Course Solutions And Notes - n190 19
| hastyreview.pdf Path: Texas >> CH >> 391 Fall, 2008 Description: insight review articles Engineered gene circuits Jeff Hasty*, David McMillen & J. J. Collins *Department of Bioengineering, University of California San Diego, La Jolla, California 92093, USA (e-mail: hasty@ucsd.edu) Center for BioDynamics and Depar... Date Added: 2009-06-12 21:27:31 |
| Networkmotifcomment1.pdf Path: Texas >> CH >> 391 Fall, 2008 Description: Comment on \"Network Motifs: Simple Building Blocks of Complex Networks\" and \"Superfamilies of Evolved and Designed Networks\" Yael Artzy-Randrup, et al. Science 305, 1107c (2004); DOI: 10.1126/science.1099334 The following resources related to this ar... Date Added: 2009-06-12 21:27:32 |
| Week6_Lec2.pdf Path: CSU Channel Islands >> M >> 280 Fall, 2009 Description: A Martin Zeman, L TEX by May Mei Math 280A Lecture Notes Entertainment 1.57. Starting from a natural number m, we define a sequence mk : k N . We describe the method on the example where m = 29. We let m0 = 29. To define m1 , we first express m0 i... Date Added: 2009-06-12 21:27:39 |
| F02L11_IOS.ppt Path: Oregon State >> BA >> 370 Fall, 2008 Description: Announcements Interorganizational Systems Chapter 11 What is an IOS? Systems shared by two or more organizations to transfer data electronically Examples? Two types of markets Vertical Extended supply chain. Output from one business is inp... Date Added: 2009-06-12 21:30:18 |
| capitaland.pdf Path: N.E. Illinois >> ENG >> 448 Fall, 2009 Description: ... Date Added: 2009-06-12 21:31:05 |
| p37.pdf Path: Fayetteville State University >> PHY >> 2054 Fall, 2009 Description: Problem 37 The unit on the AM dial is kHz, so its 940 means 940 kHz; the unit on the FM dial is MHz, so the 94 on it means 94 MHz. Obviously the later is higher frequency, thus it has a shorter wavelength. Since c=f, we have 1 f 2 94 MHz = = = 100 ... Date Added: 2009-06-12 21:33:10 |
| M2.ps Path: Sveriges lantbruksuniversitet >> CS >> 307 Fall, 2009 Description: %!PS-Adobe-2.0 %Creator: dvips(k) 5.90a Copyright 2002 Radical Eye Software %Title: practice.dvi %Pages: 2 %PageOrder: Ascend %BoundingBox: 0 0 612 792 %DocumentFonts: CMR17 CMR12 CMBX12 CMTI12 CMMI12 %EndComments %DVIPSWebPage: (www.radicaleye.com) ... Date Added: 2009-06-12 21:33:39 |
| 090126 - Chapter #4_1 - Phase Matching.pdf Path: UCF >> OSE >> 6334 Spring, 2008 Description: Problem 3-3 The question comes up whether the SVEA gives the same result as the exact solution of the differential equation for SHG. Use the scalar (co-polarized case in the cw limit with no depletion. Exact solutions for plane waves are relatively e... Date Added: 2009-06-12 21:36:47 |
| z,t,chi, and F tables.xls Path: Ohio State >> SOC >> 549 Fall, 2009 Description: z (standard normal) and t table t Confidence 0% 10% 20% 30% 40% 50% 60% 70% 80% 85% 90% 91% 92% 93% 94% 95% 96% 97% 98% 99% 99.9% z 0.00 0.13 0.25 0.39 0.52 0.67 0.84 1.04 1.28 1.44 1.64 1.70 1.75 1.81 1.88 1.96 2.05 2.17 2.33 2.58 3.29 100 0.00 0.1... Date Added: 2009-06-12 21:37:06 |
| RR_TutorialBUC1.doc Path: CSU Fullerton >> SYS >> 366 Fall, 2009 Description: SYS366 Rational\'s Rose Tutorial 1: Working with the USE CASE VIEW Business Use Case Diagrams (BUC) Page 1 of 4 This tutorial introduces you to the Rational Rose software. You will go through an exercise to draw a Business Use Case diagram as well... Date Added: 2009-06-12 21:37:32 |
| presentations.ppt Path: Berkeley >> CS >> 160 Fall, 1931 Description: vti_encoding:SR|utf8-nl vti_timelastmodified:TR|19 Oct 2000 20:48:22 -0000 vti_extenderversion:SR|4.0.2.4022 vti_filesize:IR|91648 vti_title:SR|Introduction vti_assignedto:SR| vti_approvallevel:SR| vti_backlinkinfo:VX|lectures/index.html vti_cacheddt... Date Added: 2009-06-12 21:38:04 |
| Rifle-shot typeset.pdf Path: Penn State >> ACCTG >> 550 Fall, 2009 Description: Smeal College of Business Pennsylvania State University Taxation and Management Decisions: ACCTG 550 Professor Huddart Rie-Shot Tax Break The amendments made by this subtitle shall not apply to any liquidation (or deemed liquidation under section 3... Date Added: 2009-06-12 21:38:19 |
| tj.1000m.2006081500.txt Path: U. Houston >> SERVER >> 2006081500 Fall, 2009 Description: 2 REAL 6 8 14 12 0 REAL 6 8 14 12 0 12BACKWARDOMEGA 6 8 15 0 29.696 -95.499 1000.0 6 8 15 0 29.670 -95.129 1000.0 6 8 15 0 30.039 -94.075 10... Date Added: 2009-06-12 21:41:10 |
| chap8.pdf Path: Southern Oregon >> P >> 5013 Fall, 2009 Description: Chapter 8 Summation Techniques, Pad Approximants, and e Continued Fractions 8.1 Accelerated Convergence 1 1 1 1 1 1 + - + - . = (-1)n+1 = ln 2, 2 3 4 5 6 n n=1 Conditionally convergent series, such as 1- (8.1) converge very slowly. The same is tr... Date Added: 2009-06-12 21:41:31 |
| ACSL Lesson 1.pdf Path: Purdue >> EE >> 595 Fall, 2009 Description: EE595S Notes - ACSL Fall 2005 Largely Taken w/o Permission From ESAC ACSL Course Section 2: Running ACSL Programs Keith Corzine Energy Systems Analysis Consortium 7/7/98 - 7/10/98 Example 1: DC/DC Converter 1 Average-Value Model Switching Circuit ... Date Added: 2009-06-12 21:41:55 |
| depression.txt Path: Carnegie Mellon >> CMU >> 315 Fall, 2009 Description: \"SEQN\" \"DPQ010\" \"DPQ020\" \"DPQ030\" \"DPQ040\" \"DPQ050\" \"DPQ060\" \"DPQ070\" \"DPQ080\" \"DPQ090\" \"DPQ100\" \"1\" 31130 NA NA NA NA NA NA NA NA NA NA \"2\" 31131 0 0 0 0 0 0 0 0 0 NA \"3\" 31132 0 0 0 0 0 0 0 0 0 NA \"4\" 31134 0 0 0 0 0 0 0 0 0 NA \"5\" 31139 0 0 0 0 3 ... Date Added: 2009-06-12 21:43:37 |
| xM143Chap9Notes.doc Path: Boise State >> MATH >> 143 Fall, 2008 Description: Chapter 9 Systems of Equations and Inequalities Systems of Equations Systems of Linear Equations Operations for Transformation of a Linear System of Equations to Obtain a Solution AKA Row Operations Ri j R j 1. Interchange any two equations kRi j Ri... Date Added: 2009-06-12 21:44:10 |
| physical.pdf Path: CSU Northridge >> SG >> 4002 Fall, 2009 Description: Chapter 1: The Physical Setting Regions and Landforms: Let\'s take a trip The land surface of California covers almost 100 million acres. It\'s the third largest of the states; only Alaska and Texas are larger. Within this vast area are a greater range... Date Added: 2009-06-12 21:44:47 |
| tj.1500m.2009052312.txt Path: U. Houston >> SERVER >> 2009052312 Fall, 2009 Description: 2 REAL 9 5 23 12 12 REAL 9 5 23 12 12 12FORWARD OMEGA 9 5 23 12 29.696 -95.499 1500.0 9 5 23 12 29.670 -95.129 1500.0 9 5 23 12 30.039 -94.075 15... Date Added: 2009-06-12 21:44:57 |
| 300_graphing_lab.xls Path: CSU Northridge >> SG >> 4002 Fall, 2009 Description: Sheet1 vti_encoding:SR|utf8-nl vti_timelastmodified:TR|10 Nov 2005 19:33:21 -0000 vti_extenderversion:SR|6.0.2.6551 vti_author:SR|GEOGRAPHY\\sgraves vti_modifiedby:SR|GEOGRAPHY\\sgraves vti_timecreated:TR|10 Nov 2005 19:33:21 -0000 vti_cacheddtm:TX|10 ... Date Added: 2009-06-12 21:45:02 |
| ams5-jr-12apr.pdf Path: UCSC >> AMS >> 005 Fall, 2009 Description: ... Date Added: 2009-06-12 21:45:06 |
| ams5-cw-22may.pdf Path: UCSC >> AMS >> 005 Fall, 2009 Description: ... Date Added: 2009-06-12 21:45:17 |
| 300_graphing_lab.xls Path: CSU Northridge >> SG >> 300 Fall, 2009 Description: Sheet1 vti_encoding:SR|utf8-nl vti_timelastmodified:TR|10 Nov 2005 19:33:21 -0000 vti_extenderversion:SR|6.0.2.6551 vti_author:SR|GEOGRAPHY\\sgraves vti_modifiedby:SR|GEOGRAPHY\\sgraves vti_timecreated:TR|10 Nov 2005 19:33:21 -0000 vti_cacheddtm:TX|10 ... Date Added: 2009-06-12 21:45:22 |
| tj.1000m.2009040806.txt Path: U. Houston >> SERVER >> 2009040806 Fall, 2009 Description: 2 REAL 9 4 7 18 0 REAL 9 4 7 18 0 12BACKWARDOMEGA 9 4 8 6 29.696 -95.499 1000.0 9 4 8 6 29.670 -95.129 1000.0 9 4 8 6 30.039 -94.075 10... Date Added: 2009-06-12 21:46:03 |
| submit.txt Path: Washington >> V >> 25285 Fall, 2009 Description: executable = allgamma_25285.bat universe = vanilla error = error.txt output = output.txt log = log.txt # set by submitting script Requirements= (OpSys = \"WINNT51\" ) initialdir = F:\\condor\\allgamma\\v13r5p8\\jobs25000-25499/... Date Added: 2009-06-12 21:51:18 |
| output.txt Path: Washington >> V >> 25000 Fall, 2009 Description: = running on = COMPUTERNAME=PHYSLAB-685QNB1 - local directory - Volume in drive C has no label. Volume Serial Number is 9843-D647 Directory of C:\\condor\\execute\\dir_1424 12/25/2007 07:28 PM <DIR> . 12/25/2007 07:28 ... Date Added: 2009-06-12 21:51:29 |
| log.txt Path: Washington >> V >> 25022 Fall, 2009 Description: 000 (36943.000.000) 12/25 08:06:00 Job submitted from host: <128.95.94.28:1084> . 001 (36943.000.000) 12/25 17:57:03 Job executing on host: <172.25.101.174:1057> . 006 (36943.000.000) 12/25 18:17:12 Image size of job updated: 460384 . 006 (36943.000.... Date Added: 2009-06-12 21:51:45 |
| submit.txt Path: Washington >> V >> 25000 Fall, 2009 Description: executable = allgamma_25210.bat universe = vanilla error = error.txt output = output.txt log = log.txt # set by submitting script Requirements= (OpSys = \"WINNT51\" ) initialdir = F:\\condor\\allgamma\\v13r5p8\\jobs25000-25499/... Date Added: 2009-06-12 21:53:32 |
| output.txt Path: Washington >> V >> 25253 Fall, 2009 Description: = running on = COMPUTERNAME=PHYSLAB-F3WSNB1 - local directory - Volume in drive C has no label. Volume Serial Number is 9843-D647 Directory of C:\\condor\\execute\\dir_4048 12/25/2007 08:08 PM <DIR> . 12/25/2007 08:08 ... Date Added: 2009-06-12 21:54:04 |
| submit.txt Path: Washington >> V >> 25000 Fall, 2009 Description: executable = allgamma_25030.bat universe = vanilla error = error.txt output = output.txt log = log.txt # set by submitting script Requirements= (OpSys = \"WINNT51\" ) initialdir = F:\\condor\\allgamma\\v13r5p8\\jobs25000-25499/... Date Added: 2009-06-12 21:54:18 |
| Naimo Cope Bartsch FNC Testing.2000.pdf Path: N.C. State >> SERVICE >> 004 Fall, 2009 Description: Sediment-Contact and Survival of Fingernail Clams: Implications for Conducting Short-Term Laboratory Tests Teresa J. Naimo, W. Gregory Cope,U Michelle R. Bartsch U.S. Geological Survey, Biological Resources Division, Upper Midwest Environmental Scien... Date Added: 2009-06-12 21:54:34 |
| output.txt Path: Washington >> V >> 25214 Fall, 2009 Description: = running on = COMPUTERNAME=PHYSLAB-945QNB1 - local directory - Volume in drive C has no label. Volume Serial Number is 9843-D647 Directory of C:\\condor\\execute\\dir_3428 12/25/2007 07:42 PM <DIR> . 12/25/2007 07:42 ... Date Added: 2009-06-12 21:54:40 |
| log.txt Path: Washington >> V >> 25398 Fall, 2009 Description: 000 (37319.000.000) 12/25 08:07:27 Job submitted from host: <128.95.94.28:1084> . 001 (37319.000.000) 12/25 21:28:57 Job executing on host: <172.25.101.50:1055> . 006 (37319.000.000) 12/25 21:49:06 Image size of job updated: 399700 . 006 (37319.000.0... Date Added: 2009-06-12 21:57:08 |
| tj.500m.2009050318.txt Path: U. Houston >> SERVER >> 2009050318 Fall, 2009 Description: 2 REAL 9 5 3 6 0 REAL 9 5 3 6 0 12BACKWARDOMEGA 9 5 3 18 29.696 -95.499 500.0 9 5 3 18 29.670 -95.129 500.0 9 5 3 18 30.039 -94.075 5... Date Added: 2009-06-12 21:58:14 |
| t4practice.ps Path: NMT >> PHYS >> 121 Fall, 2008 Description: %!PS-Adobe-2.0 %Creator: dvips(k) 5.86 Copyright 1999 Radical Eye Software %Title: t4practice.dvi %Pages: 6 %PageOrder: Ascend %BoundingBox: 0 0 596 842 %EndComments %DVIPSWebPage: (www.radicaleye.com) %DVIPSCommandLine: dvips -o t4practice.ps t4prac... Date Added: 2009-06-12 21:58:52 |
| 3705quiz13.pdf Path: Youngstown >> MATH >> 3705 Spring, 2008 Description: MATH 3705 Name : Dierential Equations: Quiz 13 Summer 2006 Score : /10 1. Solve the heat ow problem with = 2, L = , and f (x) = sin x 7 sin(3x) + sin(5x). 2. Compute the Fourier Sine Series for f (x) = ex , 0 < x < . ... Date Added: 2009-06-12 21:59:12 |
| practice_exams_Exam_cheatsheat.1.pdf Path: Washington >> CHEM >> 152 Fall, 2008 Description: Useful Information Constants: h = 6.626x10-34 J.s c = 3 x 108 m/s F = 96,495 C/mol ee- charge = 1.6 x 10-19 C e- mass = 9.1 x 10-31 kg R = 8.314 J/mol.K = 0.0821 l.atm/mol.K 1 nm = 10-9 m 1D = Z2 E = 2.178x10 J 2 n 18 n 2h 2 E= 8mL2 E = h = o ... Date Added: 2009-06-12 21:59:33 |
| page34.pdf Path: New Mexico >> ME >> 400 Fall, 2008 Description: ... Date Added: 2009-06-12 22:01:09 |
| 0350_Change_Order.xls Path: Ohio State >> FOD >> 0300 Fall, 2009 Description: Change Order Instructions The Ohio State University Facilities Operations and Development 400 Central Classroom - 2009 Millikin Rd. - Columbus OH 43210 Introduction The Change Order is recommended by the Architect/Engineer (A/E) and the Construction ... Date Added: 2009-06-12 22:01:53 |
| tj.pt11.2009042512.txt Path: U. Houston >> SERVER >> 2009042512 Fall, 2009 Description: 2 REAL 9 4 25 0 0 REAL 9 4 25 0 0 4BACKWARDOMEGA 9 4 25 12 30.412 -89.081 10.0 9 4 25 12 30.412 -89.081 500.0 9 4 25 12 30.412 -89.081 10... Date Added: 2009-06-12 22:02:24 |
| ThéorieDesignPatterns.pdf Path: Rush >> IFT >> 785 Fall, 2009 Description: Partie thorique 1) En ObjVlisp, la diffrence entre instance terminale, classe et mta-classes en est une de comportement et non de nature. ObjVlisp propose pour liminer la diffrence entre les classes et les objets qui existe dans JAVA, C+, etc. lunifi... Date Added: 2009-06-12 22:03:09 |
| SpaceInvaders.txt Path: Youngstown >> CIS >> 5875 Fall, 2009 Description: <!DOCTYPE html PUBLIC \"-/W3C/DTD HTML 4.01/EN\" \"http:/www.w3.org/TR/html4/strict.dtd\"> <html> <head> <META http-equiv=\"Content-Type\" content=\"text/html; charset=UTF-8\"> <meta content=\"Lift Assistive 1.9\" name=\"generator\"> <style type=\"text/css\"> ... Date Added: 2009-06-12 22:04:08 |
| tj.pt10.2009051618.txt Path: U. Houston >> SERVER >> 2009051618 Fall, 2009 Description: 2 REAL 9 5 16 6 0 REAL 9 5 16 6 0 4BACKWARDOMEGA 9 5 16 18 31.335 -92.559 10.0 9 5 16 18 31.335 -92.559 500.0 9 5 16 18 31.335 -92.559 10... Date Added: 2009-06-12 22:04:20 |
| 7b_IFT232_DesignPatterns_AbstractFactory-exemple.ppt Path: Rush >> IFT >> 232 Fall, 2009 Description: vti_encoding:SR|utf8-nl vti_timelastmodified:TR|20 Feb 2007 20:14:44 -0000 vti_extenderversion:SR|6.0.2.6551 vti_backlinkinfo:VX|Organisation.htm ... Date Added: 2009-06-12 22:04:27 |
| tj.pt09.2009051400.txt Path: U. Houston >> SERVER >> 2009051400 Fall, 2009 Description: 2 REAL 9 5 13 12 0 REAL 9 5 13 12 0 4BACKWARDOMEGA 9 5 14 0 29.993 -90.251 10.0 9 5 14 0 29.993 -90.251 500.0 9 5 14 0 29.993 -90.251 10... Date Added: 2009-06-12 22:06:07 |
| tj.pt12.2009051712.txt Path: U. Houston >> SERVER >> 2009051712 Fall, 2009 Description: <?xml version=\"1.0\" encoding=\"UTF-8\"?> <Error><Code>NoSuchKey</Code><Message>The specified key does not exist.</Message><Key>1921c1097018d05be45e8d94156ebadf96e9deb5.txt</Key><RequestId>655F29F4848F0982</RequestId><HostId>jHiExItxKAc5CcwLCZhsAW5cbUpg... Date Added: 2009-06-12 22:06:46 |
| Homework 1 Solutions Fall03.doc Path: CUNY Baruch >> EES >> 339 Fall, 2009 Description: Homework 1 Grading Key Due: 09/25/03 before class 1. Calculate the volume density of Si atoms (number of atoms/cm3) given that the lattice constant of Si is 5.43 angstroms. Calculate the areal density of atoms (number/cm2) on the (100) plane. Calcula... Date Added: 2009-06-12 22:08:18 |
| tj.pt10.2009052118.txt Path: U. Houston >> SERVER >> 2009052118 Fall, 2009 Description: 2 REAL 9 5 21 6 0 REAL 9 5 21 6 0 4BACKWARDOMEGA 9 5 21 18 31.335 -92.559 10.0 9 5 21 18 31.335 -92.559 500.0 9 5 21 18 31.335 -92.559 10... Date Added: 2009-06-12 22:11:42 |
| error.txt Path: Washington >> V >> 27500 Fall, 2009 Description: Starting test Glast-Gaudi job with job options file joboptions.txt Current time: Thu Dec 27 03:04:32 2007 ( 0 s elapsed) Area not found in title: assuming 60000 cm^2 Current time: Thu Dec 27 04:17:07 2007 ( 4355 s elapsed) ... Date Added: 2009-06-12 22:12:00 |
| output.txt Path: Washington >> V >> 29500 Fall, 2009 Description: = running on = COMPUTERNAME=PHYSLAB-715QNB1 - local directory - Volume in drive C has no label. Volume Serial Number is 9843-D647 Directory of C:\\condor\\execute\\dir_3052 12/30/2007 08:26 AM <DIR> . 12/30/2007 08:26 ... Date Added: 2009-06-12 22:12:20 |
| output.txt Path: Washington >> V >> 29500 Fall, 2009 Description: = running on = COMPUTERNAME=PHYSLAB-2W4QNB1 - local directory - Volume in drive C has no label. Volume Serial Number is 9843-D647 Directory of C:\\condor\\execute\\dir_1000 12/30/2007 08:22 AM <DIR> . 12/30/2007 08:22 ... Date Added: 2009-06-12 22:13:20 |
| submit.txt Path: Washington >> V >> 27500 Fall, 2009 Description: executable = allgamma_27963.bat universe = vanilla error = error.txt output = output.txt log = log.txt # set by submitting script Requirements= (OpSys = \"WINNT51\" ) initialdir = F:\\condor\\allgamma\\v13r5p8\\jobs27500-27999/... Date Added: 2009-06-12 22:15:15 |
| error.txt Path: Washington >> V >> 27907 Fall, 2009 Description: <?xml version=\"1.0\" encoding=\"UTF-8\"?> <Error><Code>NoSuchKey</Code><Message>The specified key does not exist.</Message><Key>1982680a49b9c7fae71b2431a873f2254cd65246.txt</Key><RequestId>E7EC637DBD89BF43</RequestId><HostId>SkRcdDx7Jp0opDtXajazIWTtqgAh... Date Added: 2009-06-12 22:15:21 |
| log.txt Path: Washington >> V >> 29882 Fall, 2009 Description: 000 (41803.000.000) 12/30 07:01:35 Job submitted from host: <128.95.94.28:1084> . 001 (41803.000.000) 12/30 10:11:27 Job executing on host: <172.25.101.196:1056> . 006 (41803.000.000) 12/30 10:31:35 Image size of job updated: 466460 . 005 (41803.000.... Date Added: 2009-06-12 22:20:30 |
| error.txt Path: Washington >> V >> 29676 Fall, 2009 Description: Starting test Glast-Gaudi job with job options file joboptions.txt Current time: Sun Dec 30 08:21:30 2007 ( 0 s elapsed) Area not found in title: assuming 60000 cm^2 Current time: Sun Dec 30 09:30:13 2007 ( 4123 s elapsed) ... Date Added: 2009-06-12 22:20:32 |
| submit.txt Path: Washington >> V >> 29903 Fall, 2009 Description: executable = allgamma_29903.bat universe = vanilla error = error.txt output = output.txt log = log.txt # set by submitting script Requirements= (OpSys = \"WINNT51\" ) initialdir = F:\\condor\\allgamma\\v13r5p8\\jobs29500-29999/... Date Added: 2009-06-12 22:21:49 |
| log.txt Path: Washington >> V >> 29514 Fall, 2009 Description: 000 (41435.000.000) 12/30 07:00:24 Job submitted from host: <128.95.94.28:1084> . 001 (41435.000.000) 12/30 07:01:38 Job executing on host: <172.25.101.166:1062> . 006 (41435.000.000) 12/30 07:21:47 Image size of job updated: 396668 . 005 (41435.000.... Date Added: 2009-06-12 22:22:18 |
| submit.txt Path: Washington >> V >> 27500 Fall, 2009 Description: executable = allgamma_27996.bat universe = vanilla error = error.txt output = output.txt log = log.txt # set by submitting script Requirements= (OpSys = \"WINNT51\" ) initialdir = F:\\condor\\allgamma\\v13r5p8\\jobs27500-27999/... Date Added: 2009-06-12 22:22:51 |
| log.txt Path: Washington >> V >> 29500 Fall, 2009 Description: 000 (41483.000.000) 12/30 07:00:32 Job submitted from host: <128.95.94.28:1084> . 001 (41483.000.000) 12/30 07:02:30 Job executing on host: <172.25.101.184:1057> . 006 (41483.000.000) 12/30 07:22:38 Image size of job updated: 46404 . 006 (41483.000.0... Date Added: 2009-06-12 22:24:50 |
| error.txt Path: Washington >> V >> 29783 Fall, 2009 Description: Starting test Glast-Gaudi job with job options file joboptions.txt Current time: Sun Dec 30 09:30:16 2007 ( 0 s elapsed) Area not found in title: assuming 60000 cm^2 Current time: Sun Dec 30 10:49:18 2007 ( 4742 s elapsed) ... Date Added: 2009-06-12 22:24:57 |
| log.txt Path: Washington >> V >> 29543 Fall, 2009 Description: 000 (41464.000.000) 12/30 07:00:29 Job submitted from host: <128.95.94.28:1084> . 001 (41464.000.000) 12/30 07:02:37 Job executing on host: <172.25.101.177:1055> . 006 (41464.000.000) 12/30 07:22:46 Image size of job updated: 454840 . 006 (41464.000.... Date Added: 2009-06-12 22:26:34 |
| Roots.pdf Path: Texas >> CHE >> 210 Fall, 2008 Description: Roots of Functions An important mathematical concept in Engineering involves finding solutions of nonlinear equations. These equations are best solved by expressing them as functions of the unknown variables by moving all quantities to one side of t... Date Added: 2009-06-12 22:28:21 |
| hw09_answers.pdf Path: Evansville >> EE >> 342 Fall, 2009 Description: EE342 Electronics I Homework 9 HW9A: 6.6, 6.8 HW9B: 6.14, 6.19 Homework 9A 6.6) Av = 3.935 V/V, Rin = 200 k, Ai = 196.8 A/A 6.8) Av = 0.841 V/V, Rin = 100 k, Ai = 16.8 A/A Homework 9B 6.14) RD = 1.3k, RS = 130 Ohm, R1 = 18.6 k, R2 = 76.7k 6.19) a) I... Date Added: 2009-06-12 22:29:12 |
| lecture_7_30.pdf Path: Delaware >> CISC >> 105 Fall, 2008 Description: CISC 105 General Computer Science Li Jin, CIS Dept University of Delaware 2008.07.30 http:/www.cis.udel.edu/~jin/courses/cisc105/08 Summer/ Pointers A pointer is a variable that contains the address of a variable. Pointers are much used in C Some... Date Added: 2009-06-12 22:29:26 |
| log.txt Path: Washington >> V >> 26000 Fall, 2009 Description: 000 (38067.000.000) 12/25 16:56:23 Job submitted from host: <128.95.94.28:1084> . 001 (38067.000.000) 12/26 04:30:14 Job executing on host: <172.25.101.191:1056> . 006 (38067.000.000) 12/26 04:50:22 Image size of job updated: 390040 . 005 (38067.000.... Date Added: 2009-06-12 22:29:31 |
| log.txt Path: Washington >> V >> 26095 Fall, 2009 Description: 000 (38016.000.000) 12/25 16:56:09 Job submitted from host: <128.95.94.28:1084> . 001 (38016.000.000) 12/26 03:59:02 Job executing on host: <172.25.101.183:1063> . 005 (38016.000.000) 12/26 05:07:53 Job terminated. (1) Normal termination (return val... Date Added: 2009-06-12 22:30:42 |
| output.txt Path: Washington >> V >> 26498 Fall, 2009 Description: = running on = COMPUTERNAME=PHYSLAB-2ZVSNB1 - local directory - Volume in drive C has no label. Volume Serial Number is 9843-D647 Directory of C:\\condor\\execute\\dir_2872 12/26/2007 07:46 AM <DIR> . 12/26/2007 07:46 ... Date Added: 2009-06-12 22:30:52 |
| log.txt Path: Washington >> V >> 26000 Fall, 2009 Description: 000 (38218.000.000) 12/25 16:57:06 Job submitted from host: <128.95.94.28:1084> . 001 (38218.000.000) 12/26 05:55:39 Job executing on host: <172.25.101.62:1056> . 006 (38218.000.000) 12/26 06:15:47 Image size of job updated: 450108 . 006 (38218.000.0... Date Added: 2009-06-12 22:31:27 |
| error.txt Path: Washington >> V >> 26000 Fall, 2009 Description: Starting test Glast-Gaudi job with job options file joboptions.txt Current time: Wed Dec 26 04:05:11 2007 ( 0 s elapsed) Area not found in title: assuming 60000 cm^2 Current time: Wed Dec 26 05:17:16 2007 ( 4325 s elapsed) ... Date Added: 2009-06-12 22:31:48 |
| homework9_2007_key.doc Path: Michigan >> PERSONAL >> 510 Fall, 2009 Description: Homework 9 Key (100 points total + 25 points extra credit) 50 points for SPSS commands and 50 points for output. DATA list FILE = \'d:\\510\\2007\\data\\AFIFI.DAT\' RECORDS=2 / IDNUM 1-4 AGE 5-8 HEIGHT 9-12 SEX 13-15 SURVIVE 16 SHOKTYPE 17-20 SBP1 21-24 MA... Date Added: 2009-06-12 22:36:12 |
| submit.txt Path: Washington >> V >> 26399 Fall, 2009 Description: executable = allgamma_26399.bat universe = vanilla error = error.txt output = output.txt log = log.txt # set by submitting script Requirements= (OpSys = \"WINNT51\" ) initialdir = F:\\condor\\allgamma\\v13r5p8\\jobs26000-26499/... Date Added: 2009-06-12 22:36:50 |
| 5_1_Arjun Krishnamurthy.ppt Path: USC >> CSCI >> 586 Fall, 2008 Description: VLDBJournal(1999) SEMANTICHETEROGENEITY RESOLUTIONINFEDERATED DATABASESBYMETADATA IMPLANTATIONANDSTEPWISE EVOLUTION ByGokselAslanandDennisMcLeod Presentedby:ArjunKrishnamurthy TOPICSOFDISCUSSION Distributeddatabasesystems Homogeneous/Heterogeneo... Date Added: 2009-06-12 22:37:10 |
| labTriggersOld.doc Path: Kennesaw >> SCIENCE >> 3310 Fall, 2009 Description: Lab on Triggers and Stored Procedures Part I DOWNLOAD AND INSTALL THE ASU DATABASE 1) Go to the Arizona State web-site by either by clicking on ASU Web-site link From the courses home page or directly through url http:/www.eas.asu.edu/~advdb/ Click ... Date Added: 2009-06-12 22:39:44 |
| Comments Re the 103 Draft Sp.doc Path: CSU Northridge >> KFS >> 103 Fall, 2009 Description: Comments Re the 103 Draft Sp, 2007 The draft is a great start. Thank you for taking time to do this and sending it on to us. Below are some comments on several problems: I am not at all offended if you decide not to use them. S Rita #2. The question ... Date Added: 2009-06-12 22:40:09 |
| description.txt Path: Allan Hancock College >> CSEE >> 801530995 Fall, 2009 Description: In this thesis the diagnostic method Polarization and Depolarization Current Measurement using long time constant is further investigated. In order to do this, a fully automatic IPS measurement system was use to allow the investigation to progress ef... Date Added: 2009-06-12 22:42:24 |
| title.txt Path: Allan Hancock College >> CSEE >> 341472962 Fall, 2009 Description: Piconet - A Wireless Ad Hoc Network for Mobile Handheld Devices ... Date Added: 2009-06-12 22:42:27 |
| Grades-Alan Pannier.pdf Path: Uni. Westminster >> ADP >> 0717 Fall, 2009 Description: Alan D. HW Unit 0 100 Pannier HW Unit 1 89 AG Unit 1 87 HW Unit 2 98 AG Unit 2 10 Final HW Unit 3 86 AG Unit 3 10 Project HW Unit 4 95 AG Unit 4 9 HW Unit 5 98 AG Unit 5 10 HW Unit 6 77 AG Unit 6 9 HW Unit 7 91 AG Unit 7 10 HW Unit 8 HW Unit 9 HW Un... Date Added: 2009-06-12 22:42:30 |
| tj.500m.2006082300.txt Path: U. Houston >> SERVER >> 2006082300 Fall, 2009 Description: 2 REAL 6 8 22 12 0 REAL 6 8 22 12 0 12BACKWARDOMEGA 6 8 23 0 29.696 -95.499 500.0 6 8 23 0 29.670 -95.129 500.0 6 8 23 0 30.039 -94.075 5... Date Added: 2009-06-12 22:43:01 |
| 456-018-HomeGroundsAnimals-Book-09.pdf Path: Virginia Tech >> PUBS >> 456 Fall, 2009 Description: Pest ManageMent guide - 2009 Home Grounds D. Ames Herbert, Jr.,... Date Added: 2009-06-12 22:43:33 |
| lecture10-slides.pdf Path: Georgia Tech >> CS >> 7613 Fall, 2008 Description: Pattern-Directed Inference Systems CS 7613 Knowledge Systems Engineering Coming Up! Wednesday: Intro to PDIS Friday: Scope and extent in Lisp (and the consequences thereof) Monday: The Tiny Rule Engine architecture Wednesday: Kalish & Montegues ... Date Added: 2009-06-12 22:43:37 |
| PDF_entries.pdf Path: Virginia Tech >> PUBS >> 424 Fall, 2009 Description: Small Grains in 2006 Barley and Wheat Entries Commercial Barley Entries Virginia Tech and Virginia Crop Improvement Association, 9142 Atlee Station Road, Mechanicsville, VA 23116 Callao, Doyce, Price, and Thoroughbred. Renwood Farms, Inc., 17303 S... Date Added: 2009-06-12 22:43:41 |
| YKR072C.t2k.stride-ebghtl-logo.pdf Path: UCSC >> YKR >> 072 Fall, 2009 Description: YKR072C.t2k EBGHTL 3 2 1 CC EE E TT E X 1 10 20 30 40 E 3 2 1 T E T H T TEEEETCTTCCCTEECEEEEETTT C C CC TCC C C T C H C E E C E E T E E H E T T E T T E C X X X X X X X X X X X X X X X X X X CC T TTT 60 E E XXXX T T E E C E X X X X ... Date Added: 2009-06-12 22:45:22 |
| tj.500m.2009040318.txt Path: U. Houston >> SERVER >> 2009040318 Fall, 2009 Description: 2 REAL 9 4 3 18 18 REAL 9 4 3 12 12 12FORWARD OMEGA 9 4 3 18 29.696 -95.499 500.0 9 4 3 18 29.670 -95.129 500.0 9 4 3 18 30.039 -94.075 5... Date Added: 2009-06-12 22:45:31 |
| BiomedicalCareersinIndustry.pdf Path: UCSD >> BIOM >> 234 Fall, 2008 Description: ... Date Added: 2009-06-12 22:45:45 |
| YOR032W-A.t2k.CB_burial_14_7-logo.pdf Path: UCSC >> YOR >> 032 Fall, 2009 Description: YOR032W-A.t2k CB_BURIAL_14_7 2 1 AA X A BBBXX CC A D D X X D B A C A A A A A A X X X XXXXXXX F F F F F X FFFFF G G G G F E E E E E XXXXXXXX F F B B A A E X X E C C D D X XXXXXXXXXXXXXXXXXXXXX D A A A A A A B A B B C C B B A A C B E ... Date Added: 2009-06-12 22:46:22 |
| YPL207W.t2k.dssp-ebghstl-logo.pdf Path: UCSC >> YPL >> 207 Fall, 2009 Description: YPL207W.t2k EBGHSTL 3 2 1 CC X T ECCCCTC H T HTT C E S C C ESCCCCCSESESSE T S H E XXXXXXXXXXXXXXXXGXXXX X X X X X C S E C EEEE E TTC H E T E S C X H 1 10 20 30 40 E 3 2 1 T H E T H S T H T TCCCCC CSESSS S S T H G X E CC HHSC H... Date Added: 2009-06-12 22:48:11 |
| 7011-2009-sem1-lecture1.ppt Path: Allan Hancock College >> LAW >> 7011 Fall, 2009 Description: LAW 7011 Copyright 1st Semester 2009 Welcome! Lecturer & Contact Details Dr David Lindsay Senior Lecturer Room 301 Building 12, Faculty of Law Tel: 9905 5547 Email: david.lindsay@law.monash.edu.au D.Lindsay.Copyright1stSem,2009. 2 Lectures Le... Date Added: 2009-06-12 22:48:39 |
| log.txt Path: Washington >> V >> 22000 Fall, 2009 Description: <?xml version=\"1.0\" encoding=\"UTF-8\"?> <Error><Code>NoSuchKey</Code><Message>The specified key does not exist.</Message><Key>19edb159be75095e43081ec29f8abb3b2c0e002e.txt</Key><RequestId>554818B0B3E77AD4</RequestId><HostId>60gsXiXUc/XRy1MZkMxnbB4FY9QX... Date Added: 2009-06-12 22:49:01 |
| YPL186C.t2k.alpha-logo.pdf Path: UCSC >> YPL >> 186 Fall, 2009 Description: YPL186C.t2k ALPHA 2 1 EAB A B E B H EBSHIA B A XBXXXXXXXXIXXXXX XAB X EEAEE A T E S E A B C A I S H G H H E B H E H H X X XX H X XXXXXXXXXXXXX H E A S H C E B S B A D SCEEEEE A ABA EBBBAB T E A B S D T H B B H H C C E D B XX ... Date Added: 2009-06-12 22:49:33 |
| YBR261C.t2k.alpha-logo.pdf Path: UCSC >> YBR >> 261 Fall, 2009 Description: YBR261C.t2k ALPHA 4 3 2 1 E E XXX H H X I I I I H XXXXXXI X H HHHHHXS H HT G ISE H I G I XXXXXIXXXXXXX X I H I B HHHHHB C S C H H B B H S D H E H H H H H H X X X XXXX X X H X XXX H E H H HH XXIXXHHXHXX X X X X E B B H S I I S H ... Date Added: 2009-06-12 22:50:09 |
| YOR251C.t2k.dssp-ebghstl-logo.pdf Path: UCSC >> YOR >> 251 Fall, 2009 Description: YOR251C.t2k EBGHSTL 3 2 1 CC X E T B S G H H X X X CC S X C T T C G S C E X XSX BE 1 10 20 30 40 H 3 2 1 T T S E H T T T 51 60 70 80 90 E H G H T H T T E T S 3 2 1 C S C H T H XXCX X H 3 2 1 CE E T E T S H ... Date Added: 2009-06-12 22:50:42 |
| YPR002C-A.t2k.str2-logo.pdf Path: UCSC >> YPR >> 002 Fall, 2009 Description: YPR002C-A.t2k STR2 5 4 3 2 1 C S S P M H H T C Q H E C T H H Q X X X X X XX X X X QQ QMQMCC H C S PQP P M H X 10 20 30 40 P 5 4 3 2 1 H T H T Y Z E A CT YZ SC X X C Z SYS A TZZCCCCCT YZ S S S S Z ST G X X XTTSTXSS XXXXGXX CC XX ... Date Added: 2009-06-12 22:52:23 |
| constitution cheat sheet.doc Path: Evergreen >> MPAFIRSTYE >> 0607 Fall, 2009 Description: Foundations of Public Administration, Constitution Summary Sheet References: Greenberg, E. & Page, B., The Struggle for Democracy, 4th ed., Addison-Wesley Educational Publishers Inc., 1999 http:/www.usconstitution.net The Basics The Constitution is t... Date Added: 2009-06-12 22:52:27 |
| output.txt Path: Washington >> V >> 22261 Fall, 2009 Description: = running on = COMPUTERNAME=PHYSLAB-945QNB1 - local directory - Volume in drive C has no label. Volume Serial Number is 9843-D647 Directory of C:\\condor\\execute\\dir_2944 12/24/2007 03:53 PM <DIR> . 12/24/2007 03:53 ... Date Added: 2009-06-12 22:53:00 |
| log.txt Path: Washington >> V >> 22000 Fall, 2009 Description: 000 (34356.000.000) 12/24 09:31:34 Job submitted from host: <128.95.94.28:1084> . 001 (34356.000.000) 12/24 17:52:09 Job executing on host: <172.25.101.69:1056> . 006 (34356.000.000) 12/24 18:12:17 Image size of job updated: 467668 . 005 (34356.000.0... Date Added: 2009-06-12 22:53:43 |
| log.txt Path: Washington >> V >> 22364 Fall, 2009 Description: 000 (34285.000.000) 12/24 09:31:00 Job submitted from host: <128.95.94.28:1084> . 001 (34285.000.000) 12/24 16:58:24 Job executing on host: <172.25.101.47:1055> . 006 (34285.000.000) 12/24 17:18:32 Image size of job updated: 418972 . 005 (34285.000.0... Date Added: 2009-06-12 22:55:32 |
| YBR126W-B.t2k.stride-ebghtl-logo.pdf Path: UCSC >> YBR >> 126 Fall, 2009 Description: YBR126W-B.t2k EBGHTL 3 2 1 C X EHHEEEE E T C H H H H H C C H T X C EE X X X X X X X C T H X C H H H X X X X TTTH T CC H H X X X X X X H H H H H X TC C T TCTTCCTTCTXXXXXCCCCCCETTX T T T T T E T T E T H H X X X X X X XCXX X X X X X XXXX... Date Added: 2009-06-12 22:57:11 |
| YGL105W.t2k.str2-logo.pdf Path: UCSC >> YGL >> 105 Fall, 2009 Description: YGL105W.t2k STR2 7 6 5 4 3 2 1 C H H H H H X X X X X X H SSSSTHCH CTC C C S S XXXCXXXTHSH X X X T C S H S H S G X TTC 10 CC C X 20 30 40 H 7 6 5 4 3 2 1 T H HHH X 51 60 70 80 90 T 7 6 5 4 3 2 1 H T H HHHH T C HHHS CS H C C HHHHX... Date Added: 2009-06-12 22:58:17 |
| hw3_sol.pdf Path: University of Illinois, Urbana Champaign >> ECE >> 559 Fall, 2008 Description: S d c m LO\'$ q Pw+4, Fv, ( x ) - - t-l 1- L -;/?cC -A20 c ex . - - - - Clt 7 \' ) I - 4 ) _ _ I i 74 L f ): L e - ~ - Po- - - -.* L+ i - l .- h- - - - (L+ i - I ) ! - [ / ~ L i s , i - 1 4 + ) (7 232 \'. ) I - ... Date Added: 2009-06-12 22:58:18 |
| YOL061W.t2k.CB_burial_14_7-logo.pdf Path: UCSC >> YOL >> 061 Fall, 2009 Description: YOL061W.t2k CB_BURIAL_14_7 3 2 1 AA B X E BACBFE B CDF D D CC X X B CDBDBCDCCAB D CE C A B E C C C ED F D EBFDDAD D C D C D A A E B B F C D B E E A D D G G D D D D A D D D D D G B C D E E D D D D A E E E F D D D D D X X X X X X X X X X X X X XC X ... Date Added: 2009-06-12 22:58:36 |
| YPL182C.t2k.CB_burial_14_7-logo.pdf Path: UCSC >> YPL >> 182 Fall, 2009 Description: YPL182C.t2k CB_BURIAL_14_7 2 1 AAAAAAAA AA A C C C C C 1 10 20 30 40 A 2 1 D A B D B A D A B D E E A B E B E D F X X X X X X X X X X XXXXXX F F E F B F F E A A A B C D E E A A E D E A A E X X X X F X X X C C D XCXDXDXX B B A D... Date Added: 2009-06-12 22:58:42 |
| YJL027C.t2k.stride-ebghtl-logo.pdf Path: UCSC >> YJL >> 027 Fall, 2009 Description: YJL027C.t2k EBGHTL 3 2 1 C TEEEE T T T X X X X X 1 10 20 30 40 E 3 2 1 H E X H T E T E T E T H H X X E E E E E E E H X X X X X X X X X X X X H H H HH HHHHHH 60 H X X X TTTCCCTCC C ETCTCTHHHH C C C C T T C CEEXXEETTTTEEXEETCXXX... Date Added: 2009-06-12 22:58:44 |
| YBR025C.t2k.alpha-logo.pdf Path: UCSC >> YBR >> 025 Fall, 2009 Description: YBR025C.t2k ALPHA 3 2 1 T H C H D H B A D H B E E H H X XXXXXXXXX H E B B C SC B E T S D H E A H H X X X X X X X E B H H H XXXXXXX H E EEAAA AA E G G S A G B T BHBBTASDBEHII B A F B EE SD B T E C X I I TC H A H EEHH A HHB T I E ICI XXXX... Date Added: 2009-06-12 22:59:14 |
| 13ip.pdf Path: University of Illinois, Urbana Champaign >> CS >> 526 Fall, 2008 Description: CS 526 Topic 13: Interprocedural Compilation Interprocedural Analysis and Optimization Why consider interprocedural analysis and optimization? 1. to produce better code around call sites avoid saves, restores understand cross-call site data flow 2. ... Date Added: 2009-06-12 22:59:42 |
| Assignment3.doc Path: Wisconsin >> SOC >> 357 Fall, 2000 Description: SOC 357 ASSIGNMENT 3 DUE DEC 9 STRUCTURED QUESTIONNAIRE EXERCISE Choose a team. You are required to do this exercise in teams of two to four people (no more than four people per team). Developing good questions is often done better through team effor... Date Added: 2009-06-12 22:59:45 |
| hw7.ps Path: USF >> CAS >> 4523 Spring, 2009 Description: %!PS-Adobe-2.0 %Creator: dvipsk 5.66a Copyright 1986-97 Radical Eye Software (www.radicaleye.com) %Pages: 1 %PageOrder: Ascend %BoundingBox: 0 0 612 792 %DocumentFonts: cmr10 cmbx10 %EndComments %DVIPSCommandLine: dvips -Pbakoma -f -f %DVIPSParameter... Date Added: 2009-06-12 23:00:50 |
| Vanguard MM Example.pdf Path: High Point >> BUA >> 234 Fall, 2009 Description: Vanguard Money Market Funds Annual Report August 31, 2002 Vanguard Prime Money Market Fund Vanguard Federal Money Market Fund Vanguard Treasury Money Market Fund Vanguard AdmiralTM Treasury Money Market Fund E arning Your Trust Every Day The lat... Date Added: 2009-06-12 23:02:18 |
| 03_mod06_set03_1up.pdf Path: Virginia Tech >> ECE >> 5654 Spring, 2008 Description: Digital Communications and Simulation ECE 5654 Section 3 Modulation Module 6 Noncoherent Receiver Set 2 Noncoherent Receiver Structures: FSK Copyright 2002 Brian D. Woerner and William H. Tranter Noncoherent Reception For FSK signals which are... Date Added: 2009-06-12 23:02:56 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 1012 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-12 23:03:04 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 2080 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-12 23:03:57 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 2100 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-12 23:04:55 |
| CAMSDM100-10-ProcSel-06.ppt Path: Allan Hancock College >> CAMSDM >> 100 Fall, 2009 Description: Manufacturing process selection School of Mechanical Engineering The University of Western Australia Professor Brett Kirk Room 116/118 Phone (6488) 3118 email: kirk@mech.uwa.edu.au Process selection The selection of process is a critical factor that... Date Added: 2009-06-12 23:05:15 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 2199 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-12 23:05:51 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 1082 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-12 23:06:54 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 1007 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-12 23:07:55 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 1000 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-12 23:08:51 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 1004 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-12 23:09:45 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 1075 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-12 23:10:43 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 1024 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-12 23:11:37 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 1044 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-12 23:12:32 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 1061 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-12 23:13:30 |
| Raetsel-16.3.pdf Path: Mansfield >> FACULTY >> 2201 Fall, 2009 Description: Freizeitbeschftigungen (16.3) 1 2 3 4 5 6 7 8 9 10 11 12 13 14 Waagerecht 3. Letzte Woche waren Verwandte aus Florida bei uns _ _. 10. Die Mama hat uns _, dass wir am Wochenende ins Kino gehen knnen. 11. Ich glaube, dass die Arbeit diese Wo... Date Added: 2009-06-12 23:14:12 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 1057 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-12 23:14:40 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 2189 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-12 23:15:39 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 2049 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-12 23:16:34 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 2035 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-12 23:18:23 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 1053 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-12 23:19:16 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 2031 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-12 23:20:09 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 1092 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-12 23:21:05 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 2088 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-12 23:21:58 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 1068 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-12 23:22:51 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 2076 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-12 23:23:48 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 1043 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-12 23:24:46 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 2096 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-12 23:25:44 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 1005 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-12 23:26:39 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 1090 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-12 23:27:39 |
| dep_out.xls Path: Sveriges lantbruksuniversitet >> BUEC >> 333 Fall, 2009 Description: Sheet3 D7538 Mean Standard Error Median Mode Standard Deviation Sample Variance Kurtosis Skewness Range Minimum Maximum Sum Count Confidence Level(95.0%) 2860.92 Mean 70.72 Standard Error 2917.5 Median 2450 Mode 1024.89 Standard Deviation 1050406.09... Date Added: 2009-06-12 23:28:32 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 2183 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-12 23:28:33 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 1084 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-12 23:29:26 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 2041 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-12 23:30:18 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 1013 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-12 23:32:57 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 2079 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-12 23:33:51 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 2095 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-12 23:34:50 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 1003 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-12 23:35:49 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 1023 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-12 23:36:56 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 1016 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-12 23:38:06 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 1086 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-12 23:39:10 |
| EvapCondDr-05-31-1956.pdf Path: Cornell >> MANNLIB >> 1956 Fall, 2009 Description: ... Date Added: 2009-06-12 23:39:10 |
| EvapCondDr-03-31-1971.pdf Path: Cornell >> MANNLIB >> 1971 Fall, 2009 Description: ... Date Added: 2009-06-12 23:39:14 |
| EvapCondDr-11-29-1961.pdf Path: Cornell >> MANNLIB >> 1961 Fall, 2009 Description: ... Date Added: 2009-06-12 23:39:45 |
| error.txt Path: Washington >> V >> 300 Fall, 2009 Description: <?xml version=\"1.0\" encoding=\"UTF-8\"?> <Error><Code>NoSuchKey</Code><Message>The specified key does not exist.</Message><Key>19f59299b8608973fb64f4cc79cd4b1fd84c5728.txt</Key><RequestId>F3824A6147853504</RequestId><HostId>l8ScjrmuA91+n5tFfheMSOfiXesg... Date Added: 2009-06-12 23:40:33 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 1060 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-12 23:41:20 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 1048 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-12 23:42:15 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 1033 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-12 23:43:13 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 1034 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-12 23:44:08 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 1073 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-12 23:45:05 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 1054 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-12 23:48:04 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 2089 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-12 23:49:07 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 1089 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-12 23:50:07 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 1042 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-12 23:51:25 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 1093 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-12 23:52:33 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 2071 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-12 23:53:40 |
| error.txt Path: Washington >> V >> 150 Fall, 2009 Description: Starting Glast-Gaudi job with job options file joboptions.txt Current time: Mon Dec 10 09:35:07 2007 ( 0 s elapsed) Area not found in title: assuming 60000 cm^2 Current time: Mon Dec 10 11:29:54 2007 ( 6887 s elapsed) ... Date Added: 2009-06-12 23:53:56 |
| POTcomp.ps Path: Princeton >> CS >> 226 Fall, 2009 Description: save DSDict begin /ThisDict 64 dict def ThisDict begin /Courier-Bold findfont 9 scalefont setfont /drawedgeARR { /gap exch def /yy exch def /xx exch def /gr exch def /strs exch def /NN strs length 1 sub def xx yy moveto 0 1 NN { /ii exch def gsave gr... Date Added: 2009-06-12 23:54:04 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 2192 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-12 23:54:48 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 2102 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-12 23:55:43 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 1070 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-12 23:56:39 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 1083 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-12 23:57:32 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 1081 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-12 23:59:22 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 2038 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-13 00:00:27 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 1040 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-13 00:01:20 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 1094 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-13 00:02:14 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 2081 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-13 00:03:08 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 2054 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-13 00:04:00 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 2121 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-13 00:04:59 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 1062 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-13 00:05:52 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 1026 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-13 00:06:45 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 2022 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-13 00:07:37 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 1001 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-13 00:09:23 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 1076 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-13 00:10:17 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 1010 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-13 00:11:11 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 1039 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-13 00:12:07 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 1006 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-13 00:13:12 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 1077 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-13 00:14:10 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 2180 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-13 00:15:09 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 1058 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-13 00:16:06 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 1011 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-13 00:17:10 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 1050 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-13 00:18:09 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 1046 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-13 00:19:20 |
| Quiz 10 -- Solution.pdf Path: Mich Tech >> MA >> 2330 Fall, 2008 Description: ... Date Added: 2009-06-13 00:21:18 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 2058 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-13 00:21:20 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 1035 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-13 00:23:27 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 1051 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-13 00:24:38 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 2047 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-13 00:25:36 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 2020 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-13 00:26:44 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 1029 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-13 00:27:37 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 2074 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-13 00:28:32 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 2057 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-13 00:29:24 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 1014 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-13 00:30:24 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 2090 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-13 00:33:08 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 1025 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-13 00:34:11 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 1097 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-13 00:35:58 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 2087 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-13 00:36:51 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 1059 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-13 00:37:46 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 1074 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-13 00:38:39 |
| error.txt Path: Washington >> V >> 100 Fall, 2009 Description: Starting Glast-Gaudi job with job options file joboptions.txt Current time: Fri Dec 07 17:59:49 2007 ( 0 s elapsed) Area not found in title: assuming 60000 cm^2 Current time: Fri Dec 07 18:33:41 2007 ( 2032 s elapsed) ... Date Added: 2009-06-13 00:39:31 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 1047 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-13 00:39:37 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 1031 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-13 00:40:32 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 1030 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-13 00:41:27 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 1021 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-13 00:42:24 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 1045 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-13 00:43:16 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 1019 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-13 00:44:10 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 1055 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-13 00:45:11 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 2119 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-13 00:46:05 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 1032 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-13 00:46:59 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 2113 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-13 00:47:59 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 2134 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-13 00:48:54 |
| ch02.ppt Path: MTSU >> CS >> 4560 Fall, 2009 Description: Copyright 2007 Pearson Education, Inc. Publishing as Pearson Addison-Wesley Slide 2- 1 Chapter 2 Database System Concepts and Architecture Copyright 2007 Pearson Education, Inc. Publishing as Pearson Addison-Wesley Copyright 2007 Pearson Edu... Date Added: 2009-06-13 00:48:55 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 1028 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-13 00:49:49 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 1072 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-13 00:51:38 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 1091 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-13 00:52:35 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 2037 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-13 00:53:28 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 1037 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-13 00:54:19 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 1085 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-13 00:55:12 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 1098 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-13 00:56:04 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 2055 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-13 00:56:55 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 1065 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-13 00:57:48 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 1087 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-13 00:58:51 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 2040 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-13 00:59:44 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 2164 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-13 01:01:39 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 2068 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-13 01:02:32 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 1038 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-13 01:03:24 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 2128 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-13 01:04:18 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 1049 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-13 01:05:11 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 2156 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-13 01:07:04 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 2084 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-13 01:07:57 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 2028 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-13 01:08:52 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 1056 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-13 01:10:41 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 2103 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-13 01:12:29 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 2032 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-13 01:14:15 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 2086 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-13 01:15:08 |
| slac-pub-4621.pdf Path: Stanford >> PUBS >> 4500 Fall, 2009 Description: SLAC - PUB - 4621 CALT - 68 - 1495 May 1988 (4 FIRST ORDER OPTICAL MATCHING IN THE FINAL FOCUS SECTION OF THE SLAC LINEAR COLLIDER* C.M. California HAWKES Institute of Technology, 91125 \' Pasadena, California and P.S. BAMBADE Stanford Linear ... Date Added: 2009-06-13 01:15:42 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 2072 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-13 01:17:12 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 1080 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-13 01:20:51 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 2045 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-13 01:21:43 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 2060 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-13 01:22:35 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 2033 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-13 01:23:27 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 2051 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-13 01:24:22 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 2030 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-13 01:25:16 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 2092 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-13 01:26:09 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 1066 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-13 01:27:02 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 1027 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-13 01:27:55 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 2069 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-13 01:29:39 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 2146 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-13 01:30:33 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 1017 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-13 01:31:26 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 1088 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-13 01:32:23 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 2172 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-13 01:33:23 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 1015 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-13 01:34:20 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 2036 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-13 01:35:15 |
| 2900.txt Path: UNC >> DOCS >> 2900 Fall, 2009 Description: The Project Gutenberg EBook of The Age of Invention, by Holland Thompson This eBook is for the use of anyone anywhere at no cost and with almost no restrictions whatsoever. You may copy it, give it away or re-use it under the terms of the Project G... Date Added: 2009-06-13 01:37:52 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 1067 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-13 01:37:57 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 2111 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-13 01:38:54 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 1052 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-13 01:39:50 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 2155 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-13 01:40:45 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 1002 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-13 01:41:38 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 2023 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-13 01:42:33 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 2021 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-13 01:43:29 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 2136 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-13 01:44:23 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 2059 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-13 01:45:17 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 1018 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-13 01:47:07 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 2123 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-13 01:49:02 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 2046 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-13 01:49:57 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 2050 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-13 01:50:54 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 2091 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-13 01:51:49 |
| 27196-8.txt Path: UNC >> DOCS >> 27196 Fall, 2009 Description: The Project Gutenberg EBook of Cheap Postage by Joshua Leavitt This eBook is for the use of anyone anywhere at no cost and with almost no restrictions whatsoever. You may copy it, give it away or re-use it under the terms of the Project Gutenberg ... Date Added: 2009-06-13 01:52:22 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 1041 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-13 01:52:47 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 1069 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-13 01:53:46 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 2118 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-13 01:54:45 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 1095 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-13 01:56:37 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 1078 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-13 01:57:34 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 2173 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-13 01:58:30 |
| 26798.txt Path: UNC >> DOCS >> 26798 Fall, 2009 Description: The Project Gutenberg EBook of The Genus Pinus, by George Russell Shaw This eBook is for the use of anyone anywhere at no cost and with almost no restrictions whatsoever. You may copy it, give it away or re-use it under the terms of the Project Gut... Date Added: 2009-06-13 01:58:38 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 2109 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-13 01:59:28 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 2077 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-13 02:00:26 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 1008 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-13 02:01:20 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 1064 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-13 02:02:15 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 2181 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-13 02:03:10 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 2188 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-13 02:04:58 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 2110 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-13 02:06:47 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 2167 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-13 02:08:37 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 2182 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-13 02:09:28 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 2070 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-13 02:10:28 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 2193 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-13 02:12:16 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 2165 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-13 02:14:02 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 2098 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-13 02:14:57 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 2063 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-13 02:16:45 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 2034 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-13 02:17:45 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 2048 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-13 02:21:22 |
| solution2.ps Path: UCSC >> HW >> 107 Fall, 2009 Description: %!PS-Adobe-2.0 %Creator: dvips(k) 5.86 Copyright 1999 Radical Eye Software %Title: solution2.dvi %Pages: 5 %PageOrder: Ascend %BoundingBox: 0 0 612 792 %EndComments %DVIPSWebPage: (www.radicaleye.com) %DVIPSCommandLine: dvips -o solution2.ps solution... Date Added: 2009-06-13 02:22:14 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 2056 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-13 02:22:16 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 2024 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-13 02:23:08 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 2178 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-13 02:24:52 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 2154 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-13 02:26:41 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 2062 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-13 02:27:36 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 2078 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-13 02:28:29 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 1009 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-13 02:29:20 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 2029 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-13 02:30:15 |
| earth_structure.doc Path: UWO >> INSTRUCT >> 023 Fall, 2009 Description: Earth\'s Structure 24 October 2006 Today\'s Lecture Earth\'s Structure Seismology Layers Composition (crust and core) More minerals on the crust Geomagnetism The earth produces its own magnetic field through the motion of liquid iron near the centre o... Date Added: 2009-06-13 02:31:05 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 2044 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-13 02:32:07 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 2043 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-13 02:33:01 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 2065 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-13 02:33:54 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 2137 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-13 02:34:46 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 1071 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-13 02:37:31 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 2097 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-13 02:38:28 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 2112 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-13 02:39:21 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 2147 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-13 02:40:14 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 2061 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-13 02:41:07 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 1022 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-13 02:41:59 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 1063 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-13 02:42:53 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 2101 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-13 02:43:47 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 2082 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-13 02:44:41 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 2053 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-13 02:45:34 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 1036 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-13 02:46:28 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 1079 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-13 02:47:21 |
| apr02.pdf Path: Washington University in St. Louis >> WU >> 128 Fall, 2009 Description: Warm-up Problems - April 2, 2007 1. Use Newtons method to nd approximate the zero of the functions given: (a) f (x) = cos x x, x0 = 0. n xn = xn1 0 0 1 2 3 4 5 (b) f (x) = x 10 ln x, x0 = 1. n xn = xn1 0 1 1 2 3 4 f (xn1 ) f (xn1 ) f (xn1 ) f (xn... Date Added: 2009-06-13 02:48:27 |
| 6761_1.txt Path: Georgia Tech >> CS >> 8803 Fall, 2008 Description: Paper #: 5 Title: PeerCQ: A Decentralized and Self-Configuring Peer-to-Peer Information Montoring System Problem As of today, most of the P2P protocols like Freenet, Gnutella, scalable CAN, Pastry, Chord, etc. operate assuming that all the nodes... Date Added: 2009-06-13 02:48:49 |
| 0041_2.txt Path: Georgia Tech >> CS >> 8803 Fall, 2008 Description: Sharing, Discovering and Browsing Geotagged Pictures on the Web Problem Addressed:- This paper is targeted towards creating a framework for new applications to make use of an ever increasing abundance of digital photography that is becoming availab... Date Added: 2009-06-13 02:49:45 |
| DC2_J0951m5632Log.txt Path: Washington >> V >> 2064 Fall, 2009 Description: * PulsarSpectrum Log for pulsarDC2_J0951m5632 * Name : DC2_J0951m5632 * * Position : (RA,Dec)=(147.76,-56.54) ; (l,b)=(279.93,-1.95069) * * Flux above 100 MeV : 1.59e-008 ph/cm2/s * Enphmin: 10000 keV | Enphmax: 3e+008 keV ** * FT2 file u... Date Added: 2009-06-13 02:50:08 |
| Pol179.lec1.S09.pdf Path: UCSC >> POL >> 179 Fall, 2009 Description: The Atomic Enterprise: A Brief History and Political Economy Pol179.S09.lec1 1 A technological \"complex\" comprises an industrial infrastructure linked to research, development, accumulation, legitimation, and knowledge Pol179.S09.lec1 2 Ideolog... Date Added: 2009-06-13 02:52:22 |
| index.txt Path: Berkeley >> ASTRO >> 00313087 Fall, 2009 Description: 1.2600000 2.0999999 6.0660851 3.6110279 15.251412 2.1000001 2.9400001 8.4276804 0.56068561 592.94659 2.9400001 3.9199998 12.370192 -3.0179847 32328.270 ... Date Added: 2009-06-13 02:52:33 |
| Kripke Against the Descri.pdf Path: Colorado >> PHIL >> 4490 Fall, 2008 Description: Kripke Against the Descriptive Theory of Names Descriptive Theory of Names (DTN) Descriptive Theory of Meaning (DTM) Names are synonymous with definite descriptions Descriptive Theory of Reference (DTR) Names refer by virtue of speakers associa... Date Added: 2009-06-13 02:52:50 |
| Lec22_molions_2.pdf Path: Berkeley >> AY >> 216 Fall, 2009 Description: 22. Molecular Ions and Fractionation 1. Review of Gas Phase Chemistry 2. Introduction to Molecular Ions 3. The Detection of H3+ and the Cosmic-Ray Ionization Rate 4. Isotope Fractionation References Tielens, Secs. 8.8, 10.2, 10.4.4 Bergin & Tafalla, ... Date Added: 2009-06-13 02:53:07 |
| lecture-week7-slides.pdf Path: DePaul >> SE >> 547 Fall, 2009 Description: SE547: Lecture 7 Overview Overview Software Security Software Model Checking Logical Satisfaction Binary Decision Diagrams Implementing BDDs Software Security Secure software is intended to grant rights to users acting in certain roles. What are exa... Date Added: 2009-06-13 02:55:53 |
| Lectures_15-17.pdf Path: SMU - Cox School of Business >> EE >> 8373 Fall, 2009 Description: EE 8373 Digital Speech Processing Spring 2004 Lecture 15 Reading Quatieri: Ch. 12 R&S: Ch. 5 Fill out the feedback forms Feel free to do as many of the exercises as you want Play with speech files. Experiment. 1 Autocorrelation Pitch Detection th... Date Added: 2009-06-13 02:56:36 |
| SYNtotalINCOMING.xls Path: Columbia >> CS >> 6185 Fall, 2009 Description: Source 193.194.63.129 193.194.63.129 193.194.63.129 218.206.176.66 61.100.1.98 61.31.202.81 61.31.202.81 61.31.202.81 61.31.202.81 217.107.223.69 217.107.223.69 200.121.129.150 211.250.18.156 218.219.147.225 218.219.147.225 12.158.132.243 12.158.132.... Date Added: 2009-06-13 02:57:29 |
| T6-WD-E2D.doc Path: Oregon >> CIT >> 281 Fall, 2008 Description: Professor Carlisle\'s Student Report Student name: Tests: 1 2 George Mai 100 95 Total test points: 45 40 Total assignment points: Total points earned: % of total points possible: 195 Assignments: 1 2 85 280 93.33% ... Date Added: 2009-06-13 02:59:29 |
| Outline sys595 F-06.doc Path: Oakland University >> SYS >> 595 Fall, 2008 Description: Instructor: Office: Lecture: COURSE OUTLINE Fall 2006 SYS and EE 595, Automotive electronics Design CRN: 47221 Professor. Subra Ganesan 105 DHE, Phone: (248) 370-2206; Fax: 370 4625, Email: ganesan@oakland.edu 4:30 P.M. to 6:17P.M., on T, R, at Ford... Date Added: 2009-06-13 03:01:01 |
| comp4a.doc Path: ASU >> MATH >> 270 Fall, 2009 Description: MAT 270 Average Velocity: Computer Lab 4 Limits and the Derivative The net change in position of an object over an interval a t b divide by the change in time. It can also be thought of as the slope of the line joining the points on the graph of... Date Added: 2009-06-13 03:01:33 |
| OneEqualsTwo.pdf Path: Harvard >> MATHE >> 301 Fall, 2009 Description: ... Date Added: 2009-06-13 03:02:27 |
| PPTDemo.ppt Path: Pittsburgh >> CS >> 110 Fall, 2009 Description: Welcome Aboard to CS110 Taught By: In this lecture you will learn how to improve your PowerPoint Presentation via: Adding Multimedia. Adding Charts. Adding Sounds. Adding Special Effects. Animating Texts. Animating Objects. ... Date Added: 2009-06-13 03:02:42 |
| chapter 6 homework.doc Path: Kentucky >> EDP >> 660 Fall, 2008 Description: EDP 660 SUGGESTED HOMEWORK CHAPTER 6: Variable Screening Methods 1. 6.1, p. 334 2. 6.3, p. 334 3. 6.5, p. 336 ... Date Added: 2009-06-13 03:02:55 |
| Exercise 1 - od Exercise.doc Path: ETSU >> CSCI >> 2230 Fall, 2009 Description: od Exercise (24 points) In the directory ~pine/2230/od_demo, there are six files main executable that produce sample main.cc source code for main makefile makefile to create main sample data file that was analyzed in class problem1 first file fo... Date Added: 2009-06-13 03:04:51 |
| submit.txt Path: Washington >> V >> 11529 Fall, 2009 Description: <?xml version=\"1.0\" encoding=\"UTF-8\"?> <Error><Code>NoSuchKey</Code><Message>The specified key does not exist.</Message><Key>1930163d19e288b040e6fc32d06d312ea1984d41.txt</Key><RequestId>F7AD931EE87DD924</RequestId><HostId>eAHc7TI3x4mYzS8IP/ZZXRfKp+uY... Date Added: 2009-06-13 03:07:15 |
| output.txt Path: Washington >> V >> 11684 Fall, 2009 Description: = running on = COMPUTERNAME=B280WS11 - local directory - Volume in drive C has no label. Volume Serial Number is 9843-D647 Directory of C:\\condor\\execute\\dir_1612 12/03/2007 03:44 PM <DIR> . 12/03/2007 03:44 PM <... Date Added: 2009-06-13 03:07:49 |
| W7Bode-class.xls Path: UT Chattanooga >> ENGR >> 329 Fall, 2009 Description: f 0.01 0.01 0.02 0.03 0.05 0.1 0.2 0.4 0.8 A.R. P.A. 10 AR (lb/min/%) 1 0 0.01 freq (Hz) 0 -30 -60 -90 PA (deg) -120 -150 -180 -210 0 0.01 freq (Hz) -210 0 0.01 freq (Hz) 01 freq (Hz) 0.1 1 0.01 freq (Hz) 0.1 1 0.01 freq (Hz) 0.1 ... Date Added: 2009-06-13 03:10:32 |
| probeg.pdf Path: Tulane >> ECON >> 323 Fall, 2008 Description: PROBABILITY EXAMPLES 1. One ball is to be selected from a box containing red, white, blue, yellow and green balls. If the probability that the selected ball will be red is 0.2 and the probability that it will be white is 0.4, what is the probability ... Date Added: 2009-06-13 03:10:47 |
| T0462.t04.o_sep-logo.pdf Path: UCSC >> M >> 0462 Fall, 2009 Description: T0462.t04 o_sep 5 4 3 2 1 10 20 30 40 D G 5 4 3 2 1 D G D A D H I G D G D A D A 51 60 70 K A G D P A T V D H D A D 80 VC K IGNRN ITLRKREADLIEVEVVGGE L PL I LA 50 1 MK L SRLVP GVPARIKRLEVSGELHEKL V GM G FV P G EE I E I VQ V ... Date Added: 2009-06-13 03:11:15 |
| query5.txt Path: Wisconsin >> CS >> 564 Fall, 2008 Description: SELECT m.dname, Max(s.age) AS MAXAGE FROM student AS s, major AS m WHERE (s.sid)=[m].[sid]) GROUP BY m.dname; ... Date Added: 2009-06-13 03:11:37 |
| cultural approaches.ppt Path: Idaho State >> COMM >> 254 Fall, 2008 Description: Cultural Approaches COMM 254: Organizational Communication What is Culture? A complicated patchwork of meaning including. Assumptions Values Artifacts Symbols Rites and rituals Behaviors Etc. Who Studies Culture? Anthropologists Organizatio... Date Added: 2009-06-13 03:13:09 |
| ivan.doc Path: Cornell >> CS >> 632 Spring, 2008 Description: Project Proposal Ivan Oprencak After looking at XML and its possible applications, following is one idea that integrates both XML and databases. XML is being dubbed as the next great thing that will hit the Internet because of its potential to orga... Date Added: 2009-06-13 03:14:45 |
| ass6.pdf Path: Allan Hancock College >> STAT >> 3004 Fall, 2009 Description: Discipline of Mathematics The University of Queensland Probability Models & Stochastic Processes Assignment 6 Due in Week 7 (8/9/06) 1. Consider a place where, on any one day, the weather can be either sunny or rainy. However, both good and bad days... Date Added: 2009-06-13 03:15:02 |
| ps6.ps Path: Washington >> MATH >> 581 Fall, 2008 Description: %!PS-Adobe-2.0 %Creator: dvips(k) 5.86 Copyright 1999 Radical Eye Software %Title: ps6.dvi %Pages: 1 %PageOrder: Ascend %BoundingBox: 0 0 612 792 %EndComments %DVIPSWebPage: (www.radicaleye.com) %DVIPSCommandLine: dvips ps6.dvi -o ps6.ps %DVIPSParame... Date Added: 2009-06-13 03:15:14 |
| SSC101CoursePlan.pdf Path: Delta State >> SSC >> 101 Fall, 2009 Description: Delta State University Division of Social Sciences Social Sciences 101 Engaging the Social Sciences Course and Graduation Plan In this assignment, you will create a roadmap to get from this course to graduation. Your plan includes the courses that ... Date Added: 2009-06-13 03:16:27 |
| CL110 HW3 Possible Answers.doc Path: Skidmore >> CL >> 110 Fall, 2009 Description: CL110 C. Welser-9/17/2007 Possible Answers to Practice Review 1. 2. 3. 4. 5. 6. 7. We see the Roman sailors son in the fields. The boys are calling the girls today. O my daughter, he alway... Date Added: 2009-06-13 03:19:16 |
| oun12z.txt Path: University of Illinois, Urbana Champaign >> ATMOS >> 20081201 Fall, 2009 Description: UPPER AIR CALCULATIONS AND PLOTTING (Ver 5.48.1-LINUX-X11) Current filename: /mnt/noaaport/nwstg/convert/08120100_upa.wxp Date: 0000Z 1 DEC 08 Searching for KOUN. Searching the city database file for: KOUN . Date:0000Z 1 DEC 08 Station: KOUN... Date Added: 2009-06-13 03:20:55 |
| How Blast Works 022108.ppt Path: Hiram >> INTD >> 388 Fall, 2009 Description: How Blast Works Role of Word Size, T, & Scoring Matrix in Seeding Query: METGAAAALGMALAAGLGALGAAIGDGICTSKLLEGVARQPEARGQLMTLMFISVGLIESIPIIAVVVAFMLMGKIA Database entry#1: MEVGAAAAIATGLAVGLGALGAAVGDGICTGKAIESIARQPEAKGTIQTTMFISVGLIESIPIIAVVLAFMLFGKLG Dat... Date Added: 2009-06-13 03:21:57 |
| OurTreeMap.ppt Path: Arizona >> CS >> 227 Fall, 2008 Description: vti_encoding:SR|utf8-nl vti_timelastmodified:TR|16 Nov 2005 15:33:48 -0000 vti_title:SR|Computing Fundamentals with C+ vti_author:SR|mercer vti_modifiedby:SR|mercer vti_timecreated:TR|16 Nov 2005 07:16:13 -0000 vti_backlinkinfo:VX|lecture_outlines.ht... Date Added: 2009-06-13 03:22:09 |
| hw2.ps Path: Caltech >> EE >> 161 Fall, 2009 Description: %!PS-Adobe-2.0 %Creator: dvips(k) 5.92b Copyright 2002 Radical Eye Software %Title: hw2.dvi %Pages: 3 %PageOrder: Ascend %BoundingBox: 0 0 612 792 %DocumentFonts: Times-Roman Times-Bold CMMI10 CMMI8 CMMI6 CMR10 CMEX10 %+ CMR8 CMSY10 Times-Italic TeX-... Date Added: 2009-06-13 03:22:26 |
| mccabe_decadal.pdf Path: Colorado >> FEB >> 6833 Fall, 2009 Description: INTERNATIONAL JOURNAL OF CLIMATOLOGY Int. J. Climatol. 19: 1399 1410 (1999) DECADAL VARIATIONS IN THE STRENGTH OF ENSO TELECONNECTIONS WITH PRECIPITATION IN THE WESTERN UNITED STATES GREGORY J. McCABEa,* and MICHAEL D. DETTINGERb, US Geological Sur... Date Added: 2009-06-13 03:22:39 |
| Ch07.pdf Path: University of Louisiana at Lafayette >> JHR >> 7815 Fall, 2009 Description: Basics Compounding frequency affects rate of growth of savings or debt 7: Compounding Frequency $100 after 1 year at 18% per year compounded annually $118.00 $100 after 1 year at 18% per year compounded monthly $119.56 Lingua Franca (Language of... Date Added: 2009-06-13 03:22:51 |
| ARP.pdf Path: San Diego State >> GB >> 0607 Fall, 2009 Description: Administration, Rehabilitation and Postsecondary Education OFFICE: 3590 Camino del Rio North, San Diego, CA 92108-1716 TELEPHONE: 619-594-6115 http:/interwork.sdsu.edu/arpe/ In the College of Education Faculty Fred R. McFarlane, Ph.D., Professor of... Date Added: 2009-06-13 03:23:58 |
| R21.pdf Path: Wisc Stevens Point >> JHUBB >> 452 Fall, 2009 Description: ... Date Added: 2009-06-13 03:24:30 |
| Quiz 9 111804.doc Path: CSU Sacramento >> INDIV >> 1183 Fall, 2009 Description: OBE 118 Section 3 QUIZ #9 Fall 2004 November 18, 2004 1) Failing to hold meetings could be a factor in a corporation losing limited liability. True 2) A promoter of a corporation is personally liable for corporation debts incurred before incorporat... Date Added: 2009-06-13 03:24:41 |
| Lecture 5 Portfolio Analysis and the CAPM.doc Path: Yale >> AF >> 227 Fall, 2009 Description: Frazzini Lecture 6: Portfolio Analysis and the CAPM Goals of this lecture: - Understand the mathematics of zero cost portfolios, leverage, and Sharpe ratios. - Understand the logical connection between Sharpe ratios and alpha\'s. - Relate regression ... Date Added: 2009-06-13 03:25:59 |
| Referance.doc Path: East Los Angeles College >> U >> 0520982 Fall, 2009 Description: Page1of1 MS1304WebPage Name:KamranKhan StudentNumber:U0330664 10/12/2005 OnthisCDarethefilesusedtocreatemywebpage,itincludestheoriginalPhotoshopfiles, editedJPG,HTMLandPNGfiles. TheoriginalsandbackupsareallontheCD,alsoincludedisabriefreportonthefo... Date Added: 2009-06-13 03:27:00 |
| P09454 Detailed Design Review Packet.doc Path: RIT >> P >> 09454 Fall, 2009 Description: Fall February 08 09 P09454 Detailed Design Review Packet Kevin Klucher, Rishitha Dias, Reme Meck, John Hayles, Ammar Jangwarbala Dresser-Rand sponsored a senior design team in the academic year 2007-08 in the creation of a self-contained pump flow... Date Added: 2009-06-13 03:27:34 |
| Copy of Customer Needs Template.xlsx Path: RIT >> P >> 09454 Fall, 2009 Description: Revision #: Customer Need # CN1 CN2 CN3 CN4 CN5 CN6 CN7 CN8 CN9 CN10 CN11 CN12 CN13 CN14 CN15 CN16 CN17 CN18 CN19 1 Importance 1 2 2 1 1 3 2 2 3 2 1 1 1 1 2 Description Product must be intuitive and possible to be operated by student with the help o... Date Added: 2009-06-13 03:27:37 |
| a2.ps Path: Toledo >> DGP >> 180 Fall, 2009 Description: %!PS-Adobe-3.0 %Creator: groff version 1.15 %CreationDate: Thu Sep 28 20:11:03 2000 %DocumentNeededResources: font Times-Bold %+ font Times-Roman %+ font Times-Italic %+ font Courier %+ font Symbol %+ font Times-BoldItalic %DocumentSuppliedResources:... Date Added: 2009-06-13 03:30:23 |
| q8ans.ps Path: Washington >> Q >> 124 Fall, 2009 Description: %!PS-Adobe-2.0 %Creator: dvipsk 5.58f Copyright 1986, 1994 Radical Eye Software %Title: q8ans.dvi %Pages: 1 %PageOrder: Ascend %BoundingBox: 0 0 612 792 %DocumentPaperSizes: Letter %EndComments %DVIPSCommandLine: dvips q8ans.dvi -o q8ans.ps %DVIPSPar... Date Added: 2009-06-13 03:30:48 |
| FED_DCPackage_Evaluation_IIVV_F08a_T16_V6.0.doc Path: USC >> CSCI >> 577 Fall, 2009 Description: Feasibility Evidence Description DC Package Evaluation (12/14/08) A) Management Overview All risks to this point have been mitigated B) Technical Details No new technical details C) Technical, Project and Operational Risks No open risks D) Propose... Date Added: 2009-06-13 03:31:17 |
| PRO_FCP_F08a_T16_V2.0.pdf Path: USC >> CSCI >> 577 Fall, 2009 Description: Initial Prototype Report Team16 Version 2.0 Initial Prototype Report Theater Script Online Database Team #16 Jae Young Bang Gary Lam Young Chan Noh Ka Ho Au Shi Heng Guan Sandeep Mikkilineni Nory Kealii Nishimura John Christo... Date Added: 2009-06-13 03:31:24 |
| 10Cytoskeleton.doc Path: Marietta >> BIOL >> 309 Fall, 2009 Description: Biol 309 Test Question Bank Cytoskeleton Multiple Choice 1. All of the following statements are true of microtubules and actin filaments, EXCEPT: A. Both are necessary for cell division. B. Both are composed of globular subunits. C. `Motor\' protei... Date Added: 2009-06-13 03:32:30 |
| Homework-10-Phase3Testing.pdf Path: BYU >> CS >> 340 Fall, 2009 Description: Homework 10 Phase 3 Testing Do a black-box, system test of another teams Phase 3 Test Tracker implementation. Download the implementation assigned to you. Try to find as many bugs as you can and write a report describing the bugs you find. Each bug ... Date Added: 2009-06-13 03:32:54 |
| Chapter 1.ppt Path: Oregon State >> BA >> 360 Fall, 2008 Description: Chapter 1 - Financial Management Learning Objectives Describe the \"Cycle of Money\" Distinguish the four main areas of finance Discuss financial markets Discuss the financial management Identify the goal of finance Explain the interactions o... Date Added: 2009-06-13 03:33:10 |
| log.txt Path: Washington >> V >> 26500 Fall, 2009 Description: 000 (38586.000.000) 12/26 07:42:28 Job submitted from host: <128.95.94.28:1084> . 001 (38586.000.000) 12/26 09:27:37 Job executing on host: <172.25.101.188:1055> . 006 (38586.000.000) 12/26 09:47:45 Image size of job updated: 381032 . 005 (38586.000.... Date Added: 2009-06-13 03:36:07 |
| output.txt Path: Washington >> V >> 26500 Fall, 2009 Description: = running on = COMPUTERNAME=PHYSLAB-5Y4QNB1 - local directory - Volume in drive C has no label. Volume Serial Number is 9843-D647 Directory of C:\\condor\\execute\\dir_2760 12/26/2007 10:59 AM <DIR> . 12/26/2007 10:59 ... Date Added: 2009-06-13 03:36:47 |
| log.txt Path: Washington >> V >> 26500 Fall, 2009 Description: 000 (38788.000.000) 12/26 07:43:09 Job submitted from host: <128.95.94.28:1084> . 001 (38788.000.000) 12/26 11:15:38 Job executing on host: <172.25.101.46:1056> . 006 (38788.000.000) 12/26 11:35:46 Image size of job updated: 390656 . 006 (38788.000.0... Date Added: 2009-06-13 03:38:30 |
| T0216.t2k.dssp-ebghstl-logo.pdf Path: UCSC >> T >> 0216 Fall, 2009 Description: T0216.t2k dssp-ebghstl 3 2 1 CCC 216 S S X X X X X CT EESES B ES X CTEEC C C X X EE EC HHHHHHH CCCX C S X 220 230 240 250 T E 3 2 1 T H H T G T 260 KT IPS GKYPVLMR NTALLDLMEMFIPM I S A EN V Q KN L S PL K GK LG EQ V GN E EE X X C EH... Date Added: 2009-06-13 03:39:00 |
| COS230-lect-2007-09-21.pdf Path: Taylor IN >> CSE >> 230 Fall, 2009 Description: COS 230 Lecture Notes Brandle FALL 2007 -September 21, 2007 -AGENDA: 0 - Admin 1 Discussion: ECHO and Gaviotas section III 2 Gaviotas video --0 ADMIN -(5 minutes) Work for Monday Read AT Ch 3 Answer questions four and seven at the end of the ... Date Added: 2009-06-13 03:40:28 |
| engl202-ingram-sp1.pdf Path: Campbell >> MAIL >> 148 Fall, 2009 Description: English 202 British Literature II Syllabus Campbell University Distance Learning Prerequisite: English 102 Instructor: Tiffany Ingram Term: Spring 1 January 5 February 28 E-mail: ingramt@campbell.edu Alternate E-mail: ingrams@skynet.be COURSE REQUI... Date Added: 2009-06-13 03:42:12 |
| me320fi_fl06.pdf Path: New Mexico >> ME >> 320 Fall, 2009 Description: Mechanical Engineering ME320L Fall 2006 nal test Closed book. Formula sheet and calculator allowed Name: 1 Part 1: Multiple choice questions Attempt all of these questions. Do not give random answers. Random answers will be assigned a score homog... Date Added: 2009-06-13 03:42:54 |
| qz3sol.pdf Path: UC Riverside >> CS >> 120 Fall, 2009 Description: CS120A Quiz #3 Summer 1 2004. Dr. Hwang Given July 14, 2004. 1. Synthesize a modulo-5 up/down counter using D flip-flops. The count is represented by the contents of the flip-flops. There is one input Down that determines the direction of the count.... Date Added: 2009-06-13 03:45:39 |
| Profs Ch 10.doc Path: Texas >> ED >> 846 Fall, 2009 Description: Chapitre 10 Pages des profs Phontique-Chapitre 10 You will hear 10 pairs of words. Decide whether the first word or the second word of the pair contains a nasal vowel. 1. main/ma 2. bonne/bon 3. cette/sainte 4. cadeau/bandeau 5. personne/raison 6. m... Date Added: 2009-06-13 03:45:49 |
| Extra_Practice_Rational_Inequalities.pdf Path: CofC >> MATH >> 111 Fall, 2008 Description: Math 111 Extra Practice Rational Inequalities Solve the following rational inequalities. Get a common denominator in order to rewrite the inequality as a single rational expression compared to zero, if it isnt already in this form. Factor the numer... Date Added: 2009-06-13 03:48:58 |
| Math 121 Chapter3 Section1 Handout.doc Path: University of South Dakota >> MATH >> 121 Fall, 2008 Description: Chapter 3, Section 1 Handout In algebra, we solve equations for a particular value of a variable; in calculus, we are interested in how a change in one variable affects another variable. For example, how does the length of skid marks change if we inc... Date Added: 2009-06-13 03:50:22 |
| Section 1.3 summer.ppt Path: Kennesaw >> DCG >> 8882 Fall, 2009 Description: Section 1.3 Linear Functions and Slope Linear Functions They can be written f(x) = m(x) + b Slope What happens if m=0? What happens if m=1 and b=0? y-intercept includes the sign Special Linear Relations Horizontal lines Have the equation f(x)=b... Date Added: 2009-06-13 03:50:25 |
| discussion.txt Path: California State University, Monterey Bay >> CS >> 241 Fall, 2009 Description: The goal of this assignment was to enhance our tutor program so it could handle timer and serial interrupts. The very first thing we have done to implement tickpack.c was to copy the timer file from a previous homework and modify it. We got the ide... Date Added: 2009-06-13 03:50:49 |
| Chelsea - Nature Tourism in Texas.ppt Path: Texas A&M >> RPTS >> 426 Fall, 2008 Description: Nature Tourism in Texas Issues in Private Farms Today: Significant decline in the number of people living on farms over the last couple of decades Decline in the number of farms and ranches with globalization, urbanization and modernization Ad... Date Added: 2009-06-13 03:51:18 |
| 380.56ch4solns-S06.pdf Path: Illinois State >> CHE >> 38056 Fall, 2009 Description: CHE 380.56 Spring 2006 Chapter 4 Review Problem Solutions 1. For each example, how many times will the loop be executed? a. DO 10 I = 10, 10 This loop will be executed only 1 time since the START and STOP values are the same. b. DO 10 I = 1, 10, 3 Th... Date Added: 2009-06-13 03:53:50 |
| Proactive_Evaluation_One_Kindergarten_1.pdf Path: Wisc Stevens Point >> JWUST >> 436 Fall, 2009 Description: ... Date Added: 2009-06-13 03:54:50 |
| gp3.doc Path: VMI >> CH >> 132 Fall, 2009 Description: 1 Homework Submission Form CH 132-3, 5,and 6 Section # (3, 5, or 6): Turner or Addington: Group #:3 Group Members:Richy Palmer, Sam Carney, Conor Evans, Andrew Gordon Group Assignments:chapter 4 Answers to Questions (Indicate # and Write Out Questio... Date Added: 2009-06-13 03:55:00 |
| FDR 10th November.ppt Path: Utah State >> INST >> 5245 Fall, 2008 Description: Moving into the Future Peter Lieber | Peter Henderson | Conner Egbert Agenda Introduction High Level Project Design Overview Subsystems Review Remaining Schedule Societal Impacts General Requirements Control of trains with fast response ... Date Added: 2009-06-13 03:55:10 |
| final-sample.pdf Path: CSU Channel Islands >> CS >> 222 Fall, 2009 Description: ... Date Added: 2009-06-13 03:55:15 |
| quiz2.pdf Path: Utah >> MATH >> 2270 Summer, 2008 Description: Quiz #2 Math 2270, Spring 2005 (10 points) Problem 1. Let A be a 3 6 matrix 0 0 0 1 2 0 A= 1 2 2 Its reduced row echelon form is 1 2 0 0 1 -1 1 rref(A) = 0 0 1 0 -1 0 0 0 1 2 -1 (a) Find a basis for Ker(A) and the dimension of Ker(A). given by... Date Added: 2009-06-13 03:55:21 |
| h1.pdf Path: University of Illinois, Urbana Champaign >> ECE >> 586 Fall, 2008 Description: ECE 586TB Correspondence # 1 FALL 2008 September 3, 2008 ASSIGNMENT 1 Reading Assignment: Advance Reading: Baar s Owen: Chps I Olsder: Chp 2 (remaining sections), chp 3 (sects. 1-4). s Problems (t... Date Added: 2009-06-13 03:56:35 |
| Tequila Powerpoint 2009 revised.pdf Path: UMBC >> HMGT >> 182 Fall, 2009 Description: HMGT 182 Beverage Operations Spirit Identification How are they made? Review. Laura decided to drink a bottle of Scotch one evening (along with some close personal friends). The next morning she discovered her breath had a slightly smoky quality. W... Date Added: 2009-06-13 03:56:51 |
| T0380.t06.CB8-sep9-logo.pdf Path: UCSC >> T >> 0380 Fall, 2009 Description: T0380.t06 CB8-sep9 3 2 1 D A J IHMJKH G H KH J BFA EEABE JHHIMJ MGILLG AA H A K M A AEB D BCF HMMNNG HGG M MGHG F BB G B C C C D D D X X X XXBCXCCXXCAXXXGNHGXXXXXXXXXXXNMXXXXXCCXXXGNN X X X X X X ABA B B D A X D X D F C E K F D G F B E E D G G ... Date Added: 2009-06-13 03:57:31 |
| Stacks_and_Queues.ppt Path: Benjamin Franklin Institute of Technology >> CSE >> 5100 Fall, 2009 Description: Data Structures and Algorithms Stacks and Queues 1 Guidelines for Selecting ADT Operations Completeness - Every ADT must be complete. It must include enough operations, including ADTconstructors, to build every possible value of the domain. Test... Date Added: 2009-06-13 03:57:37 |
| heimlich quiz.pdf Path: N. Michigan >> CS >> 255 Fall, 2008 Description: Rescue Breathing and Heimlich Maneuver Quiz-Erin Johnson Instructions: Identify whether the picture is part of the Heimlich maneuver technique or the rescue breathing technique. Write a brief description of the step in the process. a. b. c. d. e... Date Added: 2009-06-13 03:58:17 |
| Exam2.pdf Path: Sanford-Brown Institute >> MATH >> 520 Fall, 2009 Description: 1. Exam 2 Solutions Problem 1: We use Lagrange interpolation. Set (x - 2)(x - 3) (x - 1)(x - 3) (x - 1)(x - 2) , f2 (x) = , f3 (x) = f1 (x) = (1 - 2)(1 - 3) (2 - 1)(2 - 3) (3 - 1)(3 - 2) Then p(x) = 3f1 (x) + 7f2 (x) + 13f3 (x). All that remains is s... Date Added: 2009-06-13 03:58:45 |
| b6f-118.pdf Path: Texas El Paso >> MATH >> 0608 Fall, 2009 Description: College of Science Bell Hall 100 747-5536 The University of Texas at El Paso El Paso, Texas 79968-0509 Bachelor of Science Degree Plan Mathematics - Geological Science Minor (128/45) Name Major: Mathematics Department Chair: Dr. Helmut Knaust Addr... Date Added: 2009-06-13 04:00:38 |
| b6f-419.pdf Path: Texas El Paso >> MATH >> 0608 Fall, 2009 Description: College of Science Bell Hall 100 747-5536 The University of Texas at El Paso El Paso, Texas 79968-0509 Bachelor of Science Degree Plan Applied Mathematics - Management Minor (128/45) Name Major: Mathematics Department Chair: Dr. Helmut Knaust Addr... Date Added: 2009-06-13 04:00:40 |
| argument rubric.doc Path: IUP >> ENGLISH >> 100 Fall, 2009 Description: ENGL100 Basic Writing Rubric for Argument Essay/Portfolio Target (A to B+) THE PRODUCT Focus (presents an argument) Developing the Argument Thesis strong and clear. If not stated at beginning, writer consistently builds up the idea (like Sanders in \"... Date Added: 2009-06-13 04:01:54 |
| Results for exams 13 Spring 2007.pdf Path: Ill. Chicago >> PCOL >> 331 Fall, 2008 Description: Results for exams 1-3 Spring 2007 ID # 3300 3301 3302 3303 3304 3305 3306 3307 3308 3309 3310 3311 3312 3313 3314 3315 3316 3317 3318 3319 3320 3321 3322 3323 3324 3325 3326 3327 3328 3329 3330 3331 3333 3334 3335 3336 3337 3338 3339 3341 3342 3343 3... Date Added: 2009-06-13 04:02:30 |
| Converting to NTFS.txt Path: Wisc Whitewater >> ITBE >> 452 Fall, 2008 Description: Converting to NTFS Your hard drive must be formatted with a file system such as FAT, FAT32 or NTFS so that Windows can be installed on to it. This system determines how files are named, organised and stored on the drive. If youre not using it alread... Date Added: 2009-06-13 04:03:07 |
| Group9final.ppt Path: SUNY Buffalo >> GROUP >> 413 Fall, 2009 Description: Boundary detection in sensor networks for phenomenon classification GROUP MEMBERS : AKSHAY BALASUBRAMANIAN NANDAKUMAR P VENUGOPAL SATISH RAMASWAMI SALEM INSTRUCTOR : Dr PaoLo Liu TA : Mr Saurav Bandyopadhyay Presentation overview ... Date Added: 2009-06-13 04:04:15 |
| Frampton_Critical Regionalism.pdf Path: Texas Tech >> ARCH >> 5362 Fall, 2008 Description: ... Date Added: 2009-06-13 04:04:26 |
| Rivkin_Intro to Deconstruction.pdf Path: Texas Tech >> ARCH >> 5362 Fall, 2008 Description: ... Date Added: 2009-06-13 04:04:27 |
| algebra_linalg.pdf Path: NMT >> M >> 335 Fall, 2009 Description: Facts on Algebra and Linear Algebra linear algebra: determinants: Formulas for the 2 2 case a c b d Formula for the 3 a11 a21 a31 a12 a22 a32 a13 a23 a33 3 case = a11 a22 a33 +a12 a23 a31 +a13 a21 a32 a31 a22 a13 a21 a12 a33 a11 a32 a23 i+j = ad b... Date Added: 2009-06-13 04:06:35 |
| chw4_sol.pdf Path: NMT >> M >> 491 Fall, 2009 Description: M491 HW 4 solutions Problem 1: Consider the matrix 0 A=@ 1 0 0 1 1 A 1 1 J1 0 0 J2 1 0 0 (1) Compute A2 and A3 by hand. A can be written in block diagonal form, A = J1 = ( 1), J2 = 1 1 1 1 , where and the 0 entries represent zero maVerify tha... Date Added: 2009-06-13 04:06:36 |
| factbook_0607.pdf Path: UNI >> FACTBOOK >> 0607 Fall, 2009 Description: 2006-2007 Fact Book Office of Institutional Research The University of Northern Iowa offers a world-class university education, providing personalized experiences and creating a lifetime of opportunities. Quick Reference University President.. Benja... Date Added: 2009-06-13 04:09:56 |
| ch12_1_Cardiovascular_Disease.ppt Path: Neumont >> SINF >> 3223 Fall, 2009 Description: Chapter 12 Cardiovascular Disease Reducing Your Risks NON-COMMUNICABLE DISEASES Degenerative Diseases: diseases that significantly threaten health/wellness chronic illness lifestyle / genetic factors Cardiovascular Diseases Found in Heart and B... Date Added: 2009-06-13 04:11:29 |
| Week 1Agenda.doc Path: CSU Northridge >> MSE >> 508 Spring, 2009 Description: Week 1 MSE508/L Spring 2008 Introduction to course Checking that students have accounts. ... Date Added: 2009-06-13 04:11:33 |
| Hildegard Peplau Hache et Doiron.ppt Path: Neumont >> SINF >> 3023 Fall, 2009 Description: HILDEGARD PEPLAU Relations Interpersonnelles Prsent par: Rachel Doiron Fanny Hach Plan de la prsentation Historique Dfinition du nursing Quatre grands concepts Thorie Les six rles majeurs de l\'infirmire Relation infirmireclient O... Date Added: 2009-06-13 04:11:38 |
| exam296.doc Path: Texas Tech >> ANSC >> 4403 Fall, 2008 Description: ANSC 4403 Beef Production Exam II March 15, 1996 Use the space allotted to answer these questions. The time limit for this test is 60 minutes. Part I. (20 points) Briefly define or explain the following terms: a. scrotal circumference b. EPD c. MPP... Date Added: 2009-06-13 04:12:11 |
| gamble.pdf Path: CSU San Marcos >> ID >> 340 Fall, 2009 Description: \"The Fifty Million Dollar Gamble\" (c) 1995 The Merrow Report BRANDT: It\'s the people who make the difference. And if teachers don\'t realize they make a difference in children\'s lives I don\'t want them in the building, I don\'t want them on my faculty ... Date Added: 2009-06-13 04:17:02 |
| 3-l.ps Path: University of Illinois, Urbana Champaign >> CSRPLAN >> 980212 Fall, 2009 Description: ... Date Added: 2009-06-13 04:21:34 |
| prob3.ps Path: Maryland >> ASTR >> 601 Fall, 2008 Description: %!PS-Adobe-2.0 %Creator: dvipsk 5.58f Copyright 1986, 1994 Radical Eye Software %Pages: 2 %PageOrder: Ascend %BoundingBox: 0 0 612 792 %DocumentPaperSizes: Letter %EndComments %DVIPSCommandLine: dvips -f %DVIPSParameters: dpi=1200, comments removed %... Date Added: 2009-06-13 04:25:34 |
| chapter4RQ.pdf Path: LSU >> CSC >> 1100 Fall, 2008 Description: Chapter 4 Software Basics: The Ghost in the Machine Multiple Choice 1. A set of computer instructions designed to solve problems is known as a(n) a. program. b. instruction code. c. computer instruction set. d. procedure. e. code set. 2. Which of the... Date Added: 2009-06-13 04:25:49 |
| Spring 2005 Test 3.pdf Path: Baylor >> CSI >> 4337 Spring, 2008 Description: CSI 4337 Exam #3 (final) May 5, 2005 Eight Pages Name_ All questions are worth 10 points. Maximum score: 100. 1. Is the following system in a safe state? If so show the safe sequence otherwise, list the processes that cannot be added to the safe s... Date Added: 2009-06-13 04:26:02 |
| Class 27 Notes.ppt Path: Oregon State >> PH >> 106 Fall, 2008 Description: The Energy of the Strong Nuclear Force Stronger forces require more energy to overcome them-to separate the pieces being bound together. Consider the force binding each of several different masses to the earth. Now consider the force binding each of ... Date Added: 2009-06-13 04:26:08 |
| Review_Model_Hotel_Revenue.xlsx Path: Uni. Westminster >> AKS >> 0605 Fall, 2009 Description: NumberofDays NumberofRooms OccupancyRates DailyPrice VariableCost FixedCost NumberofRoomDays 365 100 95% $105 $35 $500,000 34,675 75% $135 55% $175 Revenue VariableCost FixedCost NetProfit 27,375 20,075 HighRates MidRates LowRates $3,640,875 $... Date Added: 2009-06-13 04:28:24 |
| virtualquiz.pdf Path: St. John Fisher >> KEEP >> 00556 Fall, 2009 Description: EasyTestMaker http:/easytestmaker.com/user/TestPrint.aspx?TestID=b323e462-44e4-4b6. Coordinate Points Quiz Name: Date: 1) What quadrant is the ordered pair (-5,3) located in? a) Quadrant 1 b) Quadrant 2 c) Quadrant 3 d) Quadrant 4 2) What is the eq... Date Added: 2009-06-13 04:28:36 |
| Quiz4s.pdf Path: Air Force Academy >> COMP >> 2300 Fall, 2009 Description: COMP 2300 Discrete Structures for Computing, Fall 2008 October 27, 2008 Quiz #4 (Solution) Consider the recursively defined sequence a1 = 1, an = an-1 + 2n - 1, n Z, n 2 (a) Compute the first five terms of the sequence (3 pts.) a1 = 1 a2 = a1 + 2... Date Added: 2009-06-13 04:29:42 |
| ch07.ppt Path: Auburn >> MT >> 4360 Fall, 2009 Description: Chapter 7 Data Collection: Primary Data Harcourt, Inc. items and derived items copyright Harcourt, Inc. Transparency 7.1 Behavior Checklist Purchase Behavior Use Behavior What How Much How Where When Who Harcourt, Inc. items and derived i... Date Added: 2009-06-13 04:32:03 |
| C476- The Art of Requirements Triage.ppt Path: Winthrop >> CSCI >> 476 Spring, 2008 Description: The Art of Requirements Triage By Alan Davis Computer, March 2003 The Problem Marketing wants requirements Developers want more time Responses Outcomes Triage a solution Triage Establish priorities Estimate resources Select subset of requi... Date Added: 2009-06-13 04:35:00 |
| COIT12169_TAns7.rtf Path: Allan Hancock College >> COIT >> 12169 Fall, 2009 Description: #C#COIT12169_TAns7.rtf#Z[s#~#bw#ruK[I#`Ip#i#F #VV U% #6wriin M kG#H y_d\"/UUM_#< Jm^6`Wmm#{? w^#\')~# 7wulzr#IC29Gro#d*;P)u#:zHsCsq HxK#:9A#=H#t#K#i#iZM^I 6 /#N#Hg#d7#y 9%27#sK~a7W{>u4,`vO#:q>@#eBBI NJ... Date Added: 2009-06-13 04:36:34 |
| 01_lab.pdf Path: Allan Hancock College >> COIT >> 12167 Fall, 2009 Description: COIT12167 DATABASE USE AND DESIGN Week 2 Lab Sheet 10 March 2003 Autumn 2003 I. Using Microsoft Access Before you start you will need to download a Microsoft Access database file, named VirutalHospital.mdb, from the course website: http:/www.infoc... Date Added: 2009-06-13 04:37:06 |
| Practice Exam V Solutions.doc Path: McNeese >> PH >> 201 Fall, 2009 Description: Practice Exam V PH 1123 Spring 2004 1. An ideal gas is held at a constant pressure of 1.013 x 105 Pa while its volume is tripled from its initial value of 0.25 m3. a. b. What kind of process is this? _isobaric_ What is the change in internal energy... Date Added: 2009-06-13 04:37:40 |
| 4460 Lab Lecture 4 2008.ppt Path: Auburn >> ENG >> 4460 Fall, 2009 Description: Choosing Property Models CHEN 4460 Process Synthesis, Simulation and Optimization Dr. Mario Richard Eden Department of Chemical Engineering Auburn University Lab Lecture No. 4 Selection of Property Models October 7, 2008 Contains Material Develo... Date Added: 2009-06-13 04:38:25 |
| az_emis.xls Path: UC Riverside >> PAH >> 308 Fall, 2009 Description: AZ01 AZ02 AZ03 name LCC X (km) LCC Y (km) Stack height(m) Elevation (m) Arizona Electric Power Cooperative -1251.350 -800.202 47.854 1280.160 Arizona Electric Power Cooperative -1251.350 -800.202 121.920 1280.160 Arizona Electric Power Cooperative -... Date Added: 2009-06-13 04:38:45 |
| LtrMillerTrafficking.pdf Path: Clarkson >> ANTH >> 394 Fall, 2009 Description: April 21, 2005 Ambassador John Miller Director, Office to Monitor and Combat Trafficking in Persons U.S. Department of State Washington, DC Fax: (202) 312-9637 Dear Ambassador Miller: We are writing with regard to the State Department fact sheet ent... Date Added: 2009-06-13 04:39:37 |
| derivative.ppt Path: Allegheny >> E >> 440 Fall, 2009 Description: ... Date Added: 2009-06-13 04:40:14 |
| meyer1.doc Path: Texas >> MCD >> 0105 Fall, 2009 Description: Solar SFE project How we use Big Sun Model We have constructed a large 2D model of the Sun on butcher paper. See http:/eyeonthesky.org/lessonplans/03sun_howbig.html for construction details. Using mathematical concepts, symbols, and scale models, stu... Date Added: 2009-06-13 04:42:17 |
| Scanned.pdf Path: Clarkson >> TC >> 220 Fall, 2009 Description: ... Date Added: 2009-06-13 04:45:33 |
| nrinv_shipping.vistas2002_rev_100104.ida.txt Path: UC Riverside >> BASE >> 308 Fall, 2009 Description: #IDA #TYPE Area Source Emissions Inventory #COUNTRY US #YEAR 2002 #DESC 2002 Nonroad Mobile Source Inventory #DESC File created for VISTAS Revised Phase II Base Year Modeling #DESC Includes 2002 VISTAS Nonroad Mobile Source Emiss... Date Added: 2009-06-13 04:46:10 |
| az_emis.xls Path: UC Riverside >> CERT >> 308 Fall, 2009 Description: AZ01 AZ02 AZ03 name LCC X (km) LCC Y (km) Stack height(m) Elevation (m) Arizona Electric Power Cooperative -1251.350 -800.202 47.854 1280.160 Arizona Electric Power Cooperative -1251.350 -800.202 121.920 1280.160 Arizona Electric Power Cooperative -... Date Added: 2009-06-13 04:46:50 |
| lab4.txt Path: Duke >> X >> 006 Fall, 2009 Description: - Grade summary for $studentName on $asgn Your score is $score (out of 10). The following things were noted (see below): $errors Your assignment was graded by $graderName. -- ASSIGNMENT NOTES * General 1.1 No program submitted -6 1.2 Pr... Date Added: 2009-06-13 04:46:59 |
| 07-HW5.doc Path: Rose-Hulman >> PH >> 113 Fall, 2009 Description: vti_encoding:SR|utf8-nl vti_author:SR|JOENATHA-3\\joenatha vti_modifiedby:SR|JOENATHA-3\\joenatha vti_timelastmodified:TR|25 Apr 2007 23:42:02 -0000 vti_timecreated:TR|25 Apr 2007 23:42:02 -0000 vti_cacheddtm:TX|25 Apr 2007 23:42:02 -0000 vti_filesize:... Date Added: 2009-06-13 04:48:31 |
| HW2 solution.pdf Path: University of Illinois, Urbana Champaign >> BRL >> 473 Fall, 2009 Description: ECE 473/TAM 413 Homework Assignment #2 Solutions 1. The tension in a string is provided by hanging a 3-kg mass at one end; the other end is rigidly fixed. The length of the string is 2.5 m and its mass is 50 g. Determine the phase speed of waves on t... Date Added: 2009-06-13 04:48:54 |
| fallon, carmela.ppt Path: St. Josephs NY >> MGT >> 520 Fall, 2009 Description: A Team Based Organization for My Department Organizational Theory and Design Professor William Coty Keller, PhD December 5th, 2007 Carmela M. Fallon, RN Introduction IPRO is a not for profit corporation with Medicare and Medicaid cont... Date Added: 2009-06-13 04:51:38 |
| UI400_CHAPTER_04_STUDENT.pptx Path: SEMO >> UI >> 400 Fall, 2009 Description: Chapter 04 ClicktoeditMastersubtitlestyle The Institutionalization Of Business Ethics Institutionalization in Business Ethics n n Institutionalization in business ethics relates _ __ _ _ _ Institutions provide _ _ _ __ Voluntary Boundary, Core P... Date Added: 2009-06-13 04:52:17 |
| bigotry.pdf Path: Minnesota >> ELAMI >> 001 Fall, 2009 Description: Names will be repressed and only initials will be inserted to protect the reputation of the people involved in this incident. This repression is consistent with a court order as the legal proceedings are still under way. The bigotry of A. S. Place: ... Date Added: 2009-06-13 04:52:23 |
| rfc0781.txt Path: Arkansas Tech >> CS >> 4303 Fall, 2009 Description: RFC 781 Zaw-Sing Su SRI May 1981 A SPECIFI... Date Added: 2009-06-13 04:54:25 |
| rfc1032.txt Path: Arkansas Tech >> CS >> 4303 Fall, 2009 Description: Network Working Group M. Stahl Request for Comments: 1032 SRI International November 1987 DOMAIN ADMINISTRA... Date Added: 2009-06-13 04:54:45 |
| P-Set01SS09.pdf Path: Hamline >> CH >> 1140 Fall, 2009 Description: Chem 1140 1. 2. See pages 372-388 of Chapter 10. P-Set 1 solution 3. Too hard to draw the lewis structure here, so a written description will have to suffice. a) Single bonds between each Cl and the central carbon, each Cl has 3 lone pairs. KX4 . ... Date Added: 2009-06-13 04:55:21 |
| measurement.ppt Path: SUNY Brockport >> PAD >> 688 Fall, 2009 Description: Measurement & Operationalization PAD 688: Research and Program Evaluation Main Teaching Points q q q q Review: Fundamentals of Management Research Anything Can Be Measured Levels of Measurement (nominal, etc.) Basic Measurement Rules exhaustive an... Date Added: 2009-06-13 04:55:36 |
| robison_bio.pdf Path: Allan Hancock College >> DOCS >> 1010 Fall, 2009 Description: POLICY RESEARCH FORUM Regulating the informal security sector Richard Robison is Emeritus Professor at Murdoch University, Western Australia and was previously Professor of Political Economy at the Institute of Social Studies in The Hague from 200320... Date Added: 2009-06-13 04:55:52 |
| Lab9_graduate.doc Path: Wisconsin Milwaukee >> GEOG >> 525 Spring, 2008 Description: vti_encoding:SR|utf8-nl vti_timelastmodified:TR|24 Mar 2008 19:53:38 -0000 vti_extenderversion:SR|6.0.2.8161 vti_backlinkinfo:VX|Geog525_08/Geog525_Assign.htm ... Date Added: 2009-06-13 04:56:31 |
| Fully Differential Amplifier.docx Path: Dallas >> EE >> 082000 Fall, 2009 Description: Fully Differential Amplifier Gain stage CMFB Output stage Biasing circuit Loads Voltage reference circuit Current reference circuit Sources of the proposed circuit Reference papers, textbooks, lecture notes and others ... Date Added: 2009-06-13 04:57:18 |
| hw8solution.pdf Path: George Mason >> ECE >> 646 Fall, 2008 Description: ECE646 Cryptography and Computer Network-Security Fall 2007 HW # 8 Solution 1. (10 points) Verify that Eulers theorem holds in Zm , m = 7, 10 for all elements a for which gcd(a, m) = 1. Also verify that the theorem does not hold for elements a for... Date Added: 2009-06-13 05:00:37 |
| regist.txt Path: New Mexico >> ECE >> 438 Fall, 2008 Description: library IEEE; - make library visible use IEEE.STD_LOGIC_1164.all; - interested in STD_LOGIC stuff entity REGIST is - rgister\'s name is REGIST port ( - 32 bit input value IN_VAL : in STD_LOGIC_VECTOR ( 3... Date Added: 2009-06-13 05:01:34 |
| example1lect4bodeplot.pdf Path: SPSU >> ECET >> 2310 Fall, 2009 Description: ... Date Added: 2009-06-13 05:03:28 |
| Ch27b.pdf Path: Utah State >> CHEM >> 3600 Fall, 2009 Description: Combustion Methods Combustion analysis is used to determine elemental content of organic compounds burned in excess O2 Most often used for C/H content: C x H y(g) + O 2(g) x CO 2(g) + 0.5 y H 2 O(l) Chloride Detected in Tree Rings Using Combustio... Date Added: 2009-06-13 05:03:58 |
| Nate Trade study proposal.doc Path: Oakland University >> ME >> 463 Fall, 2009 Description: INDIVIDUAL TRADE STUDY PROPOSAL: FRICTION Nathaniel Barbera Toteable, Potable Water, Inc September 19, 2006 Toteable, Potable Water, Inc is committed to creating a human-powered water still that uses heat generated from friction to boil water. A few ... Date Added: 2009-06-13 05:04:32 |
| TC5p2.pdf Path: CSU Northridge >> M >> 24771 Fall, 2009 Description: 7. /5 CHAPTER 5 Test-Quiz DUE Oct 23, 2007 Name: YOUR work justifying answers MUST be shown. 3 4 Solve the ineqality ) # ) x+1 x !1 8. /6 x3 + x2 ! 2 For the rational function given by f(x) = ) , x2 + 1 a. y-intercepts b. x-intercepts FIND ALL (... Date Added: 2009-06-13 05:05:15 |
| 10.testing.ppt Path: Harvey Mudd College >> CS >> 121 Fall, 2000 Description: Test Pl ans > > >Compilation was successful Thi s does not mean the code i s debugged! Test Dr i ven Devel opment I wr i te tests for new code code test wr i te new code test vaul t test new code Test Dr i ven Devel opment I I test new code wr... Date Added: 2009-06-13 05:05:57 |
| s03v301.ps Path: Maryland >> CMSC >> 420 Fall, 2005 Description: %!PS-Adobe-2.0 %Creator: dvips(k) 5.86 Copyright 1999 Radical Eye Software %Title: s03v301.dvi %Pages: 24 %PageOrder: Ascend %BoundingBox: 0 0 612 792 %EndComments %DVIPSWebPage: (www.radicaleye.com) %DVIPSCommandLine: dvips s03v301.dvi %DVIPSParamet... Date Added: 2009-06-13 05:05:58 |
| Labor Market Homework 2.pdf Path: Kenyon >> ECON >> 102 Fall, 2009 Description: Spring 2009 Name: _ Section (circle one): 10:10 11:10 Labor Market Homework 2 Due by 4:00 p.m. Friday, January 30 1) In their November 23, 2003 Los Angeles Times article, Abigail Goldman and Nancy Cleeland discuss the mixed blessings Walmart has be... Date Added: 2009-06-13 05:06:08 |
| 10_GraphingGuide&HW.pdf Path: ASU >> MATH >> 270 Fall, 2009 Description: ... Date Added: 2009-06-13 05:06:25 |
| Lab05.pdf Path: Penn State >> PHYS >> 250 Fall, 2008 Description: % x y ryqY p p T Y Ygp w x Y V f Q ff pp V @ s Y x f y w f y Y Yw V rf p s Y Yw w w fx f Y f w w w w ns Y x Y Y $ f x w w x x x f 4 x f q d | s x f Y Xy ... Date Added: 2009-06-13 05:07:02 |
| forxplrQ.xls Path: UMKC >> BDS >> 545 Fall, 2008 Description: ORIGINAL TIME SERIES 80.000 70.000 60.000 50.000 Y-VALUES 40.000 Column C Linear Regression for Column C 30.000 20.000 10.000 0.000 1 4 10 16 22 28 34 40 46 52 58 64 70 76 82 88 94 100106112118124130136142 7 13 19 25 31 37 43 49 55 61 67 73 ... Date Added: 2009-06-13 05:09:28 |
| Liste_Examen_Matlab_2008.pdf Path: NSULA >> GEL >> 19964 Fall, 2009 Description: Signaux et systmes discrets GEL 19964 Assia Semmar Liste des tudiants et tudiantes pour lexamen matlab G 1 : Mardi 9 dcembre de 15h30 17h30 la salle 0103 Nom Bland Castonguay Cochior Plescanu Corbin Ct Dub Dutel Fortin Fournier Guay Glinas Henry Po... Date Added: 2009-06-13 05:09:43 |
| 411 Test 2 review 09S.pdf Path: Winthrop >> CSCI >> 411 Spring, 2008 Description: CSCI 411 0. 1. 2. Define: process; interrupt. Define: IPC mechanism; IPC pattern. Test # 2 - Review March 11, 2009 Describe each of these Linux IPC mechanisms and the Linux systems calls for each: 1. Semaphore 2. Pipe 3. pthread mutex Describe eac... Date Added: 2009-06-13 05:09:59 |
| The basis for the Test of the regression line 09S.doc Path: Winthrop >> QMTH >> 206 Fall, 2008 Description: QMTH 206 Spring 2009 The Basis for the ANOVA Test of Hypothesis for the Significance of the Linear Regression Line 1. 2. The object of linear regression analysis is to take a sample of n- (x,y) pairs of observations and try to determine from the sa... Date Added: 2009-06-13 05:10:02 |
| 08ASCs.txt Path: Arizona >> CS >> 227 Fall, 2008 Description: vti_encoding:SR|utf8-nl vti_timelastmodified:TR|01 Oct 2007 16:23:39 -0000 vti_author:SR|mercer vti_modifiedby:SR|mercer vti_timecreated:TR|19 Sep 2007 20:39:53 -0000 vti_backlinkinfo:VX|ricksbook.html vti_extenderversion:SR|4.0.2.8912 vti_syncwith_l... Date Added: 2009-06-13 05:10:52 |
| 302.pdf Path: Dickinson State >> RDC >> 300 Fall, 2009 Description: UNIVERSITY OF NORTH DAKOTA - INSTITUTIONAL REVIEW BOARD - STANDARD OPERATING PROCEDURES IRB MEETING ADMINISTRATION SOP #: 302 VERSION #: 1 EFFECTIVE DATE: 05/01/09 SUPERSEDES DOCUMENT: / / THIS POLICY PERTAINS TO: RESPONSIBILITY FOR EXECUTING POLIC... Date Added: 2009-06-13 05:11:53 |
| spring2009midans.doc Path: University of Hawaii - Hilo >> UHECON >> 300 Fall, 2009 Description: ECON300, Spring 2009 Intermediate Macroeconomics Midterm Exam March 11, 2009 Name_ Professor: Hui He Student ID_ Part 1. Multiple Questions (15*2=30 points) 1. Which of the following questions is of most interest for MACROECONOMISTS? (a) Why is the... Date Added: 2009-06-13 05:12:33 |
| hw4.ps Path: Caltech >> PHYS >> 199 Fall, 2009 Description: %!PS-Adobe-3.0 %Pages: (atend) %BoundingBox: 0 0 612 792 %HiResBoundingBox: 0.000000 0.000000 612.000000 792.000000 %. %Creator: GNU Ghostscript 651 (pswrite) %CreationDate: 2004/02/01 11:43:17 %DocumentData: Clean7Bit %LanguageLevel: 2 %EndComments ... Date Added: 2009-06-13 05:12:36 |
| ps3sol.pdf Path: Washington University in St. Louis >> CSE >> 260 Fall, 2009 Description: CS/EE 260 Digital Computers: Organization and Logical Design Problem Set 3 Solutions Jon Turner Quiz on 2/13/03 1. Simplify the following expressions by applying the basic identities (page 2-24 in the notes). Find the expression with the fewest po... Date Added: 2009-06-13 05:13:06 |
| proeMech.pdf Path: Minnesota >> ME >> 5241 Fall, 2008 Description: ME 5241 Computer Aided Engineering Fall 2000 Creating and Animating a Slider-Crank in Pro/E V. 2000i Tom Chase October 3, 2000 Overview This document explains how to create a mechanism and animate it in Assembly mode of Pro/ENGINEER. The procedure ... Date Added: 2009-06-13 05:13:13 |
| h190.ps Path: Arizona >> Q >> 1512 Fall, 2009 Description: %!PS-Adobe-3.0 %BoundingBox: 54 54 558 738 %Title: Graphics produced by IDL %For: mmorita@lithops.as.arizona.edu, /net/qso/d5/mmorita/HST/HSTfinal3.5 %Creator: IDL Version 5.4 (sunos sparc) %CreationDate: Tue Jan 16 18:55:13 2001 %DocumentData: Clean... Date Added: 2009-06-13 05:13:39 |
| lecture19.pdf Path: Virginia Tech >> CS >> 4604 Fall, 2008 Description: On Line Application Processing OnLine Application Processing Warehousing Data Cubes Data Cubes Data Mining 1 Overview Traditional database systems are tuned to Traditional database systems are tuned to many, small, simple queries. Some new applic... Date Added: 2009-06-13 05:13:49 |
| linux.pdf Path: Virginia Tech >> CS >> 4984 Fall, 2008 Description: ... Date Added: 2009-06-13 05:17:44 |
| 10fal_v2as14.ppt Path: Brookdale >> IENG >> 3315 Fall, 2009 Description: Chapter 14 Animated End of Chapter Problem Ries, Bax and Royce create RBR Ries and Bax each each invest $10,000 while Royce invests $24,000. invest $10,000 while Royce invests $24,000. They agree ... Date Added: 2009-06-13 05:17:56 |
| slac-pub-6001.pdf Path: Stanford >> PUBS >> 6000 Fall, 2009 Description: hep-ph/9212308 SLACPUB6001 (T) CERN-TH.6756/92 UCLA/92/42 December, 1992 Dimensionally Regulated One-Loop Integrals Zvi Bern Department of Physics University of California, Los Angeles Los Angeles, CA 90024 bern@physics.ucla.edu hep-ph/9212308 24... Date Added: 2009-06-13 05:18:27 |
| syllabus.pdf Path: Cornell >> CS >> 214 Spring, 2008 Description: Advanced Unix Tools CS214 Spring 2004 Syllabus Time and location MWF 12:20-13:10, Upson 205 Instructor Riccardo Pucella (http:/www.cs.cornell.edu/riccardo) Office hours: Thursday, 13:00-14:00, Upson 5151. Description From the course catalog descrip... Date Added: 2009-06-13 05:18:58 |
| Electric Force Slides (6 per page).pdf Path: Syracuse >> PHY >> 106 Fall, 2009 Description: The Standard Model of Particle Physics The Electric Force In the old days, we believed that force was transmitted more o r less instantaneously by a field of force. Lines of force Lines of force EM STRONG WEAK The proton to the right is repelled by... Date Added: 2009-06-13 05:19:08 |
| Topic-1.ppt Path: GCSU >> FACULTY >> 3101 Fall, 2009 Description: Topic-1 WhatisStatistics? Introduction to Business Statistics StatisticsinourLife: StatisticsinBusiness: PowerballLotteryTickets/Sales DailyWeatherForecasting StockMarketIndex(e.g.,DOWJones/NASDAQ) PredictionaboutNBAfinals . Marketin... Date Added: 2009-06-13 05:19:53 |
| unix_sec.ppt Path: Allan Hancock College >> CPE >> 5002 Fall, 2009 Description: vti_encoding:SR|utf8-nl vti_timelastmodified:TR|18 Apr 2002 04:55:05 -0000 vti_extenderversion:SR|5.0.2.2623 vti_author:SR|AHMADK\\kayed vti_modifiedby:SR|AHMADK\\kayed vti_timecreated:TR|18 Apr 2002 04:55:05 -0000 vti_cacheddtm:TX|18 Apr 2002 04:55:05... Date Added: 2009-06-13 05:22:15 |
| Notes3_5.pdf Path: University of South Dakota >> MATH >> 123 Spring, 2008 Description: 3.5 - THE CHAIN RULE MATH 123 - CALCULUS I - PHIL HARRINGTON - SPRING 2009 In this section we will look at how to differentiate composite functions, i.e. functions like F (x) = f g(x) = f (g(x). The Chain Rule: If f and g are differentiable functio... Date Added: 2009-06-13 05:23:47 |
| tut9.pdf Path: Allan Hancock College >> COMP >> 5116 Fall, 2009 Description: COMP5116 Internet Protocols Semester 1, 2009 Tutorial 9 Mobile IP and IP Multicast 1. The mobile IP specification defines three conceptually separate forms of authentication: mobile to home agent, mobile to foreign agent, and foreign agent to home ag... Date Added: 2009-06-13 05:24:54 |
| letterex.xls Path: U. Houston >> CUIN >> 3111 Fall, 2008 Description: first name Johnny Shelly Jennifer Sean Ellie last name Smith Ramirez Jacobs Zenter Chen class Earth Science Earth Science Earth Science Earth Science Earth Science grade comments 75 He does great on the test, but does not turn i 95 Good work! She... Date Added: 2009-06-13 05:25:33 |
| AKMPrinciples.pdf Path: Simmons >> BILDER >> 465 Fall, 2009 Description: Army Knowledge Management Principles The Army Knowledge Management Principles transcend technology advancements, mission, policy or organizational changes. They embrace an enterprise focus. The principles are organizationally independent; that is, th... Date Added: 2009-06-13 05:25:50 |
| week1_1.ppt Path: Berkeley >> MCB >> 230 Fall, 2008 Description: Part 1: Intracellular trafficking Week 1: Transport through the nuclear pore complex Week 2: RNA transport, maturation cell polarity Week 5: Transport into other orga... Date Added: 2009-06-13 05:26:27 |
| SVMrefbookpages.pdf Path: SMU - Cox School of Business >> ENGR >> 8381 Spring, 2009 Description: ... Date Added: 2009-06-13 05:27:21 |
| 8381lec07.pdf Path: SMU - Cox School of Business >> ENGR >> 8381 Spring, 2009 Description: ... Date Added: 2009-06-13 05:27:23 |
| LinkedLists.ppt Path: UH Clear Lake >> CSCI >> 3333 Fall, 2008 Description: Linked Lists Linked List ADT A linked list is a series of connected nodes (or links) where each node is a data structure. Dynamically allocated data structures can be linked together to form a chain. A linked list can grow or shrink in size as the p... Date Added: 2009-06-13 05:27:48 |
| Visio-payroll.pdf Path: Texas A&M University, Corpus Christi >> COSC >> 1435 Fall, 2008 Description: Start Enter the employee number INPUT empNum If the empNum is between 1000 and 9999 Yes No ERROR: the employee number must be between 1000 and 9999 Enter the employee name INPUT empNum INPUT empName Enter the number of hours worked INPUT ho... Date Added: 2009-06-13 05:28:15 |
| sec2hw3.pdf Path: UMass (Amherst) >> M >> 425 Fall, 2009 Description: MATH 425 HW SOLUTIONS, SEC. 2 HW 3 Note that these are not complete solutions. Most of the time the solution here is an outline, and to get full credit on a problem you must fill in most, if not all, of the details. 1a. f : Rn R, f (x) = |x| = x2 ... Date Added: 2009-06-13 05:29:36 |
| t8sol.pdf Path: Allan Hancock College >> COMP >> 4403 Fall, 2009 Description: COMP4403/7402 Compilers & Interpreters (2009/1) Sample Solution to Tutorial Exercise 8 School of Information Technology and Electrical Engineering, University of Queensland May 3, 2009 For this tutorial you will need copies of the files the assignmen... Date Added: 2009-06-13 05:30:03 |
| HFCS_Bad Rap_NYTimes.pdf Path: Wisconsin >> FS >> 120 Fall, 2009 Description: A Sweetener With a Bad Rap - New York Times July 2, 2006 A Sweetener With a Bad Rap By MELANIE WARNER EVERY time Marie Cabrera goes shopping, she brings along her mental checklist of things to avoid. It includes products with artery-clogging trans ... Date Added: 2009-06-13 05:30:33 |
| 5513-F2006-Livesey.pdf Path: Southern Oregon >> CAS >> 5513 Fall, 2009 Description: Fall 2006 S. Livesey HISTORY OF SCIENCE 5513 SCIENCE IN THE MIDDLE AGES This course is not intended for specialists in the middle ages or medieval science. Nor will it by itself turn you into a specialist, if you even had the intention of becoming ... Date Added: 2009-06-13 05:30:52 |
| Rubric.doc Path: N. Georgia >> MEWHIT >> 8160 Fall, 2009 Description: Ms. Whitlock World History Class Digital Media Research Project Rubric Student Name: Research Process Gathered information from journals, books, CD-ROM, and the internet Resources are current and reliable Extracted, synthesized, and applied appropri... Date Added: 2009-06-13 05:32:12 |
| Yawen.xls Path: Iowa State >> ECE >> 308 Fall, 2009 Description: SECTION10 NAME(first) 11Students Bader Aaron Thomas Jennifer Peter Justin Iwin Tim David Shawn Tony SECTION3 Eric 11Students Joseph Nat David Shantanu Nathan Lexin Piyushkumar Milana David Jeffrey SECTION9 Ziad 11Students Gerald Bradley Stephanie Chr... Date Added: 2009-06-13 05:32:56 |
| Chapter 11.ppt Path: UMBC >> BUS >> 230 Fall, 2009 Description: Two-sample Tests of Hypothesis Chapter 11 McGraw-Hill/Irwin The McGraw-Hill Companies, Inc. 2008 GOALS Conduct a test of a hypothesis about the difference between two independent population means. Conduct a test of a hypothesis about the di... Date Added: 2009-06-13 05:34:23 |
| ERP-Overview-RefArch.pdf Path: Bowling Green >> CIS >> 8090 Fall, 2009 Description: Air Force Mentor-Protg Program ERP Overview Ronald E. Giachetti, Ph.D. Associate Professor Industrial and Systems Engineering Florida International University September 1, 2005 Duane P. Truex, Ph.D. Associate Professor Robinson College of Business... Date Added: 2009-06-13 05:34:50 |
| magellan.pdf Path: Tulane >> BREESE >> 714 Fall, 2009 Description: Reproduced with permission of the copyright owner. Further reproduction prohibited without permission. Reproduced with permission of the copyright owner. Further reproduction prohibited without permission. Reproduced with permission of the copyrigh... Date Added: 2009-06-13 05:36:57 |
| syll.ps Path: CSU Northridge >> MATH >> 5348 Fall, 2009 Description: %!PS-Adobe-2.0 %Creator: dvips(k) 5.86 Copyright 1999 Radical Eye Software %Title: syll.dvi %Pages: 4 %PageOrder: Ascend %BoundingBox: 0 0 612 792 %EndComments %DVIPSWebPage: (www.radicaleye.com) %DVIPSCommandLine: dvips syll.dvi -o %DVIPSParameters:... Date Added: 2009-06-13 05:37:05 |
| syll.ps Path: CSU Northridge >> MATH >> 1051 Fall, 2009 Description: %!PS-Adobe-2.0 %Creator: dvips(k) 5.86 Copyright 1999 Radical Eye Software %Title: syll.dvi %Pages: 4 %PageOrder: Ascend %BoundingBox: 0 0 612 792 %EndComments %DVIPSWebPage: (www.radicaleye.com) %DVIPSCommandLine: dvips syll.dvi -o %DVIPSParameters:... Date Added: 2009-06-13 05:37:05 |
|
|
Get Started With Course Hero Today!
Get study guides, join study groups, and more!
Sign up in seconds with your Facebook account!
Course Hero is a Facebook Application Partner.
Click below to sign-up for FREE.
Our Social Learning Network was built to provide students and key learning partners like professors a platform to share, meet and collaborate while accelerating their comprehension of course-related theories and concepts. We are committed to providing you immediate access to a growing wealth of study materials and an unparalleled academic network of students, professors and other key partners. Why do you care? Because you want the best grade possible and at times need a 24/7 resource that’s responsive to your needs. |
|
What People Are Saying About Course Hero
|
|||
|
|||
|
Explore the benefits of joining Course Hero's social learning network.
|
|||
 |
Get millions of study materials now!Need lecture notes for a missed class or want insightful explanation of the theories and concepts you learn in class? Look no further, Course Hero’s Study Materials empowers you to find a broad and deep set of materials that can help you right now!
Click below to sign-up for FREE.
|
||
 |
Get over 200,000 textbook solutions now!Having difficulty with your homework and need documents that are relevant for your Textbook? Don't be frustrated. Course Hero's Textbook Help presents you study materials from many college courses.
Click below to sign-up for FREE.
|
||
 |
Meet over 300,000 students and your fellow classmates now!Want to meet your current classmates or those that took the class last year? Don’t worry or have anxiety. Course Hero’s Study Groups gives you the seamless opportunity to develop both anonymous or direct relationships with those classmates whom you want to meet and get help from right now!
Click below to sign-up for FREE.
|
||
