic-Mode AFM April 30, ... Date Added: 2009-06-24 14:31:25 |
| Week 2 - review of regression.doc Path: Cal Poly >> STAT >> 313 Fall, 2009 Description: Stat 413100 Fall 2006 Friday, October 06, 2006 With regression we attempt to describe the relationship between an explanatory variable (x) and a response variable (y) with a straight line, the regression line. Activity 1: House Prices The followin... Date Added: 2009-06-24 14:31:43 |
| Quiz5.pdf Path: Oakland University >> MTH >> 154 Fall, 2008 Description: M TH 15 4 Qu i z # 5 N am e T h i s q u i z i s d u e a t t h e b e g i n n i n g o f c la s s o n M o n d a y , J u ly 3 1 , 2 0 0 6 . N o t e : S h o w a ll o f y o u r w o r k . U n s u p p o r t e d w o r k w i ll r e c e i v e n o c r e d i t ... Date Added: 2009-06-24 14:38:22 |
| hw3.pdf Path: Portland >> MTH >> 427 Fall, 2008 Description: Homework # 3, due 10/30, in class Exercises from text (Haberman) 1. Problem 2.5.1 (f) - 15 points 2. Problem 2.5.3 (a) - 15 points 3. Problem 2.5.6 (a) - 15 points 4. Problem 2.5.6 (b) - 15 points 5. Problem 2.5.8 (a) - 15 points Mth 527 students o... Date Added: 2009-06-24 14:40:09 |
| HW10.pdf Path: Lake County >> ECE >> 313 Fall, 2009 Description: University of Illinois Fall 2008 ECE 313: Solutions to Problem Set 10 In Problems 1 and 2, (u) and (u) denote the pdf and CDF of the standard Gaussian random variable. 1. (a) E[X 2k+1 ] = u2k+1 (u) du = 0 because the integrand is an odd functio... Date Added: 2009-06-24 14:40:48 |
| PS12.pdf Path: Lake County >> ECE >> 313 Fall, 2009 Description: University of Illinois Spring 2008 ECE 313: Problem Set 12 Many Random Variables This Problem Set contains five problems Due: Reading: Noncredit Exercises: Wednesday April 23 at the beginning of class. 1. Random variables X and Y have the joint PD... Date Added: 2009-06-24 14:41:05 |
| problem of evil.pdf Path: UMass (Amherst) >> PHIL >> 383 Fall, 2008 Description: Philosophy of Religion Problem of Evil: Handout 1 The Argument: 1) Evil exists 2) If God exists, He would want to prevent all evil. 3) If God exists, He would be able to prevent all evil. 4) If (3) and (4) then, if God exists, there would be no evil.... Date Added: 2009-06-24 14:41:47 |
| ChartTranscendentalism.pdf Path: Grossmont >> ENGLISH >> 231 Fall, 2009 Description: English 231: American Literature I Instructor: K. Sherlock Some Common Premises To American Transcendentalism Clues to nature, individual as the history, and cosmos spiritual center of found within Not a rejection of God, but a preference to explain... Date Added: 2009-06-24 14:42:04 |
| fuel_cell_differences.pdf Path: Tennessee >> ECE >> 525 Fall, 2009 Description: Differences in Fuel Cell Types Ideal Voltage as a function of cell temperature Electrochemical reactions in fuel cells ... Date Added: 2009-06-24 14:42:13 |
| handout5.doc Path: Ohio State >> ECE >> 327 Winter, 2008 Description: Lab 1 -Bipolar Transistor Pin Connections o 2N 3904 (NPN)/ 2N 3906 (PNP): _ (black) + (red) o IN419 Diode Schematics 1. Common emitter amplifier: 1) Design the values of resistors and the capacitor to meet the following requirements: Vcc = 12V,... Date Added: 2009-06-24 14:47:32 |
| NRES 495 Lecture 17 2009.pdf Path: Nevada >> NRES >> 495 Fall, 2008 Description: NRES 496/695 Fire Ecology and Management 2009 Lecture 17: March 30 Teacher: Ashley Sparrow NRES @ UNR Previously, on NRES 495/695 Fire event- vs interval-dependent effects related to life history strategies and adaptation Event: Timing with respec... Date Added: 2009-06-24 14:50:49 |
| week10.pdf Path: NSC Henderson >> GEY >> 474 Fall, 2009 Description: Week 10 Chapter 10 Mass Transport Water quality standards Maximum contaminant level goals (MCLGs) Maximum contaminant levels (MCLs) Water sample collection Monitoring Planning Installing Sampling Diffusion F = D dC dx where F is the mass flux, D is... Date Added: 2009-06-24 14:51:50 |
| T0491.t04.n_notor2-logo.pdf Path: UCSC >> T >> 0491 Fall, 2009 Description: T0491.t04 n_notor2 3 2 1 1 10 20 30 40 N 3 2 1 PBP B N BN G NB N H N B 51 60 70 80 90 NB 3 2 1 N H NGN GNB N GNBNAB N BN 101 110 GRDPLVGLEHHHHHH 100 AVALGDLALLLADTPLGTEMQVQGFLAPARKDSVKVKLHLQQARRIAGSM 50 MNTLELSARV... Date Added: 2009-06-24 14:52:19 |
| h8.pdf Path: Lake County >> ECE >> 359 Fall, 2009 Description: ECE 359 Handout # 8 HOMEWORK ASSIGNMENT 6 Reading: Text, Section 3.3 and Handout #9 Due Date: March 13, 2003 (in class) 1. Problem 4.18 on page 205 of the text. (Hint: First nd the cdfs of Y and Z.) Spring 2003 March 6, 2003 2. Use your knowledge o... Date Added: 2009-06-24 14:52:57 |
| solution3.pdf Path: Western Michigan >> ECE >> 371 Fall, 2009 Description: ... Date Added: 2009-06-24 14:54:17 |
| Sample tuition agreement appendix I.pdf Path: Lake City CC >> IL >> 2302 Fall, 2009 Description: ... Date Added: 2009-06-24 14:56:40 |
| execcount.1.txt Path: Lehigh >> HW >> 403 Fall, 2009 Description: CSE402, Group 2. EXECCOUNT(1) NAME execcount - get or reset the fork/clone/vfork/exec counter. SYNOPSIS execcount SYSCALL[r] DESCRIPTION execcount performs one of two actions, depending on the option statement. execcount takes as a parameter... Date Added: 2009-06-24 14:58:31 |
| ECE421_HW8_F08.pdf Path: Colorado State >> ECE >> 421 Fall, 2008 Description: ECE421: Homework Set 8 Fall Semester 2008, CSU, Ft. Collins Due date: Nov. 20, 2008 Solve the following problems from Chapter 7 of the textbook: Detection Error Probability: 7.6-2 M-ary Communication: 7.7-3 and 7.7-4 Passband Digital Communicati... Date Added: 2009-06-24 15:03:55 |
| AN1040.pdf Path: Southern Illinois University, Carbondale >> ECE >> 531 Fall, 2008 Description: A/D and D/A CONVERSION/SAMPLING CIRCUITS BASESTATIONS / WIRELESS INFRASTRUCTURE HIGH-SPEED SIGNAL PROCESSING Mar 29, 2002 Coherent Sampling vs. Window Sampling One of the most useful techniques for evaluating the dynamic performance of fast and ult... Date Added: 2009-06-24 15:04:31 |
| Rasteroperations.pdf Path: WVU >> GEOG >> 350 Fall, 2008 Description: ... Date Added: 2009-06-24 15:12:14 |
| ex2_fall00.pdf Path: Washington >> ASTRO >> 101 Fall, 2009 Description: Astronomy 101 U & V Fall 2000 Exam 2 Star _ Name _ Score _/ 100 1. Identifying Your Star: (5 pts) Find a star map of your constellation and reproduce that map here. Include at least 4 named stars (Bayer designation is OK). Show the outline of the ... Date Added: 2009-06-24 15:19:28 |
| quiz1.pdf Path: SUNY Stony Brook >> MAT >> 118 Summer, 2008 Description: Quiz 1 PRINT your Name: MAT 118, Spring 2003 Nine 10-year-old boys were asked to rank their favorite T.V. shows. Three kids liked The Happy Bunny Mayhem Hour best, with Dragonball Z second, followed by Ed, Edd, and Eddie, and then Rabid Ninjas last... Date Added: 2009-06-24 15:24:50 |
| ex7.pdf Path: NSCC >> ASTR >> 100 Fall, 2009 Description: Astronomy 100 Name(s): Exercise 7: Minimum energy orbit Though a straight line may be the shortest distance between two points, travelling along the straight line requires a huge expenditure of energy, especially between two planets. In fact, the l... Date Added: 2009-06-24 15:26:16 |
| lecture8.pdf Path: Sanford-Brown Institute >> CS >> 034 Fall, 2009 Description: CS34 Lecture 8 CS-034 Its Magic Thomas Doeppner Pascal Van Hentenryck 3/23/2005 CS-034: Lecture 8 (twd/pvh: 2005) 1 Storage stack Local Variables dynamic data text malloc and new everything else Code 3/23/2005 CS-034: Lecture 8 (twd/pvh: 2... Date Added: 2009-06-24 15:30:41 |
| Test2.doc Path: New Mexico >> MATH >> 123 Fall, 2008 Description: MATH 123TRIGONOMETRY SUMMER 2007 TEST 2 1. (14 points) Find the EXACT values of the following a. cos105 0 b. sin 19 12 4 , csc x < 0. 5 2. (14 points) Find sin 2x and cos 2x, given that cos x = 3. (15 points) Rewrite the expression as an algebraic ... Date Added: 2009-06-24 15:37:57 |
| Lab03_rev2.pdf Path: UC Davis >> PHYS >> 116 Fall, 2008 Description: Lab 3: Passive Components U.C. Davis Physics 116A 10/8/2003 INTRODUCTION In this lab you will build a Thvenin equivalent circuit and a low-pass filter and will characterize each. 1. THVENIN EQUIVALENT CIRCUIT In this section, you will build a circui... Date Added: 2009-06-24 15:41:09 |
| 1300prob6.pdf Path: University of Toronto >> MAT >> 1300 Fall, 2009 Description: UNIVERSITY OF TORONTO MAT 1300Y Due: Monday, April 9, 2007 Problem Set VI 1. Let T = S 1 S 1 denote the torus. Show that any map from S 2 to T is zero on reduced homology. 2. a) Show that T can be covered by 3 contractible open sets. b) Show that T... Date Added: 2009-06-24 15:44:14 |
| GCS_wormelli_postcrd.pdf Path: Hamline >> FAS >> 270 Fall, 2009 Description: acclaimed middle school educator RICK WORMELI Sure Footing in a Shaky World: Best Practices in Middle School EDUC 6185-54343 Boost your enthusiasm and motivation for teaching middle school students. Gain immediately applicable skills, references, a... Date Added: 2009-06-24 15:45:26 |
| Chapter 4rev.ppt Path: Laurentian >> MGT >> 4090 Fall, 2009 Description: The Internal Environment: Resources, Capabilities, and Core Competencies 0 Chapter Four 2006 by Nelson, a division of Thomson Canada Limited. 4- 1 The Components of Internal Analysis 2006 by Nelson, a division of Thomson Canada Limited. 4- 2... Date Added: 2009-06-24 15:46:58 |
| T0501.t04.n_notor-logo.pdf Path: UCSC >> T >> 0501 Fall, 2009 Description: T0501.t04 n_notor 4 3 2 1 MLTKVIAQAHIDHFTKWFERADKIVIVSHVSPDGDAIGSSLGLYHFLDSQDKIVNVIVPNAFPDFLKWMPGSKDILLYDRYQEFADKLIMEADVICCLDF 1 10 20 30 40 50 60 70 80 90 N 4 3 2 1 H GP N SH GPN PNPN GN H NGP N NALKRIDEMSDIVAASPGRKIMIDHHLYPEDFCRITISHPEIS... Date Added: 2009-06-24 15:47:15 |
| EOC_Solution_23_55.pdf Path: Cal Poly >> PHYS >> 132 Fall, 2009 Description: 23.55. Model: Use the ray model of light and the phenomenon of refraction. Visualize: Solve: (a) The critical angle c for the glass-air boundary is 1.0 nglass sin c = nair sin 90 c = sin 1 = 41.81 1.50 For the triangle ABC, glass 1 + 120 ... Date Added: 2009-06-24 15:57:58 |
| Pfinalsolutions.pdf Path: SUNY Stony Brook >> MAT >> 303 Summer, 2008 Description: MAT303 Spring 2009 Some Practice Final Solutions Problem 2 i. xy + y = 3 This is of the form a(x)y + b(x)y = f (x), so it is linear. No integrating factor is needed (or you may use p(x) = 1). xy + y = 3 (xy ) = 3 xy = 3x + c c y = 3+ x ii. xy y =... Date Added: 2009-06-24 16:01:20 |
| sub1.pdf Path: Delta State >> MAT >> 331 Fall, 2009 Description: Subtraction: Comparison Place Value Table using Decomposition and Subtraction from the Base Step 0 534 - 345 Set up the chart. Notice the chart is a comparison chart. Step 1 2 10 53 4 - 345 9 Notice the first thing to do is decompose a one-ten ... Date Added: 2009-06-24 16:02:37 |
| YJL093C.t2k.alpha-logo.pdf Path: UCSC >> YJL >> 093 Fall, 2009 Description: YJL093C.t2k ALPHA 3 2 1 S T E XA EAEEE EA B A A E E G B X X X XX T B A EHH BT HG D E D D B E F I I S F E C H C S S A A A E I H I A B B E B B E B S A C H H H A B T X X X X FH S XXXX X E EES IXS I X XXXXXDXIXII X A A C E BB C B 10 20 ... Date Added: 2009-06-24 16:03:16 |
| YJL012C.t2k.stride-ebghtl-logo.pdf Path: UCSC >> YJL >> 012 Fall, 2009 Description: YJL012C.t2k EBGHTL 3 2 1 CCHHHHHHHHCC THC X X X X X C G T G E G C T T T C T T T T T H G T C B H C G T H H C C T T C C X X X X X X X X X X X X X X X X X X X HTTTGTHC X CHHHTT G E C CH E 10 20 30 40 H 3 2 1 H G T E H T H H HHHHHHHHH... Date Added: 2009-06-24 16:03:39 |
| to.txt Path: NYU >> JK >> 1786 Fall, 2009 Description: aalto agrigento alecto allegretto alto amaretto antipasto auto basuto blotto bonito burrito caimito callisto canto caporetto caracolito castrato cavetto concerto conto contrafagotto contralto ditto divertimento erato esperanto falsetto frijolito fto ... Date Added: 2009-06-24 16:04:52 |
| 1045L FINAL EXAM REVIEW WORKSHEET.pdf Path: Miami Dade >> AVELAZQ >> 1045 Fall, 2009 Description: ... Date Added: 2009-06-24 16:12:25 |
| Program 6 Spring_09.doc Path: Frostburg >> COSC >> 240 Fall, 2008 Description: COSC 240 Spring 2009 FSU Program Six -This is the continuation of program four. Please add the following methods to your class LIST. Please make sure the previous methods are still working. -Create a method called searchName to accept a formal param... Date Added: 2009-06-24 16:13:51 |
| Lab_1.pdf Path: Frostburg >> COSC >> 240 Fall, 2008 Description: Computer Science 240 Lab 1 - Data Types, Assignment, Evaluation, Printing Introduction Java has a number of primitive data types. If you are familiar with other programming languages, you might recognize some of them. Every language has its own idio... Date Added: 2009-06-24 16:13:51 |
| module02_eclassroom.doc Path: U. Houston >> MODULE >> 6373 Fall, 2009 Description: Needsassessmentisabroadtermusedtodescribeavarietyofactivitiesrangingfrominterviews tosurveystoobservationsthatallcontributetothedesigner\'sknowledgeoftheinstructional problem. Mostreferencesadvocateusingmultiplemethodsofneedsassessment.Togetatruepictu... Date Added: 2009-06-24 16:18:48 |
| 03-serendip_prog.pdf Path: Contra Costa College >> ATT >> 5952 Fall, 2009 Description: Serendipities and Synchronicities Pete Stollery This piece was commissioned by the Reeling & Writhing Theatre Company, Glasgow as part of Standing Wave, a play about the life and music of Delia Derbyshire, who worked at the BBC Radiophonic Workshop... Date Added: 2009-06-24 16:19:26 |
| FR Appendicies.pdf Path: Penn State >> KMH >> 326 Fall, 2009 Description: MilestoneBuilding#4 KristenMHlopick ConstructionManagement|Dr.Riley|Germantown,Maryland|April9,2008 AppendixA BuildingSequencing Page 51 of 117 MilestoneBuilding#4 KristenMHlopick ConstructionManagement|Dr.Riley|Germa... Date Added: 2009-06-24 16:24:07 |
| 20184.txt Path: UNC >> DOCS >> 20184 Fall, 2009 Description: The Project Gutenberg EBook of The Adventures of Uncle Jeremiah and Family at the Great Fair, by Charles McCellan Stevens (AKA \'Quondam\') This eBook is for the use of anyone anywhere at no cost and with almost no restrictions whatsoever. You may co... Date Added: 2009-06-24 16:26:43 |
| 20567.txt Path: UNC >> DOCS >> 20567 Fall, 2009 Description: The Project Gutenberg EBook of The Pigeon Tale, by Virginia Bennett This eBook is for the use of anyone anywhere at no cost and with almost no restrictions whatsoever. You may copy it, give it away or re-use it under the terms of the Project Gutenb... Date Added: 2009-06-24 16:26:59 |
| 20563.txt Path: UNC >> DOCS >> 20563 Fall, 2009 Description: The Project Gutenberg EBook of Terry, by Charles Goff Thomson This eBook is for the use of anyone anywhere at no cost and with almost no restrictions whatsoever. You may copy it, give it away or re-use it under the terms of the Project Gutenberg Li... Date Added: 2009-06-24 16:27:09 |
| 20470.txt Path: UNC >> DOCS >> 20470 Fall, 2009 Description: The Project Gutenberg EBook of Etiquette, by Agnes H. Morton This eBook is for the use of anyone anywhere at no cost and with almost no restrictions whatsoever. You may copy it, give it away or re-use it under the terms of the Project Gutenberg Lic... Date Added: 2009-06-24 16:27:18 |
| nwpyg10.txt Path: UNC >> DOCS >> 2049 Fall, 2009 Description: The Project Gutenberg Etext of Liber Amoris or The New Pygmalion by William Hazlitt Copyright laws are changing all over the world, be sure to check the copyright laws for your country before posting these files! Please take a look at the importan... Date Added: 2009-06-24 16:28:16 |
| mat 151 4.3 hw.pdf Path: Pima CC >> MAT >> 151 Fall, 2008 Description: ... Date Added: 2009-06-24 16:31:46 |
| lecture_1.pdf Path: Acton School of Business >> ESCI >> 102 Spring, 2005 Description: Earth Science 102 Evolution of the Earth Spring 2005 Rice University Class Overview Lecture: M W F 9:00-9:50 105 Geological Labs Grading: Participation (20%) Class Projects (45%) Mid-Term Exam (15%) Final Exam (20%) Instructors Brandon Dugan duga... Date Added: 2009-06-24 16:34:15 |
| hwk11.pdf Path: Bryn Mawr >> PHYS >> 306 Fall, 2009 Description: Physics 306 Homework #11 Due Friday, November 30, 5 p.m. . . . . Reading: Boas 11.9 12.1 12.2 12.11 The Error Function Series Solutions to Dierential Equations, Legendre Polynomials Method of Frobenius (more series solutions) Note: there is a lot o... Date Added: 2009-06-24 16:34:30 |
| edu962389.pdf Path: Allan Hancock College >> EDUC >> 3050 Fall, 2009 Description: Journal of Educational Psychology 2004, Vol. 96, No. 2, 389 395 Copyright 2004 by the American Psychological Association 0022-0663/04/$12.00 DOI: 10.1037/0022-0663.96.2.389 A Personalization Effect in Multimedia Learning: Students Learn Better When... Date Added: 2009-06-24 16:35:34 |
| Adventure_Help_Session2006.pdf Path: Sanford-Brown Institute >> CS >> 015 Fall, 2009 Description: ADVENTURE THE MOST A-MAZE-ING GAME OF YOUR LIFE Your Adventure TA Team: Tatyana Andrew Alex Arushi Laura Tyrell Basic Requirements A randomly generated maze A goal At least 2 non-player characters Items User Manual How are we going to do all t... Date Added: 2009-06-24 16:35:34 |
| wright_tech.xls Path: Ball State >> PRODUCTION >> 0304 Fall, 2009 Description: NationalAirS looking east Power located approx. 175ft from this location. Hand rails do not move. Sidewalk is 25ft wide ... Date Added: 2009-06-24 16:35:42 |
| Set71.pdf Path: Ill. Chicago >> CHEM >> 344 Fall, 2008 Description: ... Date Added: 2009-06-24 16:36:24 |
| exam1_S02.pdf Path: Oakland University >> AME >> 437 Spring, 2009 Description: u GA G p I3A T HUUi)EcD6Hbs`H}b42 l oDUWCV g 6D4b6Fq}6}c4@2)W7boibDooD6HA g 4WCo}cbo}HbWGiHUUcbbn 27AC 2 T 2 m 5 7 2 7 V T n m up3357 7 VA 2 TA 5 a V I GA 732 I G 922 I 2 57 a V A T V2 T n5 T V j X2 GAC X 952 9 A T pA j A V 23... Date Added: 2009-06-24 16:38:39 |
| hw3.txt Path: Clarkson >> CS >> 451 Fall, 2009 Description: CS451/551 Artificial Intelligence Spring 2000 Assignment #3 due: Thursday, 3/31/00 The Assignment: - Download OTTER from http:/www-unix.mcs.anl.gov/AR/otter If you want you can run my version dir... Date Added: 2009-06-24 16:52:54 |
| CHEM 255 Assignment 9 2008.doc Path: St. Francis IL >> CHEM >> 255 Fall, 2009 Description: CHEM 255 Assignment 9 March 2008 1. Production of acetyl-CoA (activated acetate) Which of the following is not true of the reaction catalyzed by the pyruvate dehydrogenase complex? A) Biotin participates in the decarboxylation. B) Both NAD+ and a ... Date Added: 2009-06-24 16:53:07 |
| SVTConfigLossMDI.pdf Path: Stanford >> MTG >> 050617 Fall, 2009 Description: SVT Configuration Losses & FW-MID FW-BTM diodes 6/17/05 Shane Curry SVT Configuration Losses Burst of Radiation Causes AToM Chips to Reset, Results - Corrupted Data Run 55099: June 8th 2005 Red Dots = Modules with Configuration Losses B. Petersen h... Date Added: 2009-06-24 16:53:40 |
| Quiz1.pdf Path: Concordia Chicago >> MATH >> 112 Fall, 2009 Description: Name: Math 112 Section 20 Fall 2006 Quiz 1 1. Let A = {0, 1, 2, 3} and B = {a, b, c, d}. (a) Give an example of a function from A to B which is one to one. Write your function as a subset of A B . (b) Give an example of a function from A to B which... Date Added: 2009-06-24 16:54:18 |
| A-401.pdf Path: Penn State >> LWM >> 124 Winter, 2009 Description: ... Date Added: 2009-06-24 17:00:45 |
| Shelburne-2005-MuscleCompensationACL.pdf Path: FIU >> PHT >> 6127 Fall, 2008 Description: APPLIED SCIENCES Biodynamics Effect of Muscle Compensation on Knee Instability during ACL-Deficient Gait KEVIN B. SHELBURNE1, MICHAEL R. TORRY1, and MARCUS G. PANDY2 Steadman Hawkins Research Foundation, Biomechanics Research Laboratory, Vail, CO; a... Date Added: 2009-06-24 17:02:58 |
| YPL111W.t2k.dssp-ehl2-logo.pdf Path: UCSC >> YPL >> 111 Fall, 2009 Description: YPL111W.t2k DSSP-EHL2 2 1 C CHEE C C C C H H H H X X X X X X X X X X X X X X 1 10 20 30 40 T 2 1 CC CCCXX E H X X X S E T T H H T 51 60 70 80 90 T 2 1 T E T H HHHHHHHHHHH CC EEEE C C C X X X X X X X X X X X CXE H C X X CCC... Date Added: 2009-06-24 17:07:46 |
| YPL151C.t2k.w0.5-logo.pdf Path: UCSC >> YPL >> 151 Fall, 2009 Description: YPL151C.t2k w0.5 5 4 3 2 1 DE E D S G K K P E XXXX L L P V N Q R N G X XXXXXXXXXXXXXXXXXXXXXXXXXXXXX L E D S D E E E F L L E E E P D L E L L E E L R L S E Y L V X D E I E X XXX L S L L XX X XXXXXXXX L K G E R Q K... Date Added: 2009-06-24 17:08:21 |
| page11.pdf Path: Kent State >> MATH >> 61052 Fall, 2008 Description: ... Date Added: 2009-06-24 17:12:04 |
| Pacing Guide pt 4.doc Path: Appalachian State >> PW >> 54779 Fall, 2009 Description: Competency Goal 10: WorldWarIIandtheBeginningoftheColdWar(19301963) ThelearnerwillanalyzetheUnitedStatesinvolvementinWorld WarIIandthewarsinfluenceoninternationalaffairsinthe followingdecades. Objective 10.04 (1 day): Elaborateonchangesinthedirecti... Date Added: 2009-06-24 17:12:06 |
| 6th_chapter1_sect_1.pdf Path: El Paso CC >> MATH >> 243 Fall, 2009 Description: Introduction to the Practice of Statistics Sixth Edition Moore, McCabe Section 1.1 Homework Answers 1.21 An aging population. The population of the United States is aging, though less rapidly than in other developed countries. Here is a stemplot of... Date Added: 2009-06-24 17:15:21 |
| page1.pdf Path: El Paso CC >> MATH >> 243 Fall, 2009 Description: ... Date Added: 2009-06-24 17:15:25 |
| p230_ch25_sp09.pdf Path: Centre >> P >> 230 Fall, 2009 Description: B VB VA A E ds B Equipotential Surfaces VB VA A E ds B A conservative field: One for which taken from A to B. A Another way to say this is E ds is independent of the path E ds 0 B A conservative field: One for which taken from A to... Date Added: 2009-06-24 17:17:13 |
| Area Studies and Bush Wars Poster.doc Path: Minnesota >> ANDER >> 025 Fall, 2009 Description: A rea Studies a nd Bush Wars: Neo-Conservatism and the China-Japan Nexus Thursday,April6th,3:306pm Aroundtablewith: PresentedbytheOrganizationforAsianResearch. YerbaBuenaBallroomSalon6,MarriotSanFrancisco,55FourthStreet,CA94103 Juan Cole, Mark Sel... Date Added: 2009-06-24 17:18:51 |
| hw4.pdf Path: Ohio State >> LING >> 384 Fall, 2009 Description: Homework 4: Machine Translation Linguistics 384 (Anna Feldman) Due at beginning of class on Thursday, February 24, 2005 1. Go to http:/babelfish.altavista.com, a site which allows you to type in text and translate it into another language. You can a... Date Added: 2009-06-24 17:19:24 |
| Art10Lesson8.pdf Path: Laurentian >> DAY >> 3601 Fall, 2009 Description: Subject: Art 10 Unit: Acrylic Painting Topic: Canvas Board Preparation Lesson: Eight Duration: One Period Date: March 18, 2004 At the end of this lesson students will: 1. Be able to prime their painting boards correctly. 2. Understand the importance ... Date Added: 2009-06-24 17:20:41 |
| ch20.ppt Path: UCSC >> ECON >> 161 Fall, 2008 Description: vti_encoding:SR|utf8-nl vti_timelastmodified:TR|13 Jan 2003 18:20:08 -0000 vti_extenderversion:SR|4.0.2.6513 vti_backlinkinfo:VX|powerpoints.htm vti_cacheddtm:TX|09 Feb 2001 12:19:48 -0000 vti_filesize:IR|1059840 vti_cachedlinkinfo:VX| vti_cachedsvcr... Date Added: 2009-06-24 17:25:30 |
| 23407.txt Path: UNC >> DOCS >> 23407 Fall, 2009 Description: The Project Gutenberg EBook of The Tiny Picture Book., by Anonymous This eBook is for the use of anyone anywhere at no cost and with almost no restrictions whatsoever. You may copy it, give it away or re-use it under the terms of the Project Gutenb... Date Added: 2009-06-24 17:28:37 |
| 23070.txt Path: UNC >> DOCS >> 23070 Fall, 2009 Description: The Project Gutenberg EBook of Clara Maynard, by W.H.G. Kingston This eBook is for the use of anyone anywhere at no cost and with almost no restrictions whatsoever. You may copy it, give it away or re-use it under the terms of the Project Gutenberg... Date Added: 2009-06-24 17:28:58 |
| lstbw10.txt Path: UNC >> DOCS >> 2350 Fall, 2009 Description: Project Gutenberg Etext His Last Bow, by Sir Arthur Conan Doyle #23 in our series by Sir Arthur Conan Doyle Copyright laws are changing all over the world, be sure to check the copyright laws for your country before posting these files! Please take... Date Added: 2009-06-24 17:29:27 |
| ex96ans.doc Path: East Los Angeles College >> CIVE >> 1400 Fall, 2009 Description: CIVE 1400: FLUID MECHANICS Examination May/June 1996 Model answers. 1(a) 1(b) State Buckinghams Theorems and explain the uses of dimensional analysis. (8 marks) An apparatus is used to measure the pressure drop in a pipe of 3cm diameter in which wat... Date Added: 2009-06-24 17:30:15 |
| YAL042C-A.t2k.alpha-logo.pdf Path: UCSC >> YAL >> 042 Fall, 2009 Description: YAL042C-A.t2k ALPHA 1 E E E E B E C H A H H H XXXXXXXXX E B D C B T C E E B H H H H H X X X X X X X H H S S B H S C E B S E A D H X X XXXXXXA X E H X X X X X X X H H H H H H X X X X XXXXX E E H E E H E H E XXXXXAXXX X S S B E E... Date Added: 2009-06-24 17:31:36 |
| YML114C.t2k.w0.5-logo.pdf Path: UCSC >> YML >> 114 Fall, 2009 Description: YML114C.t2k w0.5 4 3 2 1 V I A S LT M XXXXXXX S L E D K L S A X G E I ID T MS L MQ F V VXQVLXXXXLFXLX V XXXXXXXXXXXXXXXXXXXXXXXXXXXXX XXX XX X G S A F D S E T Q IVQ E L A V L E P S I S T S L A L S L F M L ISE D E S V L F L I F... Date Added: 2009-06-24 17:31:36 |
| HW10.pdf Path: Sanford-Brown Institute >> MA >> 114 Fall, 2009 Description: MA114 Analysis on Manifolds Hughes Homework 10 (collaborative) Due: 17 April 2003 Reading: Spivak, pages 63-66, page 115 to end. 1 Complex variables Do problem 4-33 of Spivak. 2 Forms on a manifold; coordinate expressions in dierent coordinat... Date Added: 2009-06-24 17:42:06 |
| MA322_Quiz3Soln_Fall2007.pdf Path: Kentucky >> MA >> 322 Fall, 2008 Description: Name: SOLUTION Quiz 3: Fri, Aug 31st Your answer should be a detailed explanation written neatly in quality English. Problem 1 (2 pts): Given an m 3 matrix A= and two vectors a1 a2 a3 u1 u = u2 u3 and v1 v = v2 , v3 show that A(u + v) = Au ... Date Added: 2009-06-24 17:43:44 |
| G191_Chapt1.pdf Path: UCSB >> G >> 191 Fall, 2009 Description: AreasofQuantitativeMethodsOR/MS 1 IntroductiontoOptimization R.L.Church MathProgramming/optimization DecisionTheory GraphTheory GameTheory QueuingTheory StochasticProcesses Simulation 2 1 MathProgramming Linearprogramming Integerprogr... Date Added: 2009-06-24 17:48:03 |
| ELEN449_Lab_Syllabus.pdf Path: Texas A&M >> ELEN >> 449 Fall, 2009 Description: ELEN 449 Lab Syllabus (Tentative), Summer 2004 TA: Sections: 301 302 303 Office: Office Hour: E-mail: Mail Box #: Phone: Nader Samaan W 2:00PM-04:50PM R 2:00PM-04:50PM R 11:00AM-02:00PM 30E ZACH M: 11:00AM 12:30PM W: 12:00PM - 1:30PM nsamaan@ee.tamu... Date Added: 2009-06-24 17:48:18 |
| HistoryOfInfinity.pdf Path: Boise State >> MATH >> 547 Fall, 2008 Description: The History of Infinity1 What is it? Where did it come from? How do we use it? Who are the inventors? 1 The Beginning As there is no record of earlier civilizations regarding, conceptualizing, or discussing infinity, we will begin the story of inf... Date Added: 2009-06-24 17:55:00 |
| 4160_module3.pdf Path: North Texas >> CECS >> 3260030 Summer, 2009 Description: Amber Garrett Assignment 3 ATTD 4160.020 Fall 2006 ... Date Added: 2009-06-24 17:57:05 |
| QOM.ppt Path: USC >> CSCI >> 586 Fall, 2008 Description: QOMQuickOntologyMapping Marc Ehrig and Steffen Staab Institute AIFB, University of Karlsruhe Outline Introduction Terminology Process Data Structures and Methods Approaches to Determine Mappings Comparing Run-time Complexity Evaluation ... Date Added: 2009-06-24 17:58:31 |
| YBL107W-A.t2k.stride-ebghtl-logo.pdf Path: UCSC >> YBL >> 107 Fall, 2009 Description: YBL107W-A.t2k EBGHTL 3 2 1 C TEHCCE HHHXX H H C X X X X X 1 10 20 E HE T E T H H E 30 C CEEE EE EEEE MIIIFIELCRIADSLLWIPKSWRRTSSISTYLIL T T E H T H E C X X X X X X E T E X X T C T T E C C H T H T X X X X X X X X C C C H H X X X... Date Added: 2009-06-24 18:10:38 |
| PS5_S09.pdf Path: CofC >> WALKERD >> 317 Fall, 2009 Description: ECON 317, Microeconomic Analysis Spring 2009, Walker PROBLEM SET #5 March 24, 2009 Name: _ DUE DATE: Tues., Mar. 31, 1.40. Keep a copy of your responses. Since the exam is the class day after the due date for PS#5, you will not see your graded prob... Date Added: 2009-06-24 18:12:39 |
| SG3.pdf Path: CofC >> OLD >> 317 Fall, 2009 Description: Chapter 03 - Rational Consumer Choice Chapter 3 RATIONAL CONSUMER CHOICE Boiling Down Chapter 3 This chapter gets down to the nitty-gritty of decision making. The process of choosing among alternatives requires, first, a clear understanding of the ... Date Added: 2009-06-24 18:12:42 |
| exam_3_key_s08 Path: Rutgers >> CHEM >> 01:160:308 Spring, 2009 Description: _ PRINT NAME 1. Which compound would incorporate the most deuterium atoms upon treatment with alkaline D2O? 308 EXAM III SPRING 2008 1 _ PRINT NAME 2. Which is the major product formed in the reaction sequence shown below? 308 EXAM III SPRING 200... Date Added: 2009-06-25 13:43:03 |
| Final_Exam_Key Path: Rutgers >> CHEM >> 01:160:308 Spring, 2009 Description: ... Date Added: 2009-06-25 13:44:46 |
| Final_Exam_Key Path: Rutgers >> CHEM 160 >> 01:160:308 Spring, 2009 Description: ... Date Added: 2009-06-25 13:50:12 |
| Pratica - p- 209 exam 2 Path: Cornell >> PORT >> 2090 Fall, 2008 Description: Preencher usando uma forma do Perfeito / Imperfeito/ Mais-que-Perfeito ou Infinito Pessoal Ateno sequncia dos tempos verbais. Quando houver mais de uma possibilidade, por exemplo o pefeito ou imperfeito, etc., sem mudar o significado, escreva ambas ... Date Added: 2009-06-25 15:15:17 |
| plan-A2000.pdf Path: Cal Poly >> MTH >> 2301 Fall, 2009 Description: M thodes statistiques en ing nierie Cours MTH2301 (4,1,4) Automne 2000 Pr alable Pr alable pour COLE POLYTECHNIQUE 115 1.322 1.411 1.440 2.573 6.326 7.420 7.431 9.353 9.370 9.500 Coordonnateur Groupe 1 Groupe 2 Groupe 3 Marc Bourdeau A-520.12 Mar... Date Added: 2009-06-25 18:17:47 |
| oh_with_equations.pdf Path: East Los Angeles College >> SD >> 103 Fall, 2009 Description: Numerical Methods for Natural Sciences IB Introduction Numerical Methods Natural Sciences Tripos 1B Lecture Notes Lent Term 1999 Stuart Dalziel Department of Applied Mathematics and Theoretical Physics University of Cambridge Phone: (01223) 337911... Date Added: 2009-06-25 18:24:21 |
| X.25-DNIC-List.doc Path: DePaul >> TDC >> 372 Fall, 2009 Description: I NTERNATIONAL T ELECOMMUNICATION U NION Geneva, 14 April 1997 Ref: TSB Circular 31 COM 7/HZ +41 22 730 5994 +41 22 730 5853 - To the Administrations of Member States of the Union Copy: - To ITU-T Sector Members; - To the Chairman and Vice-Chairmen... Date Added: 2009-06-25 18:24:47 |
| hw4.pdf Path: Wisc Stout >> FACULTY >> 156 Fall, 2009 Description: MATH 156 Homework 4 Show all work and use proper notation. 1. (2 pts.) Let f (x) be a function. Name: (a) State the analytic denition of the derivative f (x) in terms of a limit. (b) State the geometric interpretation of the derivative f (x). 2. ... Date Added: 2009-06-25 18:25:05 |
| hwj20.ppt Path: Illinois State >> EAF >> 512 Fall, 2009 Description: Applied Statistics for the Behavioral Sciences Chapter 20: Other Correlation Coefficients Trisha Klass Illinois State University Key Concepts in Chapter x x x x x x x Dichotomous variable Point-biserial correlation coefficient (rPB ) Phi ( ) coe... Date Added: 2009-06-25 18:25:12 |
| sh050606_tilt04.ps Path: Wisconsin >> SH >> 050606 Fall, 2009 Description: %!PS-Adobe-3.0 %Creator: MATLAB, The Mathworks, Inc. %Title: sh050606_tilt04.ps %CreationDate: 06/16/2005 17:08:19 %DocumentNeededFonts: Helvetica %DocumentProcessColors: Cyan Magenta Yellow Black %LanguageLevel: 2 %Pages: (atend) %BoundingBox: (aten... Date Added: 2009-06-25 18:33:15 |
| 75.pdf Path: Oregon State >> MTH >> 632 Fall, 2008 Description: Section 75 Def: If X is path connected, the abelianization of ! 1 !X, x 0 \" is called the first homology group of X, H 1 ! X\" . Note: Independent of base point. Thm: Let F be a group, N a normal subgroup and q : F ! F/N be the projection homomorphism... Date Added: 2009-06-25 18:37:40 |
| lec14.ps Path: Caltech >> WEEK >> 108 Fall, 2009 Description: %!PS-Adobe-2.0 %Creator: dvipsk 5.58f Copyright 1986, 1994 Radical Eye Software %Title: lec14.dvi %Pages: 12 %PageOrder: Ascend %BoundingBox: 0 0 612 792 %DocumentFonts: cmbx12 cmr10 cmmi10 cmr7 cmex10 cmsy10 cmmi7 cmsy7 %+ cmti10 cmmi5 cmr5 %EndComm... Date Added: 2009-06-25 18:37:58 |
| MIS Business Project.doc Path: Penn State >> KLT >> 5057 Fall, 2009 Description: Table of Contents COMPANY OVERVIEW.2 LOCATION..2 PRODUCTS.2 ESTIMATE SALES..2 PEOPLE..2 PEOPLE 1.3 PEOPLE 2..3 PEOPLE 3..3 HARDWARE.3 SYSTEM COMPONENTS..3 INPUT DEVICES.3 OUTPUT DEVICES..4 STORAGE..4 NETWORK.4 SOFTWARE..4 WORD PROCESSING.4 SPREADSHE... Date Added: 2009-06-25 18:42:11 |
| p30_023.pdf Path: St. Michael >> CH >> 212 Fall, 2009 Description: 23. Using the right-hand rule, we see that the current i2 carried by wire 2 must be out of the page. Now, BP 1 = 0 i1 /2r1 where i1 = 6.5 A and r1 = 0.75 cm + 1.5 cm = 2.25 cm, and BP 2 = 0 i2 /2r2 where r2 = 1.5 cm. From BP 1 = BP 2 we get i2 = i1 r... Date Added: 2009-06-25 18:47:51 |
| 313hw6.pdf Path: George Mason >> MATH >> 313 Fall, 2008 Description: %ft f Aaffi=,atu/-4- frr/ I ^ o*r r.t p\" 0 -\'at t 0 -\'at4# .-J*14 ffi = 4 tu\'/A, -= -_ f;zu * a- laz @f rTi?rb = ira:u\'fr Jr ru -0 , j ^fo.-i= - 7.;,4 o 3b+ \'v*4iti+ =t;/tff \"r\"* ^7&\'^ orki74:hritl,... Date Added: 2009-06-25 18:48:10 |
| JerryKim_CV.pdf Path: Columbia >> JWK >> 2108 Fall, 2009 Description: Jerry W. Kim Columbia Business School Uris 719, 3022 Broadway, New York NY 10027 Phone: (212) 854-2812; Fax: (212) 854-3778 jwk2108@columbia.edu APPOINTMENTS 2006 Present Assistant Professor of Management, Columbia University (New York NY) EDUCATIO... Date Added: 2009-06-25 18:49:05 |
| hw2sol.doc Path: UF >> STAT >> 6934 Fall, 2009 Description: STA 6934 HW # 2 Chapter 6: Problems 8, 9, 13, 14, 15, 16 18, 19 8) Given: Probability of childs gestation age < 37 weeks, P(A) = 0.142 Probability of birth weight less than 2500 gms, P( B) = 0.051 Probability of these two events occurring simultaneou... Date Added: 2009-06-25 18:59:13 |
| Readings week7.doc Path: UCSB >> ESM >> 595 Fall, 2009 Description: Brouwer, E., and A. Kleinknecht (1997). \'Measuring the unmeasurable: a country\'s non R & D expenditure on product and service innovation\', Research Policy, 25(8), pp. 12351242. Grindley, Peter, David C. Mowery, and Brian Silverman. The design of high... Date Added: 2009-06-25 19:01:39 |
| homework.pdf Path: SLCC >> PHYS >> 1010 Fall, 2008 Description: PHYSICS 1010 Elementary Physics Assignments (J. Barnes) FALL 2006 These are the exercises and problems from the chapter that are required for your homework. They are due on the date listed on the class calendar. You are responsible to bring the Cha... Date Added: 2009-06-25 19:05:38 |
| exam2006sol.pdf Path: Allan Hancock College >> MATH >> 101 Fall, 2009 Description: ) ! SO I0 ~0 0 ... Date Added: 2009-06-25 19:09:38 |
| Chapitre_9_TAO.pdf Path: Université du Québec à Montréal >> R >> 17165 Fall, 2009 Description: Chapitre 9 : 1 Chapitre 9 Le testing adaptatif Table des matires 9.0 9.1 9.2 9.3 Introduction Problmes de prcision et limites ladministration des tests papier crayon Testing adaptatif 9.2.1 Droulement dun test adaptatif Le testing adaptatif : une a... Date Added: 2009-06-25 19:09:48 |
| Assignment6.doc Path: Dallas >> EE >> 6331 Fall, 2008 Description: Assignment 6 due Feb. 28th 1. 2. 3. 4. 5. Problem 8.1 Problem 8.4 Problem 8.5. You do not have to find k. Problem 8.6. You do not have to find k Problem 8.7 ... Date Added: 2009-06-25 19:10:02 |
| 126.pdf Path: Pittsburgh >> AEI >> 2887 Fall, 2009 Description: ... Date Added: 2009-06-25 19:12:27 |
| hspice_basic.pdf Path: USC >> EE >> 577 Fall, 2009 Description: autumn 96/97 EE371 5. HSPICE Basics An input netlist file must be created to begin the design entry and simulation process. If you are just starting out, you might want to copy a demo file to your own directory and edit the netlist to create your o... Date Added: 2009-06-25 19:16:34 |
| 573syl.ps Path: Iowa State >> CS >> 573 Fall, 2009 Description: %!PS-Adobe-2.0 %Creator: dvips 5.519 Copyright 1986, 1993 Radical Eye Software %Title: 573syl.dvi %CreationDate: Sun Jan 13 21:10:11 2002 %Pages: 4 %PageOrder: Ascend %BoundingBox: 0 0 612 792 %EndComments %DVIPSCommandLine: dvips 573syl %DVIPSSource... Date Added: 2009-06-25 19:23:45 |
| Landcare.ppt.pdf Path: Allan Hancock College >> ENVS >> 1001 Fall, 2009 Description: Volunteers wanted Are you prepared to visit your old school during the mid year break and give a talk on Fenner School courses? We will pay you with USB drive that you can keep with a powerpoint presentation on it There will be a briefing session on ... Date Added: 2009-06-25 19:23:50 |
| Todo.txt Path: UC Davis >> PHYSICS >> 250 Fall, 2009 Description: * counter term : version which limits counter terms defined in model file. Older version is left with some options. * add version information to \"out.grf\" ... Date Added: 2009-06-25 19:25:00 |
| MATH100D01.TXT Path: Sveriges lantbruksuniversitet >> MATH >> 19993 Fall, 2009 Description: Sheet1 PROFILE OF STUDENTS IN SFU COURSES COURSE: MATH 100-3 D01 TITLE: PRECALCULUS SEMESTER: 1999-3 LOCATION: SFU SECTION TYPE: LEC ENROL: 172 = PROGRAM OF STUDENT (Top 5 programs reported in each category Programs with < 3 students not shown separ... Date Added: 2009-06-25 19:25:26 |
| 07.strings.pdf Path: Arkansas Little Rock >> CS >> 201 Fall, 2009 Description: C-strings Introduction Two string types: C-strings Array with base type char End of string marked with null, \ Older method inherited from C Uses templates Not look at now! Slide 2 Created by Frederick H. Colclough, Colorado Technical Univer... Date Added: 2009-06-25 19:25:28 |
| lecture9.pdf Path: Utah >> PHYS >> 6771 Fall, 2008 Description: Scintillators revisited Scintillators revisited (cont.) Outstanding features: Sensitivity to energy: above certain energy most scintillators behave in a near linear fashion to with respect to the energy deposited Fast time response: obtain timin... Date Added: 2009-06-25 19:32:39 |
| Economics_2006 04.pdf Path: Sveriges lantbruksuniversitet >> CMNS >> 230 Fall, 2009 Description: Economics of the Cultural Industries Examine changes in capitalism, and especially cultural economics over time Explore the nature of the cultural commodity Look at the nature of the cultural production process CMNS 230 1 Learning Objectives Ident... Date Added: 2009-06-25 19:38:40 |
| Online_music_e 2004.pdf Path: Sveriges lantbruksuniversitet >> CMNS >> 230 Fall, 2009 Description: The Challenges and Opportunities of Online Music: Technology Measures, Business Models, Stakeholder Impact and Emerging Trends Prepared for: Canadian Heritage March 31, 2004 Cathy Allison NOTE This study was funded by the Department of Canadian He... Date Added: 2009-06-25 19:38:47 |
| 0519-cware-ruthconviction.pdf Path: Allan Hancock College >> USA >> 1923 Fall, 2009 Description: Chris Ware: The Conviction of Ruthenberg at St. Joseph [May 19, 1923] 1 The Conviction of Ruthenberg at St. Joseph. by C.S. Ware Published in The Worker [New York], v. 6, whole no. 275 (May 19, 1923), pp. 1-2. At 10 minutes of 8 on Wednesday eveni... Date Added: 2009-06-25 19:41:32 |
| 23464.txt Path: UNC >> DOCS >> 23464 Fall, 2009 Description: The Project Gutenberg eBook, A Life of William Shakespeare, by Sidney Lee This eBook is for the use of anyone anywhere at no cost and with almost no restrictions whatsoever. You may copy it, give it away or re-use it under the terms of the Project... Date Added: 2009-06-25 19:43:26 |
| Task Schedule.pdf Path: Penn State >> CMP >> 234 Fall, 2009 Description: January Task Schedule Week 1: January 9- January 15, 2006 A. Set up a layout for the new columns and floor framing of the steel system. Determine where columns can be removed to save material and costs. B. Begin to set up a model of the building in R... Date Added: 2009-06-25 19:49:22 |
| lec1.pdf Path: TAMU Commerce >> PHYS >> 497 Fall, 2008 Description: What is the Universe? A medieval pilgrim peering through the sky as if it were a curtain to look at the inner workings of the universe. by Camille Flammarion, 1888 1 What is the composition of the Universe? Fluctuations in the microwave background... Date Added: 2009-06-25 19:51:22 |
| lect9.pdf Path: Caltech >> EE >> 162 Fall, 2009 Description: 9. Two Functions of Two Random Variables In the spirit of the previous lecture, let us look at an immediate generalization: Suppose X and Y are two random variables with joint p.d.f f XY ( x, y). Given two functions g ( x, y ) and h( x, y ), define t... Date Added: 2009-06-25 19:51:23 |
| types-abstraits.pdf Path: Université du Québec à Montréal >> INFO >> 3140 Fall, 2009 Description: y b b c u qibg qg c yc w b q q 0tgiitgteedsivtsrhth0h!bj%tegHtuvtfvs u qibg qg c s bwb e sg { qi gc usg e b qsi e qc e u s {eb s vtsrhth0f~bv0~vjYvetectrhfvcj0gcvfr@tefjf@v0vjfgHBvn q ciue c q e q ew u y c { H 1YjBjtjVh... Date Added: 2009-06-25 19:58:59 |
| Lesson14.pdf Path: UCCS >> CS >> 531 Fall, 2009 Description: CS 531 Software Requirements Analysis and Specification Fall 2004 Lesson 14, 12 Oct 2004 Requirements Traceability II Reading Gotel 94 Gotel 96 Talk About Mid-Term Finish Class Exercise from Last Time Establish Requirements Baseline Designate... Date Added: 2009-06-25 20:02:48 |
| A Rainforest Mystery.doc Path: Pima CC >> MKANE >> 1646 Fall, 2009 Description: A Rainforest Mystery A Compilation Task WebQuest about Rainforest Animals By Megan Kane Introduction | Task | Process | Resources | Evaluation | Conclusion Introduction The Rainforest Conservatory needs your help! Several of their scientists just ... Date Added: 2009-06-25 20:04:19 |
| docWG3ihlyfUH.doc Path: Sveriges lantbruksuniversitet >> CMNS >> 110 Fall, 2009 Description: SFUInternationalFilmForumpresents WATER 3:30pmat40ASSC10081 PresentedbySFUCommunicationstudentNidhi Panwar March20 ,2008 th FromthecourageousfilmmakerDeepaMehtacomesWATER,the profoundlymovingstoryofIndiaswidowhouses.Setin1938in BritishIndia,itisaco... Date Added: 2009-06-25 20:07:10 |
| docQDitMOhfms.doc Path: Sveriges lantbruksuniversitet >> CMNS >> 110 Fall, 2009 Description: SFUInternationalFilmForumpresents WATER 3:30pmat40ASSC10081 PresentedbySFUCommunicationstudentNidhi Panwar March20 ,2008 th FromthecourageousfilmmakerDeepaMehtacomesWATER,the profoundlymovingstoryofIndiaswidowhouses.Setin1938in BritishIndia,itisaco... Date Added: 2009-06-25 20:07:10 |
| IDS321_Mod_1_Colortheory.rtf Path: Academy of Art >> IDS >> 321 Fall, 2009 Description: * Please add this at the beginning of Module 1 the go to painter* Before we embark on anything digital we have to go back to basics. Color. Before you master painter, Photoshop CG rendering at the core of a great presentation are compelling images th... Date Added: 2009-06-25 20:08:55 |
| Chormarat_1997.pdf Path: Washington >> MICRO >> 553 Fall, 2009 Description: Carcinogenesis vol.18 no.11 pp.21792190, 1997 Distinct time courses of increase in cytochromes P450 1A2, 2A5 and glutathione S-transferases during the progressive hepatitis associated with Helicobacter hepaticus Pascale Chomarat1, Marek A.Sipowicz2... Date Added: 2009-06-25 20:09:41 |
| CS520_Lect_06_QoS_I_2004.pdf Path: UMKC >> CS >> 520 Fall, 2009 Description: CS 520: Network Architecture I Fall 2004 Lecture 6: QoS I This lecture provides discussion on mechanisms and research related to providing acceptable quality of service levels to IP datagrams. I. The Need for QoS Traffic Requirements As the Interne... Date Added: 2009-06-25 20:14:30 |
| Weiser.Slicing.TSE.pdf Path: Georgia Tech >> CS >> 6340 Fall, 2009 Description: 1 2 3 4 5 6 ... Date Added: 2009-06-25 20:15:19 |
| Mgt 2700 S05 Quiz 4 focus.doc Path: Laurentian >> MGT >> 200501 Fall, 2009 Description: Quiz 4 Focus Chapter 16 Sampling Probability vs. non-probability Reason for selection Summary (page 392-393) Chapter 17 Statistics and Sample Size Terms: Descriptive and Inferential stats Normal distribution (standardized) Estimations and hyp... Date Added: 2009-06-25 20:16:30 |
| HMM2.ppt Path: N.C. Central >> CISG >> 5203 Fall, 2009 Description: Algorithms in Computational Biology Profile HMMs for Sequence Families Department of Mathematics & Computer Science Algorithms in Computational Biology 1 Finding More Members for a Sequence Family Perform a database search for more members using... Date Added: 2009-06-25 20:23:31 |
| mid_fig.doc Path: Duke >> STA >> 240 Fall, 2008 Description: (A) (B) (C) 600 4000 100 80 400 Light Sleepers n = 22 Heavy Sleepers n = 20 3000 Light Sleepers n = 22 Heavy Sleepers n = 20 Maximum Life Span (years) Gestation Time (days) Brain Weight (grams) 60 Light Sleepers n = 22 Heavy Sleepers n ... Date Added: 2009-06-25 20:23:32 |
| patterns_lulv.pdf Path: CUNY Baruch >> GEOG >> 383 Fall, 2009 Description: ... Date Added: 2009-06-25 20:23:36 |
| Convergent%20margins.ppt Path: University of Hawaii - Hilo >> GG >> 399 Fall, 2009 Description: ... Date Added: 2009-06-25 20:27:42 |
| monportfoliol.ppt Path: UMass (Amherst) >> ECON >> 368 Fall, 2009 Description: The Monetary and Portfolio Balance Approaches to External Balance Monetary Approach to the Balance of Payments Emphasizes that the balance of payments are essentially a monetary phenomenon Important issues are the supply and demand for money Atte... Date Added: 2009-06-25 20:32:26 |
| Fire Safety.ppt Path: N. Georgia >> MEPOWE >> 3052 Fall, 2009 Description: By: Molly Powell Fire Is: Da ng e ro us Ho t Lo ud Da rk Where in your home do possible fire problems exist? Fire p la c e Kitc h e n Aro und e le c tric ity C a nd le s Ma tc h e s Be careful! What would you do if there was a fire in yo... Date Added: 2009-06-25 20:32:31 |
| pm_interviews.doc Path: Augsburg >> IE >> 5541 Fall, 2009 Description: Guidelines for Project Manager Interview Please note that these are guidelines and sample questions only. Use only the questions that seem appropriate, and feel free to add your own. Note: If the interviewee wants to remain anonymous, thats fine. If ... Date Added: 2009-06-25 20:35:24 |
| Assn04.doc Path: Evansville >> EE >> 411 Fall, 2009 Description: EE 411 Assignment 04 October 9, 2002 Due: October 18, 2002 1. From Chapter 6 Problems pp. 249-257: problems 2, 8, 19, 20, 21, and 24 ... Date Added: 2009-06-25 20:35:37 |
| 21891.txt Path: UNC >> DOCS >> 21891 Fall, 2009 Description: The Project Gutenberg EBook of The Brand of Silence, by Harrington Strong This eBook is for the use of anyone anywhere at no cost and with almost no restrictions whatsoever. You may copy it, give it away or re-use it under the terms of the Project ... Date Added: 2009-06-25 20:37:19 |
| 90B48433_007.pdf Path: Texas San Antonio >> BLK >> 1990 Fall, 2009 Description: 33.098792N 100.543170W Stinking Cr 1990 COUNTY BLOCK MAP (RECREATED): STONEWALL County 33.098792N 100.350402W LEGEND SYMBOL NAME STYLE INTERNATIONAL AIR C R 430 452* C R 434 C R 424 Trust Land TJSA / TDSA / ANVSA STATE (or statistically equiva... Date Added: 2009-06-25 20:37:59 |
| What is Math.ppt Path: SEMO >> UI >> 100 Fall, 2009 Description: What is Math? What is Art? Cheryl J. McAllister Fall 2008 UI100 What is a definition? A statement of the meaning of a word or group of words. (Merriam-Webster Dictionary, 1974) What is Mathematics? A body of knowledge centered on such concepts as q... Date Added: 2009-06-25 20:40:39 |
| 2005_wizards.ppt Path: Cal Poly Pomona >> DJO >> 04747 Fall, 2009 Description: TheWizardsChemistryDayatPomonaCollege HonoredGuests TeddyBearsandRainbowRoom(CUCCEarlyChildhoodCenter) PomonaSummerRec2005 July26,2005 PomonaCollegeChemistryDepartment TheWizardsChemistryDayatPomonaCollege TheWizards WendyIskenderian(04),CharlieHa... Date Added: 2009-06-25 20:48:28 |
| SAMPLE MULTIPLE CHOICE.doc Path: Minnesota >> ECON >> 1101 Fall, 2008 Description: FORMAT OF THE MIDTERM TIME : 90 MIN (09:15 ~ 10:45, FRIDAY, JUNE 25th) COMPOSITION OF THE EXAM (TENTATIVE) FINAL VERSION WILL BE ANNOUNCED ON WEDNESDAY (23rd) - MULTIPLE CHOICE : 25 QUESTIONS (75 points) - SHORT FORM : 4 QUESTIONS (50 points) - LONG... Date Added: 2009-06-25 20:54:26 |
| 01-RA_Positions_At_Seminis.doc Path: UC Davis >> ATT >> 0702 Fall, 2009 Description: Research Assistant I for New Trait Development Desired Hire Date: March, 2007 or as soon as possible thereafter We are seeking an enthusiastic person with the desire to be part of a dynamic team working to identify valuable traits in genetic resource... Date Added: 2009-06-25 20:59:28 |
| notes_ch7.pdf Path: San Jose State >> MS >> 118 Fall, 2009 Description: Chapter 7 Section 1 We will now look at trigonometry. We are going to put our angles in a coordinate system such that the vertex of the angle is at the origin and the initial side of the angle lies on the positive x-axis. This is called standard posi... Date Added: 2009-06-25 21:14:09 |
| 5.doc Path: CSU Northridge >> PMB >> 64311 Fall, 2009 Description: Name: June16,2005 (1) General Software Review. In this activity you will be reviewing software that you would find useful in your role as a teacher. Note, this is a review of software, not websites. Websites can be used only if they have a high leve... Date Added: 2009-06-25 21:16:31 |
| sp09-lw-s3.pdf Path: Georgia Tech >> ECE >> 2030 Fall, 2008 Description: ECE 2030 1:00pm 4 problems, 4 pages Problem 1 (3 parts, 30 points) Computer Engineering Exam Three Solutions Spring 2009 8 April 2009 Memory Systems Part A (12 points) Consider a DRAM chip organized as 4 million addresses of 64-bit words. Assume b... Date Added: 2009-06-25 21:18:44 |
| ESFig3.7.pdf Path: UCSC >> EART >> 150 Fall, 2008 Description: ... Date Added: 2009-06-25 21:23:11 |
| k124-ws5.fig1.ps Path: Washington >> MATH >> 124 Fall, 2008 Description: ... Date Added: 2009-06-25 21:26:34 |
| 124.figREa.ps Path: Washington >> K >> 124 Fall, 2009 Description: ... Date Added: 2009-06-25 21:26:54 |
| TOPIC 4.ppt Path: Texas El Paso >> PAD >> 5359 Fall, 2008 Description: THE LEGAL BASES OF PLANNING TOPICS KEY QUESTIONS POLICE POWER PLANNING HOW IS THE PUBLIC INTEREST BEING DEFINED? WHAT ARE THE LIMITS OF PLANNING? HYPOTHETICAL CASES TRANSBORDER PLANNING AND TH... Date Added: 2009-06-25 21:28:24 |
| Ch7answers.doc Path: N.E. Illinois >> MGT >> 3800 Fall, 2009 Description: Ch 7 answers 7.2 7.3 7.17 7.18 7.28 7.29 5 170 32.9 2700 22 47 44 Pearlsburg Case ... Date Added: 2009-06-25 21:29:18 |
| quiz5.pdf Path: Maryland >> PHYS >> 122 Fall, 2007 Description: ... Date Added: 2009-06-25 21:38:13 |
| hw01.doc Path: Rochester >> CHM >> 455 Fall, 2009 Description: U N I V E R S I T Y OF ROCHESTER DEPARTMENT OF CHEMISTRY CHM 455 W. Udo Schrder Due: 17 Sept. 2002 ThermodynamicsandStatisticalMechanics ProblemSet1 1. SimpleIterations a) Comparethetwosequencesofnumbers 1 2 ( x n + 1) 3 x 2 n 1 ( x n +... Date Added: 2009-06-25 21:39:07 |
| test4B.pdf Path: N.C. State >> MA >> 141 Fall, 2008 Description: MATH 141-008 Test 4 Version B (100 Points) Nov 21, 2005 Name: Answer the questions in the spaces provided on the question sheets. If you run out of room for an answer, continue on the back of the page. Underline the word circle if you are readin... Date Added: 2009-06-25 21:43:20 |
| Calculation of internal energy change.doc Path: Oakland University >> ME >> 463 Fall, 2009 Description: Calculation of internal energy change Room temperature 25 oC Specific heat of water, c = 4.186 J/g oC Density of tap water at room temp: 0.99823 g/ cm3 200 ml of water has the mass of m = 199.646 g Latent heat of vaporization: CL=2260 J/g Energy requ... Date Added: 2009-06-25 21:44:26 |
| Homework7Sol.pdf Path: UMass (Amherst) >> PHYS >> 2490 Fall, 2009 Description: (By +! LM ) oh- ] z x -L \\ bv-f CO-lAht 8\"t\' \'t\"t\" d m e - l (., - d ry\" -., . . . - f d P t &~ W L L - ... Date Added: 2009-06-25 21:45:28 |
| Breadth vs. Depth.ppt Path: Clayton >> ITSD >> 4312 Fall, 2009 Description: ITSD 4312 ITSD Advanced Programming II Breadth vs. Depth Searching Basics of Trees Basics Node consists of two parts Data (simple or keyed-complex) References (left/right or list of pointers) 42 42 Can degenerate into lists If no siblings exis... Date Added: 2009-06-25 21:46:58 |
| H of quality template.doc Path: Fayetteville State University >> EML >> 4550 Fall, 2009 Description: Example House of Quality Matrix (Mountaineering Climbing Harness) Dr. A. J. Lowe 2000 K m + - e y to r o o f / c o r r e la t io n a tr ix s y m b o ls P o s itiv e / S u p p o r t in g N e g a t iv e / T r a d e o ff + - + - + D IR E C T IO N ... Date Added: 2009-06-25 21:47:02 |
| quiz15.doc Path: CSU San Marcos >> PS >> 402 Fall, 2009 Description: POLITICAL SCIENCE 402 Spring 1997 Dr. Nichols QUIZ #15 Caldeira examined numerous factors, looking at whether or not they affected public support for the Supreme Court. Please name any one of these factors. ... Date Added: 2009-06-25 21:48:30 |
| quiz7.doc Path: CSU San Marcos >> PS >> 401 Fall, 2009 Description: POLITICAL SCIENCE 401 FALL 1996 DR. NICHOLS QUIZ #6 Kelley devotes an entire chapter (chapter 3) to discussion of three tests of decisiveness of electoral victory margins. Name and briefly describe any one of the three. ... Date Added: 2009-06-25 21:48:42 |
| quizzes_Quiz_5.pdf Path: Washington >> CHEM >> 239 Fall, 2008 Description: Chem 239B Spring, 2008 Quiz #5 Prof. Sasaki _ 1. When 2,4,6-trinitroanisole is treated with sodium ethoxide, a product of formula C9H10O8N3-Na+ is formed. A product of the same formula is formed by the treatment of trinitrophenetole with sodium metho... Date Added: 2009-06-25 21:49:11 |
| CL_KeepingTheCommitment.ppt Path: Dallas >> SXK >> 038200 Fall, 2009 Description: KeepingtheCommitment (TheSuccessfulClubSeries) Srividya Kona CL Speech # 1 June14,2006 June14,2006 1 I promise to participate by attending regularly carefully preparing speeches fulfilling all assignments June14,2006 June14,2006 2 I promise... Date Added: 2009-06-25 21:49:12 |
| hardness.txt Path: Berkeley >> ASTRO >> 00207281 Fall, 2009 Description: # t1 t2 hardness error 0.13918100 0.14004300 -0.035314446 0.19082569 0.14004300 0.14074200 -0.11111111 0.19125843 0.14074200 0.14166600 -0.11111111 0.19125844 0.14166600 0.14234000... Date Added: 2009-06-25 21:59:41 |
| Word Chapter 3.pptx Path: NYIT >> WORD >> 101 Fall, 2009 Description: Microsoft Office 2007 Word Chapter 3 Creating a Cover Letter and a Resume Objectives Format characters and paragraphs Insert and format clip art Set and use tab stops Identify the components of a business letter Insert the current date Create and... Date Added: 2009-06-25 22:01:00 |
| 272ch22b.pdf Path: University of Hawaii - Hilo >> CH >> 272 Fall, 2009 Description: ... Date Added: 2009-06-25 22:04:01 |
| written.pdf Path: UF >> MIL >> 5666 Fall, 2009 Description: University of Florida Department of ECE 8/28/03 EEL 5666: Intelligent Machines Design Laboratory A. Antonio Arroyo Assoc. Professor ECE Guidelines for Written Reports Written reports in this class will be evaluated on the basis of the following gu... Date Added: 2009-06-25 22:05:27 |
| syllabus.pdf Path: UF >> MIL >> 5666 Fall, 2009 Description: University of Florida Department of ECE 8/25/08 EEL 5666: Intelligent Machines Design Laboratory A. Antonio Arroyo, PhD Eric M. Schwartz, PhD University of Florida Department of Electrical and Computer Engineering Fall Semester 2008 EEL 5666: INTE... Date Added: 2009-06-25 22:05:31 |
| teksobjective.doc Path: U. Houston >> CUIN >> 3111 Fall, 2008 Description: 110.41. Implementation of Texas Essential Knowledge and Skills for English Language Arts and Reading, High School. 110.43. English II (One Credit). (15) Listening/speaking/evaluation. The student listens to analyze, appreciate, and evaluate oral perf... Date Added: 2009-06-25 22:06:23 |
| hw10.pdf Path: Utah >> MATH >> 3900 Fall, 2008 Description: MATH 3900, Spring 2009 Homework 10 Due 04/10/09 1. Finish example that we considered in class: a protein can bind in any given second with probability 0.7. You are observing it for 5 seconds and record the total number of proteins bound. Find the (bi... Date Added: 2009-06-25 22:10:09 |
| YDL060W.t2k.w0.5-logo.pdf Path: UCSC >> YDL >> 060 Fall, 2009 Description: YDL060W.t2k w0.5 5 4 3 2 1 L V M XXX E G L X XXXX K R S R S X XX L K K K R X XXXXXXXX Q R N E H E K K K A R K X X XXXXXXXX S A K L E L K R K A X XXXXXXX K N K K G V K A X XXXXXXXXXXX K L R V L N Q K A A S 1 10 20 ... Date Added: 2009-06-25 22:11:48 |
| YDL054C.t2k.dssp-ehl2-logo.pdf Path: UCSC >> YDL >> 054 Fall, 2009 Description: YDL054C.t2k DSSP-EHL2 2 1 CC 1 H C C C C C C C C H C C H H H H H H H H H H C H C C C C C C H C C H C C C C C X X X X X X X X X X X X X X X X X X X X X X X X CCCCC CCCCCCCCCCC X X X X X X X X H X X X X X HH X X 10 20 30 40 H 2 1 HHH 51 ... Date Added: 2009-06-25 22:11:55 |
| YDL037C.t2k.CB_burial_14_7-logo.pdf Path: UCSC >> YDL >> 037 Fall, 2009 Description: YDL037C.t2k CB_BURIAL_14_7 2 1 AAA X AB B BBBBAXAA 1 A B B B D F B C CECF B E B D E CDDCC C C D D D D G EGDB G D C D B D E C F CCCCACCBAFDEXXFBDDDDCXXCXEXXXXDDXXBDCCDXEFXDXXEED D D D D CCCXXEDXXEEEDXXX A D D D A C D D A A G C E D D X X X X X X X X... Date Added: 2009-06-25 22:12:43 |
| L05Algorithms2.ppt Path: UMBC >> PUB >> 104 Fall, 2009 Description: Algorithms, Part 2 of 3 Topics Problem Solving Examples Pseudocode Control Structures Reading Section 3.1 CMSC 104, Version 8/06 L05Algorithms2.ppt Problem Solving Decode this sentence: Pdeo eo pda yknnayp wjosan. We have just come up with a... Date Added: 2009-06-25 22:14:28 |
| L05Algorithms2.ppt Path: UMBC >> PUB >> 104 Fall, 2009 Description: Algorithms, Part 2 of 3 Topics Problem Solving Examples Pseudocode Control Structures Reading Section 3.3 - 3.10 (dont worry about understanding the C code, just the pseudocode) Problem Solving Decode this sentence: Pdeoeopdayknnaypwjosan. ... Date Added: 2009-06-25 22:15:25 |
| tos06.pdf Path: Auburn >> XZQ >> 0001 Fall, 2009 Description: Modeling and Improving Security of a Local Disk System for Write-Intensive Workloads Mais Nijim Xiao Qin* Department of Computer Science New Mexico Institute of Mining and Technology Socorro, New Mexico 87801 {mais, xqin}@cs.nmt.edu Tao Xie Departmen... Date Added: 2009-06-25 22:20:02 |
| YKL197C.t2k.stride-ebghtl-logo.pdf Path: UCSC >> YKL >> 197 Fall, 2009 Description: YKL197C.t2k EBGHTL 3 2 1 C C TH H X X 1 10 20 30 40 H 3 2 1 H E X X X E T C TCTTCCTTCETECCCCECCCCTCC T T T T T C T T E T T C C C E C C C T C C C C HHHHHXXXXXXXXXTHHTTT C T T C E T E C T H T E E E E T T E E H H X X X X X X X X X X X X X X... Date Added: 2009-06-25 22:21:09 |
| YKL176C.t2k.w0.5-logo.pdf Path: UCSC >> YKL >> 176 Fall, 2009 Description: YKL176C.t2k w0.5 2 1 M L V I A I V 1 10 20 30 40 H 2 1 LD E I V T T T E T H I I I I P EML PPLLDHL DDL L LFG RDLPY RPLD L V VE V V V V XXXXXXXXX XXXXXXXX XXXXXXXXXXXXXXXXXXX XXX XXXXXX A N I I L L K X L V I S I V T T S S XX H E I V... Date Added: 2009-06-25 22:21:37 |
| CST605_L1.pdf Path: East Los Angeles College >> CST >> 605 Fall, 2009 Description: CST605 Computer Architecture and Performance Lecturer David Lancaster Email: lancasd@westminster.ac.uk Office: A2.1 Admin Prerequisite: 2COS201 Some C and Java programming Marks 40% Coursework 2 equally weighted reports based on analysing meas... Date Added: 2009-06-25 22:26:49 |
| l3class-norm-44072.ps Path: Stanford >> MEETING >> 040127 Fall, 2009 Description: %!PS-Adobe-2.0 %Title: l3class-norm-44072.ps (Portrait A 4) %Pages: (atend) %Creator: HIGZ Version 1.26/04 %CreationDate: 2004/01/26 01.22 %EndComments %BeginProlog /s {stroke} def /l {lineto} def /m {moveto} def /t {translate} def /sw {stringwidth} ... Date Added: 2009-06-25 22:27:37 |
| dtsfcal-stack-49944.ps Path: Stanford >> MEETING >> 040713 Fall, 2009 Description: %!PS-Adobe-2.0 %Title: dtsfcal-stack-49944.ps (Portrait A 4) %Pages: (atend) %Creator: HIGZ Version 1.26/04 %CreationDate: 2004/07/10 10.05 %EndComments %BeginProlog /s {stroke} def /l {lineto} def /m {moveto} def /t {translate} def /sw {stringwidth}... Date Added: 2009-06-25 22:27:45 |
| bio435 08 week 6 day 1.doc Path: UCCS >> BIO >> 435 Fall, 2009 Description: BIO 435/535, Fall 2008: Week Six, Day One Thought for the day: He who is skilled at making excuses rarely excels at anything else. 1. Exams 2. The Ankle and Foot a. The Ankle Joint = uniaxial hinge, tibiofibular and tibiotalar A.k.a. talocrural ... Date Added: 2009-06-25 22:28:28 |
| 18_Loop_Invariant.ppt Path: UNC >> COMP >> 114 Fall, 2005 Description: Loop Invariant COMP 114 Thursday March 7 Lastra, 2001 Slide 1 Announcements Program 3 Lastra, 2001 Slide 2 Loop Invariant An assertion In a loop Changes meaning every iteration Lastra, 2001 Slide 3 Example Assert.pre( true ); i = 0; whil... Date Added: 2009-06-25 22:30:44 |
| GalaxyMorphology.pdf Path: S.F. State >> ASTRO >> 410 Fall, 2008 Description: Galaxies an d Cosmology Astronomy 410 Galaxies Galaxy Morphology an d Classication Galaxy Structure: distribution of light Galaxy Dynamics: motions -> distribution of mass Stellar Populations: constituents of galaxies Galaxies Galaxy Morphology an ... Date Added: 2009-06-25 22:34:10 |
| Literary analysis of myth.pdf Path: Mt. SAC >> LIT >> 36083 Fall, 2009 Description: Professor Jean Garrett Spring 2009 THE LITERARY ANALYSIS APPROACH Use of Greek Mythology In Poetry Auden, W.H. Musee des Beaux Art Ode to Gaea Venus Will Now Say a Few Words Blake, William To the Muses Why Was Cupid a Boy Browning, Robert Apollo and ... Date Added: 2009-06-25 22:36:52 |
| ee210_fa06_MID_SPEC.pdf Path: Bergen CC >> EE >> 210 Fall, 2009 Description: Version 10/5/06 EECS 210 Fall 2006 Tu, Th 12:30-2 400 Cory Applied Electromagnetic Theory Office Hours M, (W), 11AM Tu, Th, (F) 10AM Prof. A. R. Neureuther, 509 Cory Hall, 2-4590 neureuth@eecs Exam Midterm Specification Sheet Midterm In Class Tues... Date Added: 2009-06-25 22:37:04 |
| lecture13-Faradays Law and Curl.pdf Path: U. Houston >> ECE >> 2317 Fall, 2008 Description: ECE 2317: Applied Electricity and Magnetism Fall 2008 Prof. Jeffery T. Williams Dept. of Electrical & Computer Engineering University of Houston. Faradays Law and Curl Notes prepared by the EM group, Michael Faraday, 1791-1867 University of Houston... Date Added: 2009-06-25 22:42:27 |
| lecture9 sup - Examples of Gauss Law.pdf Path: U. Houston >> ECE >> 2317 Fall, 2008 Description: ECE 2317: Applied Electricity and Magnetism Fall 2008 Prof. Jeffery T. Williams Dept. of Electrical & Computer Engineering University of Houston Examples of Gauss Law Notes prepared by the EM group, University of Houston. Example Example z Find E ... Date Added: 2009-06-25 22:42:29 |
| npcdhc.pdf.pdf Path: UCSB >> CS >> 230 Fall, 2009 Description: h v u t 6 @ 9 V 69 Y A 8 6 V S V c 69 4 D 0 a 6 V S ` @ 678 ( 8 7 A 45 R 69 X 5 b 9 AS 69 Y S 8 Y X C 6 ! S b P 678 D 6 C 7 R P A 7 A 45 y B 6 9 I H 8 @... Date Added: 2009-06-25 22:45:21 |
| Study-Guide_1.doc Path: IPFW >> CHEM >> 104 Fall, 2009 Description: Quiz 1 Study Guide Chemistry 104 Spring, 2006 IPFW A HYPOTHESIS is a tentative explanation for a set of observations. Law: A concise verbal or mathematical statement of a relationship(s)among phenomena which are always identical when observed under t... Date Added: 2009-06-25 22:47:02 |
| Hwk_3.doc Path: IPFW >> CHEM >> 104 Fall, 2009 Description: ... Date Added: 2009-06-25 22:47:04 |
| Hwk_6.doc Path: IPFW >> CHEM >> 104 Fall, 2009 Description: ... Date Added: 2009-06-25 22:47:05 |
| lec-01.pdf Path: W. Alabama >> ECE >> 427 Fall, 2009 Description: E&CE 427 Digital Systems Engineering Mark Aagaard Dept of Electrical and Computer Engineering University of Waterloo 2002t3 Fall Credits Sources of information and images for this presentation: Carl Seger, Robert Jones, and others at Intel Don Lin... Date Added: 2009-06-25 22:52:41 |
| proj2nofig.pdf Path: Duke >> X >> 140 Fall, 2009 Description: ... Date Added: 2009-06-25 23:04:25 |
| lambdaperl2.txt Path: Allan Hancock College >> CSC >> 123 Fall, 2009 Description: #!/bin/perl # Perl meets lambda calculus # Chuck Liang, for CSC123/252, Hofstra University Computer Science, # If you\'re an experienced programmer, learning enough about perl to # understand this document should be a day or two\'s work, maybe less.... Date Added: 2009-06-25 23:06:32 |
| syllabus041.pdf Path: Toledo >> EECS >> 4980 Fall, 2008 Description: Syllabus EECS 4980:001 Special Topics: Java Spring 2004 Catalog Description: 3 hours. Prerequisite: EECS 1530 or equivalent. This course will cover the Java programming language and the virtual machine model under which it operates. The course will c... Date Added: 2009-06-25 23:07:17 |
| handout_5.pdf Path: Minnesota >> SW >> 5095 Fall, 2009 Description: DEFINING RESEARCH EVIDENCE STUDENT HANDOUT 5 Evidence-Based Practices and Evidence-Based Programs Distinct from the process of evidence-based practice is a group of interventions referred to as evidence-based practices or evidence-based interventions... Date Added: 2009-06-25 23:09:36 |
| lecture 10.doc Path: GCSU >> MATH >> 5600 Fall, 2008 Description: 32 More Examples Example 1 Suppose that X has the pdf 1 0 x 2 f ( x) = 2 0 elsewhere Find the cdf F ( x) Example 2 In a sedimentation experiment, the size of particles studied are uniformly distributed between 0.1 and 0.5 millimeters. What propo... Date Added: 2009-06-25 23:09:47 |
| Assignment 2.txt Path: FIU >> KDANS >> 001 Fall, 2009 Description: Kristen Day HFT 6555 Miwa Lock AL5H The Miwa Lock Company has introduced a dual technology lock. This lock is a combination of magnetic strip readers and smart card technologies. With the new Miwa AL5H lock, programming is achieved by an infra... Date Added: 2009-06-25 23:12:15 |
| ReadMe.txt Path: Benjamin Franklin Institute of Technology >> ECE >> 2552 Fall, 2009 Description: = APPLICATION : Lanes Project Overview = AppWizard has created this Lanes Application for you. This file contains a summary of what you will find in each of the files that make up your Lanes application. Lanes.vcproj This is the main pro... Date Added: 2009-06-25 23:13:05 |
| LegislativeProject.doc Path: CSU Northridge >> HCHSC >> 517 Fall, 2009 Description: PPH-514 Economic Concepts Applied to Healthcare Legislative Analysis Project Groups of no more then two students will be formed. Each group will investigate a current piece of Federal of State legislation (or a law that is no more the 5 years old). L... Date Added: 2009-06-25 23:16:01 |
| 57LectureOnSolarSystem.pdf Path: CSU Chico >> GEOS >> 142 Fall, 2009 Description: Lecture Notes: Comets, Falling Stars and the Origin of the Solar System 2002 Ann Bykerk-Kauffman, Dept. of Geological and Environmental Sciences, California State University, Chico* A. What is a comet? 1. When it is far from the sun, a comet is a.... Date Added: 2009-06-25 23:16:16 |
| HiSEECTouchCirc.doc Path: Utah >> ECE >> 2260 Fall, 2008 Description: Op-Amp Touch Sensor ... Date Added: 2009-06-25 23:18:12 |
| arf_pc.txt Path: Berkeley >> ASTRO >> 00223217 Fall, 2009 Description: ;instrument XRT ;exposure 122845.71 ;xunit kev ;bintype counts 0.0000000 0.0049999999 13.966075 1.00000 0.0049999999 0.0099999998 14.015903 1.00000 0.0099999998 0.015000000 14.065731 1.0... Date Added: 2009-06-25 23:22:12 |
| hwsol1.pdf Path: Michigan >> PERSONAL >> 303 Fall, 2009 Description: Philosophy 303 Symbolic Logic Winter, 2009 Solutions to Homework Assignment 1 1. Chapter 2, Exercise 2, Parts b), e) and f). b) (x + 2)2 = x2 + 4x + 4 e) If John gave some money to x and Mary gave some money to y (with x = y ) then y may not have w... Date Added: 2009-06-25 23:23:47 |
| Paitsel Homework #2.doc Path: UNC >> HW >> 111 Fall, 2009 Description: EdPaitsel 01/27/06 Problem1: Homework#2 a)Followsthepathofleastresistance. Totalresistance=R b)Cubeofresistors R/R/R+R/R/R/R/R/R+/R/R/R Totalresistance=(1/3+1/6+1/3)R=(5/6)R Problem2: c)TheveninResistance=(2R)(2R)/(2R+2R)=R SetVx=0 Vout1=(Vin)(R)/2... Date Added: 2009-06-25 23:25:22 |
| nancy-hw2.doc Path: UNC >> HW >> 111 Fall, 2009 Description: Nancy Du BMME111 HW2 January 31, 2006 Problem 1 a) All in parallel, 1 1113 =+= Req R R R R Req = R 3 b) Req = (R/3) + (R/6) + (R/3) = R(1/3 + 1/6 + 1/3) = 5R/6 Problem 2 c) VR2 = 2R 2R 2 Vin = Vin = Vin = VTH R + 2R 3R 3 R 2R 2R 2 2 8 RTH = (R... Date Added: 2009-06-25 23:25:24 |
| Lecture4of7_04182007_Notes.pdf Path: Acton School of Business >> PHYS >> 102 Fall, 2008 Description: AC Circuits 0.1 Inductors in an AC circuit Time Varying Voltages and Inductors slide 1 Consider an inductor (L) connected in series with an alternating voltage (VP sin t) as shown below. Lets calculate the current through the inductor: V (t) = L... Date Added: 2009-06-25 23:26:08 |
| chapt08.ppt Path: Macon State >> CHEM >> 1211 Fall, 2009 Description: vti_encoding:SR|utf8-nl vti_timelastmodified:TR|02 Sep 2004 19:44:58 -0000 vti_extenderversion:SR|6.0.2.6551 vti_backlinkinfo:VX|chem1211_2.htm ... Date Added: 2009-06-25 23:27:39 |
| 14-text.pdf Path: Rutgers >> PHYSICS >> 397 Fall, 2009 Description: Some Physics around the Home Wednesday March 29, 2006 Continuing on with heating and insulation. Heat is transferred through radiation, conduction, and convection. The total power radiated by a warm object is given by P = A(T4-Ts4), where T is the te... Date Added: 2009-06-25 23:29:09 |
| YJL208C.t2k.dssp-ehl2-logo.pdf Path: UCSC >> YJL >> 208 Fall, 2009 Description: YJL208C.t2k DSSP-EHL2 2 1 C C C C C C C H H H H X X X X X X X X X X X X X X X 1 10 20 30 40 G 2 1 C C C C C C H H H X X X X X X X X X T EH S 51 60 70 80 90 T 2 1 HH C X X X H T E T GT E H T 2 1 HGH HG HT T T E T H HH... Date Added: 2009-06-25 23:31:04 |
| MEW 1031 water intermolecular forces 2.pdf Path: Colorado >> CHEM >> 1031 Fall, 2008 Description: Water, intermolecular forces and the properties of solutions 2 LIKE DISSOLVES LIKE Substances with similar types of intermolecular forces dissolve in each other. When a solute dissolves in a solvent, solute-solute interactions and solventsolvent in... Date Added: 2009-06-25 23:39:58 |
| Box_Plot_story.pdf Path: Delaware >> GEOG >> 677 Fall, 2008 Description: A Box Plot Story and a Resampling Story Cort J. Willmott Center for Climatic Research Department of Geography University of Delaware Newark, DE 19716 Spatial/Geographic Interpolation estimation f r o m a set of observations associated with a set of ... Date Added: 2009-06-25 23:41:30 |
| Section1.pdf Path: Buffalo State >> MAT >> 161 Fall, 2009 Description: ... Date Added: 2009-06-25 23:47:59 |
| 02-JustificationAndFeasibility.doc Path: Scranton >> CS >> 490 Fall, 2009 Description: WUSR Music Library Inventory System Justification and Feasibility Michael Scaramastro Faculty Advisor Dr. Yaodong Bi September 7, 2007 Submitted in partial fulfillment of the requirements of CMPS 490 Computer Projects WUSR Music Library Inventory S... Date Added: 2009-06-25 23:52:47 |
| ExamplePoster1.pdf Path: Toledo >> CHM >> 346 Fall, 2009 Description: Nitrogen Heterocycles: From Natural Product Inspired Methods to Peptide-Heterocycle Conjugates Robert Batey, Julia Gavrilyuk, Ghotas Evindar, David Powell Department of Chemistry University of Toronto 80 St. George Street Toronto, Ontario, M5S 3H6 CA... Date Added: 2009-06-25 23:57:12 |
| finalsols04.pdf Path: Oklahoma State >> FP >> 5263 Fall, 2009 Description: ... Date Added: 2009-06-25 23:57:26 |
| trialexam2005.pdf Path: Allan Hancock College >> COMP >> 170 Fall, 2009 Description: comp170/570 UNIX/Linux Programming Environment Trial Exam 2nd semester 2005 Marks total 60 Time allowed: 2 hours. Calculators are not allowed. No notes. 1 Question 1. (6+3=9 marks) a) Explain what each of these UNIX commands do: i) ls a1*.* ii) gre... Date Added: 2009-06-25 23:57:26 |
| swb_timeinfo0.txt Path: Berkeley >> ASTRO >> 00332931 Fall, 2009 Description: #file=swbz_15-350lc.txt dt=1.9 tstart=-48.430 tstop=156.770 #t90 dt90 t50 dt50 rt90 drt90 rt50 drt50 rt45 drt45 tav dtav tmax dtmax trise dtrise tfall dtfall cts cts_err pk_rate dpk_rate band 159.600 16.357 68.400 10.086 79.800 ... Date Added: 2009-06-25 23:59:02 |
| hw1.pdf Path: Iowa State >> CS >> 531 Fall, 2009 Description: sVC i HVV p VCU AHV iVrH dC dV A9 S fHc pCVV dV V fC F a9 S S f d9 V i9U AC BWBow7`rB73DSh77BWB(CDdE`WDUBeS7GVw7`vg`rTcBDSGAgB~ 7DV%G9qDBv`%WYVEg s d9 dc9p F f V HC dV SHC dc9p S fc9 S c9p| Fc d A9H dC a9 d HVU HV DBvW%B0THBTCgxjBeS`vYBW%B... Date Added: 2009-06-26 00:02:18 |
| StudyGuide1.pdf Path: Glendale Community College >> AST >> 112 Fall, 2008 Description: The Cosmic Perspective Chapter 1 Study Guide Vocabulary (Be sure you are comfortable with the following terms.) star moon asteroid Solar System Milky Way Galaxy Local Group supercluster of galaxies Astronomical Unit rotation planet satellite comet pl... Date Added: 2009-06-26 00:07:03 |
| Cattell.pdf Path: East Los Angeles College >> OPEN >> 1912 Fall, 2009 Description: Development of an Integrated Governance Strategy for the Voluntary and Community Sector The Foundation for Good Governance St Marys Centre Oystershell Lane Newcastle upon Tyne NE4 5QS T: 0191 2332 6942 The Foundation for Good Governance St Marys Cen... Date Added: 2009-06-26 00:09:03 |
| kanzi.pdf Path: Occidental >> CS >> 101 Fall, 2009 Description: ... Date Added: 2009-06-26 00:13:59 |
| Compliance-matrix-DUrso.pdf Path: University of Illinois, Urbana Champaign >> AE >> 441 Fall, 2008 Description: ... Date Added: 2009-06-26 00:14:33 |
| sole3.pdf Path: Colorado >> AMATH >> 3570 Fall, 2009 Description: ... Date Added: 2009-06-26 00:15:45 |
| ThePaleolithic.pdf Path: Alabama >> ANT >> 100 Fall, 2008 Description: 10/7/2007 The Evolution of Material Culture The Paleolithic The Paleolithic Timeline Basal 2.5 Paleolithic tools to 1.8 mya Oldowan Chopper Mostly cores and flakes unifacial Percussion flaking The Paleolithic Timeline Lower 1.5 Paleo... Date Added: 2009-06-26 00:18:02 |
| cl2_ba.pdf Path: Fayetteville State University >> CHAP >> 5226 Fall, 2009 Description: Figure 2-2. Effect of strain rate and temperature on stressstrain curves. 4 ... Date Added: 2009-06-26 00:21:35 |
|
|
Get Started With Course Hero Today!
Get study guides, join study groups, and more!
Sign up in seconds with your Facebook account!
Course Hero is a Facebook Application Partner.
Click below to sign-up for FREE.
Our Social Learning Network was built to provide students and key learning partners like professors a platform to share, meet and collaborate while accelerating their comprehension of course-related theories and concepts. We are committed to providing you immediate access to a growing wealth of study materials and an unparalleled academic network of students, professors and other key partners. Why do you care? Because you want the best grade possible and at times need a 24/7 resource that’s responsive to your needs. |
|
What People Are Saying About Course Hero
|
|||
|
|||
|
Explore the benefits of joining Course Hero's social learning network.
|
|||
 |
Get millions of study materials now!Need lecture notes for a missed class or want insightful explanation of the theories and concepts you learn in class? Look no further, Course Hero’s Study Materials empowers you to find a broad and deep set of materials that can help you right now!
Click below to sign-up for FREE.
|
||
 |
Get over 200,000 textbook solutions now!Having difficulty with your homework and need documents that are relevant for your Textbook? Don't be frustrated. Course Hero's Textbook Help presents you study materials from many college courses.
Click below to sign-up for FREE.
|
||
 |
Meet over 300,000 students and your fellow classmates now!Want to meet your current classmates or those that took the class last year? Don’t worry or have anxiety. Course Hero’s Study Groups gives you the seamless opportunity to develop both anonymous or direct relationships with those classmates whom you want to meet and get help from right now!
Click below to sign-up for FREE.
|
||
