Course Solutions And Notes - hw2 19
| errata01.pdf Path: ASU >> STAT >> 371 Fall, 2009 Description: page 8, line 11: x BF (A B) should be x BF (A B) page 10, line 11: x y = x + (x) should be x y = x + (y) page 11, line 3: x < 0 and y < 0 should be x < 0 and y > 0 1 ... Date Added: 2009-06-24 12:24:44 |
| Econ-616-pprob5.pdf Path: Iowa State >> ECON >> 616 Fall, 2008 Description: Econ 616 Schroeter Practice Problem #5 Table 1 in Bresnahan and Reiss (\"Entry and Competition in Concentrated Markets,\" Journal of Political Economy, 1991) gives the values of some per-firm entry threshold ratios, and the price-cost margins at succes... Date Added: 2009-06-24 12:29:32 |
| Math440_HW02.pdf Path: CSU San Marcos >> MATH >> 440 Fall, 2009 Description: ... Date Added: 2009-06-24 12:33:20 |
| 766_vg_cat_rna.pdf Path: National Taiwan University >> BIOCHEM >> 766 Fall, 2009 Description: Biochemistry 766 Topic: Ribozymes Guest lecturer: Venkat Gopalan Date: 23rd February 2005 Lecture outline Ribozymes - Historical perspective The RNA world hypothesis Comparing RNA and protein catalysts Mechanisms of RNA-catalyzed reactions Summa... Date Added: 2009-06-24 12:46:53 |
| E2S07.pdf Path: SUNY Stony Brook >> CHE >> 322 Fall, 2008 Description: Form 0 CHE322 Multiple Choice Questions. 60 points 1. Choose the correct order carboxylic acid derivative reactivity with water. (class quiz). O (A) CH C Cl 3 CH3 O C OCH3 CH3 O C NH2 O (B) CH C Cl 3 CH3 O C NH2 CH3 O C OCH3 Exam 2 3/14/2007 incre... Date Added: 2009-06-24 12:47:29 |
| lab2.pdf Path: SUNY Stony Brook >> CHE >> 134 Spring, 2008 Description: CHE 134 SECTION 2 CALENDAR SYLLABUS SPRING-2009 State University of New York at Stony Brook Department of Chemistry Lecture: Lab: Friday Monday 12: 50 PM - 2:10 PM, Rm. 100, Javits Lecture Hall 3: 45 PM, Rm. 319, Old Chem. Bldg. Date Lec. Date L... Date Added: 2009-06-24 12:47:45 |
| lab1.pdf Path: SUNY Stony Brook >> CHE >> 134 Spring, 2008 Description: CHE 134 SECTION 1 CALENDAR SYLLABUS SPRING-2009 State University of New York at Stony Brook Department of Chemistry Lecture: Lab: Friday Monday 12: 50 PM - 2:10 PM, Rm. 100, Javits Lecture Hall 11: 45 AM, Rm. 319, Old Chem. Bldg. Date Lec. Date ... Date Added: 2009-06-24 12:47:45 |
| Week02_PR_F06a_T12.xls Path: USC >> CSCI >> 577 Fall, 2009 Description: Team Number: Week: Program Size (SLOC) Base Added Deleted Modified Reused # of COTS Total New SLOC Effort (Hours) Project Mgmt. Requirements COTS Assessment Design Life Cycle Planning Configuration Mgmt. Feasibility Analysis Code COTS Tailoring COTS ... Date Added: 2009-06-24 12:52:01 |
| psy420_final_concept.doc Path: CSU Northridge >> PSY >> 420 Fall, 2009 Description: 1 Possible conceptual questions Each answer should be short, clear, logical, and concise. Points will be deducted if your answer is long, ambiguous, and poorly structured. 1. Explain why the ANOVA is a special case of MRC. 2. Explain the logic of nu... Date Added: 2009-06-24 12:55:20 |
| schedule.pdf Path: CCBCMD >> CINS >> 130 Fall, 2009 Description: CINS130 WC1 Schedule Spring 2008 last revised 1/25/2008 Page 1 of 4 CINS130: Schedule Final Version This is an Overview of Class Activities. You should refer to the Learning Modules for specifics ORIENTATION ASSIGNMENT: Due by midnight Wednesday ... Date Added: 2009-06-24 12:56:17 |
| YJR148W.t2k.stride-ebghtl-logo.pdf Path: UCSC >> YJR >> 148 Fall, 2009 Description: YJR148W.t2k EBGHTL 3 2 1 CCC 1 T E E E CCCCTC CTCCC H E C G H TTTTTTGHCTCEECCTCHHTTHXXCHHCXCCCTEECCTCCCCTXECCCTT C T H T H C C H C H E T T T H T H T H E T C G H G CH TCCXE E C X X X X X X X X X X X X X X X X X X X X C T X X X X X X X X CTTTH ... Date Added: 2009-06-24 13:08:34 |
| YJR110W.t2k.alpha-logo.pdf Path: UCSC >> YJR >> 110 Fall, 2009 Description: YJR110W.t2k ALPHA 3 2 1 B F EB H E T BC E A G E E B E B C T BBAA E H X XXXXXXXXIAXX X X X D A S X S EAE B A E D B B B S D E B H E H X A C B S I S XXXXXXXBBBXE X A E C I C E S A EEEAD EAEE EA F C AAAEGXEB TB BA X T S A D B H X X X E... Date Added: 2009-06-24 13:08:54 |
| Clean Energy Now.doc Path: Colorado College >> EV >> 120 Fall, 2009 Description: Greenpeace Clean Energy Now! Campus Guide: How to Stop Global Warming by Making Your Campus a Leader in Clean Energy For more information, Maria Ramos at: 1-888-363-9197 or maria.ramos@wdc.greenpeace.org Global Warming: The Most Serious Environment... Date Added: 2009-06-24 13:19:28 |
| flight (key).rtf Path: St. Francis IL >> X >> 467 Fall, 2009 Description: Across 2. 4. 6. 7. 8. HOTAIRBALLOONThe brothers, Joseph Michel and Jacques Etienne Montgolfier, were inventors of the first . CHINESEwhat culture invented the Kite? SLOWERAir moves _ underneath the wing. FLIGHTThe first manned _was on November 21, 17... Date Added: 2009-06-24 13:22:40 |
| YKL082C.t2k.w0.5-logo.pdf Path: UCSC >> YKL >> 082 Fall, 2009 Description: YKL082C.t2k w0.5 6 5 4 3 2 1 D I E M XXX L T V XXXXXXXXXXX I LE V R L K N S D E FE L M I V Y D E N I A A X X X XXXXXXXXXXXXXXXXXXX S I LV M Y L LI Y L P A F E F K Y R A L L Y Y F W F Y L V E D I A S T D E L F Q T E E E X... Date Added: 2009-06-24 13:25:41 |
| YKL073W.t2k.dssp-ehl2-logo.pdf Path: UCSC >> YKL >> 073 Fall, 2009 Description: YKL073W.t2k DSSP-EHL2 2 1 C X C C C H C C C C C H X X E E E X X X 1 10 20 30 40 H 2 1 H E X X T E T E T E T CCCCCCE EEEC 51 S 2 1 E 60 70 80 90 S T T E H TH H H H CXEE C C C H H H C C C H H C C C C C X X X X X X T 2 1 S ... Date Added: 2009-06-24 13:25:47 |
| YKL043W.t2k.CB_burial_14_7-logo.pdf Path: UCSC >> YKL >> 043 Fall, 2009 Description: YKL043W.t2k CB_BURIAL_14_7 3 2 1 AA X AB BA BA BBAA BBCBAAB CCBCX C A X X A F A E A GEFEF B D C B C B E B A E C A A B C C C C C C C D C D CBCCCCC E C F G D D D D D D B A C D D D D D D D D D D D D D C D D B D D D D X X X X X X X X X X X X XGEXXGXDE... Date Added: 2009-06-24 13:25:55 |
| proj2.pdf Path: Carnegie Mellon >> CS >> 498 Spring, 2009 Description: 15-498 Project #2 Simulating a Distributed System Times of Interest Monday, February 19, 2006: Assignment distributed 11:59PM on Wednesday, March 8th: Assignment submission deadline Educational Objectives and Overview This lab is designed to expos... Date Added: 2009-06-24 13:35:07 |
| quiz9.pdf Path: George Mason >> MATH >> 125 Fall, 2008 Description: Math I25 Quiz I Spring 2009 \\Vorl< carefully and neatly. You must show all relevant work! You may\'eceirre no creclit there is insufficient work. if [ pts] 1. A graph has the adjacency m atrix it has. give n below. Determine the number of spanni... Date Added: 2009-06-24 13:36:58 |
| hw6.pdf Path: Minnesota >> MATH >> 1151 Fall, 2008 Description: 5.1 Homework (February 8, 2004) 12. Draw the following angle: 21 4 82. A pendulum swings through an angle of 20 each second. If the pendulum is 40 inches long, how far does its tip move each second? 92. Charleston, West Virginia, is due north of Jack... Date Added: 2009-06-24 13:39:38 |
| 17.pdf Path: Princeton >> COS >> 126 Fall, 2008 Description: S y m b o l T a b le 4 .4 S y m b o l T a b le s Symbol table. Key-value pair abstraction. Insert a key with specified value. Given a key, search for the corresponding value. ! ! Ex. [DNS lookup] Insert URL with specified IP address. Given URL, fi... Date Added: 2009-06-24 13:41:58 |
| measurement2_prelab.pdf Path: KVCC >> CHEMISTRY >> 100 Fall, 2009 Description: CHEMISTRY 100 MEASUREMENT AND DENSITY PRE LABORATORY INTRODUCTION: DENSITY is a physical property of pure substances and, as such, does not vary from sample to sample. Because the density of a pure substance remains constant, no matter how much of th... Date Added: 2009-06-24 13:45:06 |
| sustainability_defs.pdf Path: New Mexico >> ME >> 561 Fall, 2008 Description: Meeting the needs of the present without compromising the ability of future generations to meet their own needs. (American Friends Service Committee) Sustainable development The concept of meeting the needs of the present without compromising the abi... Date Added: 2009-06-24 13:45:55 |
| mt1.pdf Path: Lake County >> ECE >> 361 Fall, 2009 Description: ECE398 Spring 2008 Midterm 1 Midterm Instructions: All information bits are equally likely to be 0 or 1 and statistically independent of each other. No calculators or electronic devices are allowed. The test is in class and is closed book and cl... Date Added: 2009-06-24 13:48:23 |
| lecture15.pdf Path: UCSB >> ECE >> 162 Fall, 2009 Description: Photodetectors Read: Kasip, Chapter 5 Yariv, Chapter 11 Class Handout ECE 162C Lecture #15 Prof. Prof John Bowers No class Monday (Memorial Day) No l W d d N class Wednesday Class Friday, May 30 Types of Photodetectors Photoelectric detectors A ph... Date Added: 2009-06-24 14:06:18 |
| Evaluation.pdf Path: Eastern Oregon >> MM >> 410 Fall, 2009 Description: MM 460 Extra Evaluation Questions 1A 2 3 4 5 Should this class use a series of several small, manageable assignments rather than the bigger project of Create a character? If some combination would be good describe it. Was the sequence of topics reaso... Date Added: 2009-06-24 14:07:00 |
| Fluids statics - part 2.ppt Path: Bethel VA >> CHE >> 345 Fall, 2009 Description: ChE 345 Chemical Engineering Fluid Mechanics Fluid Statics (part 2) H ydrostatic forces on plane surfaces What force is necessary to hold the hatch in place? Hydrostatic force on an inclined plane surface Hydrostatic force on an inclined plane sur... Date Added: 2009-06-24 14:07:41 |
| Chapter_10B_outline.pdf Path: Bethel VA >> CHE >> 231 Fall, 2009 Description: Chapter 10 (continued) Intermediate phases or compounds Some systems have _ _ other than those lying near the extremes. Cu - Zn diagram Figure 10.17 Chapter 10 (continued) Intermediate phases or compounds (cont.) For some systems, specific _ e... Date Added: 2009-06-24 14:07:48 |
| westtracks2061212.pdf Path: Georgia Tech >> GTG >> 880 Fall, 2009 Description: TD TS HR 30 N o MHR 24oN 18oN 12oN 6oN 96oW 88oW 80oW 72oW 64oW ... Date Added: 2009-06-24 14:10:06 |
| ww37.ppt Path: Clemson >> ECE >> 496 Fall, 2009 Description: 496 Presentation - Gyrobot Group C March 15, 2001 Overview Physics Controls Simulink Files Hardware Problems/Solutions/Future Plans Physics KE = 1/2 mv2 (velocity) KE = 1/2 I (d /dt)2 (rotation) v = qd q1 L q2 2 KE = 1/2 mava2 + 1/2 mdvd2 +... Date Added: 2009-06-24 14:14:15 |
| Homework2.pdf Path: Duke >> ECE >> 227 Fall, 2009 Description: ECE 227/PHY272 Quantum Information Science Homework #2 Due in Class 2/11/2009 1. Bell States are maximally entangled states of two particles. Using two basis states 0 and 1 , one of the Bell states reads = 0 1 0 2 + 1 1 1 (a) Express the Bell state ... Date Added: 2009-06-24 14:19:07 |
| exercises1_solutions.pdf Path: CUNY Baruch >> STAT >> 724 Fall, 2009 Description: STAT 724/ECO 761 Spring 2007 Problem Set One SOLUTIONS 1. If the cumulative distribution function of a random variable X is given by if b < 0, 0 1/2 if 0 b < 1, 3/5 if 1 b < 2, F (b) = 4/5 if 2 b < 3, 9/10 if 3 b < 3.5, 1 if b 3.5 ... Date Added: 2009-06-24 14:20:06 |
| Breadth Areas.pdf Path: Penn State >> AJS >> 394 Fall, 2009 Description: ADAM J. SENK PENNSYLVANIA STATE UNIVERSITY CHEMISTRY BUILDING THESIS PROPOSAL MECHANICAL OPTION BREADTH AREAS Additional area to be redesigned is an atrium space. The space is comprised of a stair and elevator lobby which connects the 1st through 5t... Date Added: 2009-06-24 14:20:19 |
| notes_mte410_051909.pdf Path: Oakland University >> MTE >> 410 Winter, 2008 Description: ... Date Added: 2009-06-24 14:27:07 |
| incidentlog1_3.doc Path: Berkeley >> I >> 213 Spring, 2009 Description: Critical Incident Form Usability Test User # _1_ Test Scenario #_3_ Time 4:44 Steps Selects Searchable Databases But decides this is NOT what she was looking for.wants \"Choose a Source\" Selects Choose a Source Chooses Electronic Journals Wants to ... Date Added: 2009-06-24 14:33:19 |
| Scavenger Hunt 830.doc Path: Trinity U >> CS >> 1300 Fall, 2009 Description: vti_encoding:SR|utf8-nl vti_timelastmodified:TR|27 Aug 2007 21:35:27 -0000 vti_extenderversion:SR|6.0.2.6551 vti_author:SR|TRINITY\\jbelisle vti_modifiedby:SR|TRINITY\\jbelisle vti_timecreated:TR|27 Aug 2007 21:35:27 -0000 vti_cacheddtm:TX|27 Aug 2007 ... Date Added: 2009-06-24 14:40:18 |
| Info.pdf Path: Lake County >> ECE >> 313 Fall, 2009 Description: ECE 313: Probability with Engineering Applications. Fall 2001 11 MWF, Room 260 Everitt Laboratory Instructor: Professor Dilip Sarwate 109 Coordinated Science Lab 3337473 326B Everitt Lab 3330387 E-mail: sarwate@comm.csl.uiuc.edu Tuesdays 1:30 p.m. 4... Date Added: 2009-06-24 14:40:19 |
| schedule.pdf Path: Lake County >> ECE >> 316 Fall, 2009 Description: ECE/Philosophy 316 DAILY SCHEDULE Fall 2008 * = Principles of Effective Writing Electronic Reserves: http:/www.library.uiuc.edu/ereserves/ Class #1 Class #2 Tu 8/26 Th 8/28 Introduction, Course Overview, Gilbane Gold Moral Theory: Concepts and ... Date Added: 2009-06-24 14:41:35 |
| EStemmerman.pdf Path: Portland >> GEOG >> 492 Winter, 2008 Description: The Caribbean Basin: Ports, Population, and Marine Protected Areas Erick Stemmerman Portland State University GEOG 492 GIS II June 8, 2005 Introduction Determine areas of interest for additional and more focused research in the Caribbean Basin Ide... Date Added: 2009-06-24 14:50:59 |
| Grade Conversion Scale.doc Path: High Point >> COX >> 204 Fall, 2009 Description: Technology Product For Pre-Service Teachers Grading Conversion Scale Points Earned Letter Conversion Grade Conversion <10 F 0-60 10 C70 20 C 73 31 C+ 77 41 B80 51 B 83 62 B+ 87 72 A90 82 A 93 93 A+ 97 ... Date Added: 2009-06-24 14:51:25 |
| week03.pdf Path: NSC Henderson >> GEY >> 712 Fall, 2009 Description: Week 3 Soil Moisture The unsaturated zone or vadose zone is referred to a region in which the pore spaces of the rock or soil may partly filled with air and water. The unsaturated zone consists of soil water zone, intermediate zone, and capillary fri... Date Added: 2009-06-24 14:51:46 |
| Chpt05.pdf Path: NSC Henderson >> GEOG >> 101 Fall, 2009 Description: GEO 101: PHYSICAL GEOGRAPHY GEO Chapter 05: Global Temperatures Topics Temperature Concepts and Temperature Measurement Principal Temperature Controls Principal Earths Temperature Patterns Earth Air Temperature and the Human Body Air Temperature Co... Date Added: 2009-06-24 14:52:01 |
| review1.pdf Path: NSC Henderson >> GEOG >> 101 Fall, 2009 Description: Chapter 1 1. 2. 3. 4. 5. 6. 7. 8. 9. 10. Define geography and physical geography Systems, open systems and closed systems Earths four spheres Negative and positive feedbacks System equilibrium Latitude, longitude, geographic zones Grate circle, equat... Date Added: 2009-06-24 14:52:04 |
| 03-CPB_20Fall_202008_20Seminar.pdf Path: UC Davis >> ATT >> 149 Fall, 2009 Description: 2008 Fall Quarter CPB Seminars (PBG290) When: Tuesdays, 4:10 - 5:30 PM Where: 1022 Life Sciences Building - formerly known as LSA(addition) _ September 30, 2008 Dan Warren, Graduate Student, Population Biology Graduate Group, UC Davis Title: New met... Date Added: 2009-06-24 14:52:58 |
| 03-CPB_20Fall_202008_20Seminar.pdf Path: UC Davis >> ATT >> 190 Fall, 2009 Description: 2008 Fall Quarter CPB Seminars (PBG290) When: Tuesdays, 4:10 - 5:30 PM Where: 1022 Life Sciences Building - formerly known as LSA(addition) _ September 30, 2008 Dan Warren, Graduate Student, Population Biology Graduate Group, UC Davis Title: New met... Date Added: 2009-06-24 14:53:01 |
| rosenthal66.pdf Path: Indiana >> EDUCY >> 520 Fall, 2009 Description: Psychological Reports, 1966, 19, 115-118. Teachers\' Expectancies: Determinants Of Pupils\' IQ Gains1 Robert Rosenthal Harvard University and Lenore Jacobson South San Francisco Unified School District Summary - Within each of 18 classrooms, an avera... Date Added: 2009-06-24 14:53:12 |
| homework4.pdf Path: Lake County >> ECE >> 428 Fall, 2009 Description: CS 425 / ECE 428 / CSE 424: Distributed Systems Homework 4 - Due on March 31st , 2009 Spring 2009 Students are encouraged to collaborate and exchange ideas on homework problems; however, you must submit your own solutions All book problems from CDK... Date Added: 2009-06-24 15:06:03 |
| chap3_part2.pdf Path: Walla Walla University >> ENGR >> 433 Fall, 2009 Description: ... Date Added: 2009-06-24 15:11:18 |
| designcon_2.pdf Path: University of Illinois, Urbana Champaign >> ECE >> 598 Fall, 2008 Description: DesignCon 2004 Error-Correction Coding for 10Gb/s Backplane Transmission Lars E. Thon, Aeluros Inc. Haw-Jyh Liaw, Aeluros Inc. Abstract Backplane links operating in the 6-12Gb/s region are affected by a number of transmission channel impairments s... Date Added: 2009-06-24 15:13:42 |
| lect18.pdf Path: Maryland >> CMSC >> 212 Fall, 2005 Description: Announcements G Exam #2 Regrade Requests Due next Monday G Reading Notes (Today) Notes (Tuesday) CMSC 212 F05 (lect 18) 1 Events G Many programs need to respond to external activity keyboard mouse network sensors G Many programs can ... Date Added: 2009-06-24 15:14:15 |
| solution7.pdf Path: Wesleyan >> PHYS >> 213 Fall, 2009 Description: - I - ... Date Added: 2009-06-24 15:15:38 |
| udp_6.pdf Path: Virginia Tech >> CS >> 4254 Fall, 2008 Description: UDP: The User Datagram Protocol z UDP is another transport protocol in the User Datagram Protocol (UDP) Srinidhi Varadarajan z UDP provides an unreliable datagram service Packets may be lost or delivered out of order Users exchange datagrams (n... Date Added: 2009-06-24 15:20:02 |
| ex1.pdf Path: NSCC >> CHE >> 150 Fall, 2009 Description: Chemistry 150 Name(s): Exercise 1: Hybrid orbitals and molecular orbital theory 1. What is the hybridization of each of the carbon, oxygen, and nitrogen atoms in caffeine (pictured below)? 2. Predict the bond angle of each of the atoms in the ring... Date Added: 2009-06-24 15:26:45 |
| Dry_Chem_App.ppt Path: Purdue >> ASM >> 222 Fall, 2008 Description: ASM 222 Crop Production Equipment Application of Dry Chemicals Learning Objectives: 1. Describe 4 methods of metering 2. Describe 2 types of drives for metering devices 3. Describe 3 methods of delivery 4. Describe 2 methods of calibration Gaine E.... Date Added: 2009-06-24 15:37:43 |
| ch18.ppt Path: Hope >> ECON >> 302 Fall, 2009 Description: Chapter 18 Changes in the Monetary Base Copyright 2008 Pearson Addison-Wesley. All rights reserved. Balance Sheet of the Federal Reserve System Changes in securities and discount loans are the major cause of monetary base changes. Changes in the... Date Added: 2009-06-24 15:40:44 |
| Lab11.pdf Path: UC Davis >> PHYS >> 116 Fall, 2008 Description: Relaxation Oscillator and One-Shot Using 555 Timer Physics 116B Lab 11 Rev. 2, January, 2003 Introduction In this experiment you will use an FET version of a 555 timer (TLC555) to make a relaxation oscillator (astable multivibrator) use the circui... Date Added: 2009-06-24 15:41:10 |
| PracticeFinal.pdf Path: SUNY Stony Brook >> MAT >> 303 Summer, 2008 Description: MAT303 Practice Final The nal exam will be very similar to the exam in terms of content and the format. The bonus questions on the practice nal are meant to tell you what kind of bonus questions would be on the exam. Show all work. IF YOU ARE USING A... Date Added: 2009-06-24 16:01:41 |
| Mat351_quiz3_solutions.pdf Path: SUNY Stony Brook >> MAT >> 351 Fall, 2008 Description: ... Date Added: 2009-06-24 16:03:19 |
| YJL061W.t2k.alpha-logo.pdf Path: UCSC >> YJL >> 061 Fall, 2009 Description: YJL061W.t2k ALPHA 2 1 B E X X X X X X X X XX H H H H S E B H S H H X X X X X X X X X E H H H H H X H H H H H XX B E C H EEE AA E X X B C G D S F E E A H I B C B G D A B B B A E C I HDT B E H B XXXXXXXXXXBBBXXXX X X X B SEE A BB EE... Date Added: 2009-06-24 16:03:27 |
| Language Experience Stories.doc Path: Western Michigan >> SPED >> 534 Fall, 2009 Description: Strategy: Appropriate Grade Level: Procedures/Steps: Comments and/or tips: Source: Gately, S. (2004). Developing concept of word. Council for Exceptional Children, 36, 16-22. ... Date Added: 2009-06-24 16:05:12 |
| TechOnDeck.pdf Path: Georgia Tech >> GTH >> 754 Fall, 2009 Description: SportS Technique Friday, February 22, 2008 27 TECH ON DECK T > STATS Baseball looks forward to promising spring season he Tech baseball team starts the season outside of the coaches poll with 21 votes. Techs schedule is very balanced, especi... Date Added: 2009-06-24 16:07:23 |
| Morgan Firestine Resume.pdf Path: Penn State >> MAF >> 5002 Fall, 2009 Description: 4520 Conrad Weiser Pkwy, Womelsdorf, PA 19567 717-304-9488 maf5002@psu.edu http:/maf5002.googlepages.com/ http:/www.personal.psu.edu/maf5002/ Morgan Firestine OBJECTIVE: To obtain a position in the Agriculture Business field. EDUCATION: The P... Date Added: 2009-06-24 16:08:07 |
| R180RRa.pdf Path: UWO >> R >> 151 Fall, 2009 Description: Rump: Or an Exact Collection. An Electronic Edition Page 1 of 5 A DISPLAY OF THE HEADPIECE AND CODPIECE VALOUR Ratts Rhimed to Death (April? 1660) Anonymous. [p. 60] [E6v] First pub. 1 March, 1660? A Display of the Headpiece and Codpiece Valour, ... Date Added: 2009-06-24 16:08:13 |
| T0405.t04.w0.5-logo.pdf Path: UCSC >> T >> 0405 Fall, 2009 Description: T0405.t04 w0.5 2 1 1 10 20 30 40 H 2 1 T S T T H 51 60 70 80 90 T 2 1 H T T A TS T H T 101 110 120 130 140 S 2 1 TH T H T 151 160 170 180 190 ZQA 2 1 Y STYA ZYZHEZA Z S H T 201 210 220 230 240 H 2... Date Added: 2009-06-24 16:09:35 |
| Bu447 Professional Preparation.ppt Path: Charleston Law >> BU >> 447 Fall, 2009 Description: Professional Preparation Make the most of your time Things to Remember Physicalpreparation Mentalpreparation Studytechniques Examwritingtechniques Physical Preparation Sleep Exercise Food Recreation Dress Mental Preparation Practicefors... Date Added: 2009-06-24 16:19:45 |
| iep.pdf Path: Wyoming >> EDEC >> 5250 Fall, 2009 Description: IDEA 1997 Comparison of IEP and IFSP Components Component Present Level of Performance IFSP A statement of the infant s or toddler s present level of Physical development Cognitive d evelopm ent Social or e motional d evelopm ent A ND A daptive deve... Date Added: 2009-06-24 16:21:35 |
| 2.Backyard Wildlife Steward.doc Path: Western Washington >> AC >> 575 Fall, 2009 Description: Backyard Wildlife Habitat Steward Training Stacey Larsen, Adam Lorio and Abigail Sussman Evaluation Background1 This evaluation plan is in response to a request from a representative of the Island County Public Works Department Watershed Management P... Date Added: 2009-06-24 16:25:37 |
| sign410.txt Path: UNC >> DOCS >> 2097 Fall, 2009 Description: Project Gutenberg Etext The Sign of the Four, by A. Conan Doyle #16 in our series by Arthur Conan Doyle [In addition to a few unnumbered short stories] Copyright laws are changing all over the world, be sure to check the copyright laws for your cou... Date Added: 2009-06-24 16:28:18 |
| T0398.t2k.w0.5-logo.pdf Path: UCSC >> T >> 0398 Fall, 2009 Description: T0398.t2k w0.5 4 3 2 1 1 10 20 30 40 E 4 3 2 1 H T E TH ET H T E H 51 60 70 80 90 E 4 3 2 1 H T E 101 110 120 130 140 H 4 3 2 1 T E 151 160 170 180 190 T 4 3 2 1 E SH T E H T 201 210 220 230 240 H 4 3... Date Added: 2009-06-24 16:35:27 |
| hw5-solutions.pdf Path: Concordia Chicago >> P >> 322 Fall, 2009 Description: Physics 322 Solutions to Problem Set 5 Jock McOrist. Email: jmcorist (at) uchicago 1. Jackson Problem 5.29 Inside a perfect conductor all currents and charges are at the surface. Further, there are no magnetic elds inside the conductors. For a cylin... Date Added: 2009-06-24 16:35:37 |
| Meteorite_Discussion.pdf Path: ASU >> GEO >> 110 Fall, 2009 Description: Meteorite Discussion Three Major Classes of Meteorites 1) Stony a. Differentiated Achondrites i.e. Eucrites (and Martian and lunar) b. Undifferentiated Ordinary Chondrites (primitive) Carbonaceous Chondrites (carbon rich) Enstatite Chondrites (very r... Date Added: 2009-06-24 16:35:57 |
| 163HW5.pdf Path: Concordia Chicago >> MATH >> 163 Fall, 2008 Description: Math 163 Section 33 Spring 2008 Problem Set 5 Due Monday May 5th in class 1. Read Chapters 25 and 26 2. Chapter 25: Prove Theorem 1 parts 5, 7, 8, Problems 4, 5, 7, 9, 10ab (c is really useful and extra credit) 3. Chapter 26: 5ab, 8 1 ... Date Added: 2009-06-24 16:54:14 |
| Lab2_Density.pdf Path: Santa Barbara City >> CHEM >> 155 Summer, 2008 Description: E ric B u llo c k S a n ta B a rb a ra C ity C o lle g e Lab 2. Investigating Density Purpose To determine the density of an unknown solid and to identify what it is based on your measurements. In addition, you will graph your data and use a linear ... Date Added: 2009-06-24 16:55:20 |
| YPL176C.t2k.str2-logo.pdf Path: UCSC >> YPL >> 176 Fall, 2009 Description: YPL176C.t2k STR2 5 4 3 2 1 Z CCCCCC TSCC C Q S ZYBY Q B Z T XXXXXX QQ S TC S C SCSTXXX S T G G X X X CC C T T S T T S C S S S H T T S S H C S C S S CCH S S C S S S STT H T C SHTGHHHHTHSS T H H T C G H H T C H S S H X XHSGGTTTHGXTHSHHXXXTT X X ... Date Added: 2009-06-24 17:09:33 |
| Plateu_honing.ppt Path: UNC Charlotte >> MEGR >> 6181 Fall, 2008 Description: Characterization of Surface Texture generated by Plateau Honing Process Plateau Honed Surface Texture Two line approximation of a Bearing Area Curve Surface Model for Two Line Approximation to a Bearing Area Curve Summary of Rk family of Paramete... Date Added: 2009-06-24 17:11:05 |
| Gear_metrology.ppt Path: UNC Charlotte >> MEGR >> 6181 Fall, 2008 Description: GEAR METROLOGY Course: MEGR 6181 Department of Mechanical Engineering and Engineering Science UNC Charlotte, NC Major gear metrological features for cylindrical parallel axis gears Pitch Involute tooth profile Tooth thickness Gear surface met... Date Added: 2009-06-24 17:11:05 |
| page62.pdf Path: Kent State >> MATH >> 61052 Fall, 2008 Description: ... Date Added: 2009-06-24 17:12:15 |
| web based lesson.doc Path: N. Georgia >> JMTALL >> 7291 Fall, 2009 Description: Web-Based Lesson Plan Lesson Plan Title: Developed by: Subject Area: Grade Level: Purpose of the Activity: Learning Objectives written in behavioral terms. (include at least one Georgia QCC or Georgia Performance Standard): Alphabet Fun Joanie Tallan... Date Added: 2009-06-24 17:14:19 |
| 54823p6.ppt Path: N.E. Illinois >> CS >> 317 Fall, 2009 Description: MicrosoftVisualBasic2005 CHAPTER6 Loop Structures 6 Objectives Add a MenuStrip object Use the InputBox function Display data using the ListBox object Understand the use of counters and accumulators Understand the use of compound operators Chapte... Date Added: 2009-06-24 17:20:04 |
| Art10Lesson7.doc Path: Laurentian >> DAY >> 3601 Fall, 2009 Description: Subject: Art 10 Unit: Acrylic Painting Topic: Composition Lesson: Seven Duration: Three Periods Date: March 16, 2004 At the end of this lesson students will: 1. Solve teacher directed problems of unity and emphasis in creating composition. 2. Underst... Date Added: 2009-06-24 17:20:40 |
| UnitonPainting.pdf Path: Laurentian >> DAY >> 3601 Fall, 2009 Description: 1 Unit: Acrylic Painting Grade: 10 Art School: Holy Trinity Academy Teacher: Ms. Gorka Date: March 1st, 2004 Overview of the Unit: The unit is based on painting and the medium acrylics. The central emphasis of this unit is for students to understand ... Date Added: 2009-06-24 17:20:42 |
| chap009.ppt Path: UMKC >> BMA >> 567 Fall, 2008 Description: 91 McGrawHill/Irwin 2005TheMcGrawHillCompanies,Inc.Allrightsreserved. 92 PartThree Chapters 911 Part Three: Employee Contributions-Determining Individual Pay Chapter9:PayforPerformance:The Evidence Chapter10:PayforPerformancePlans Chapter11:Perf... Date Added: 2009-06-24 17:23:04 |
| 2354.txt Path: UNC >> DOCS >> 2354 Fall, 2009 Description: The Project Gutenberg EBook of Note on the Resemblances and Differences in the Structure and the Development of Brain in Man and the Apes, by Thomas Henry Huxley This eBook is for the use of anyone anywhere at no cost and with almost no restrictions... Date Added: 2009-06-24 17:26:52 |
| 3050.txt Path: UNC >> DOCS >> 3050 Fall, 2009 Description: The Project Gutenberg eBook, Notes of a War Correspondent, by Richard Harding Davis, Illustrated by F. C. Yohn This eBook is for the use of anyone anywhere at no cost and with almost no restrictions whatsoever. You may copy it, give it away or re-... Date Added: 2009-06-24 17:27:19 |
| YAL030W.t2k.CB_burial_14_7-logo.pdf Path: UCSC >> YAL >> 030 Fall, 2009 Description: YAL030W.t2k CB_BURIAL_14_7 3 2 1 AA 1 A BBAACA B BBC B C C D D D D D X X X X X X 10 20 30 40 DBA EBAD A 3 2 1 A BBB C ACCC B A A D B B E D B B B C D C E D B C B D C F C C D E C C CDDXDDXXXDXXXXAXXBBCXXXXX C D CDCXCXCXDCDCDDC D C B C D D ... Date Added: 2009-06-24 17:32:49 |
| Readme.pdf Path: WVU Tech >> EE >> 438 Fall, 2009 Description: This CD contains the following three folders: 1. Lecture_Presentation_Slides: This folder contains .pdf files, one for each chapter. 2. Appendices: This folder contains .pdf files of the appendices. 3. PSpice: This folder contains PSpice related mate... Date Added: 2009-06-24 17:37:04 |
| 115 ch 1.xls Path: Drexel >> ACCT >> 115 Fall, 2009 Description: Chapter 1 5. These four concepts may be described as an endless cycle in which economic activities occur, are measured by an accounting process which produces accounting information which, in turn, facilitates decision making which restarts the proc... Date Added: 2009-06-24 17:37:34 |
| 23989.txt Path: UNC >> DOCS >> 23989 Fall, 2009 Description: The Project Gutenberg eBook, Caleb in the Country, by Jacob Abbott This eBook is for the use of anyone anywhere at no cost and with almost no restrictions whatsoever. You may copy it, give it away or re-use it under the terms of the Project Gutenb... Date Added: 2009-06-24 17:39:35 |
| pend.pdf Path: Rutgers >> PHYSICS >> 205 Fall, 2009 Description: 5/06 NM 2 Coupled Pendulums About this lab Small displacements about stable equilibrium produce restoring forces proportional to the displacement, i.e. linear in the displacement coordinates. Then the motions are a mix of sinusoids at characteristi... Date Added: 2009-06-24 17:43:24 |
| kowchcommunity.pdf Path: Wilfrid Laurier >> OCT >> 677 Fall, 2009 Description: Abstract This article defines community for educators and proceed to examine fundamental issues around new theories and practice for constructing learning communities. Our concept of community asks the reader not to consider the shape of institutions... Date Added: 2009-06-24 17:48:00 |
| Educ369compplan.pdf Path: Wisc Stevens Point >> SSTEI >> 693 Fall, 2009 Description: Sarah Steiner Education 369 Comprehensive Instructional Plan Assignment PLAAFP Diana is a nine year old currently in the 4th grade at Prairie View Elementary school. Diana is qualified for services in the area of cognitive disabilities based off of ... Date Added: 2009-06-24 17:59:54 |
| hst423syllabus2003.pdf Path: ASU >> HST >> 423 Fall, 2009 Description: History 423: The Tudor Monarchy Social Science 236 Professor: Retha M. Warnicke Office Hours: MWF 10:30-11:30 Office Location SS 224D inside ACMRS Office Phone: 480-727-6489 e-mail rwarnicke@asu.edu Web site: http:/www.public.asu.edu/~iermw Fax: 480... Date Added: 2009-06-24 18:06:21 |
| YBL101W-C.t2k.stride-ebghtl-logo.pdf Path: UCSC >> YBL >> 101 Fall, 2009 Description: YBL101W-C.t2k EBGHTL 3 2 1 C TTXXHHHEXHX C X X C E H C C H E X X X X X 1 10 20 E H H T H 30 TTC CC HHHHHH C C H EE H CC X X MSRSIFFFSSLFLSPLNKIRNIGGKVENPWKSQIRDWKN H E T H G H H T C T T H T G H H X X G X X X X X X H T H X X T T... Date Added: 2009-06-24 18:10:47 |
| fall042.doc Path: Dallas >> FIN >> 6301 Fall, 2008 Description: Show your work. The first 7 questions are worth 5 points each. 1. Which form of the efficient market hypothesis implies that security prices reflect all information contained in past prices? Weak 2. Holden Bicycles has 1,000 shares outstanding each w... Date Added: 2009-06-24 18:11:17 |
| ch15.ppt Path: Dallas >> FIN >> 6301 Fall, 2008 Description: CapitalStructure 15.1 The Capital-Structure Question and The Pie Theory 15.2 Maximizing Firm Value versus Maximizing Stockholder Interests 15.3 Financial Leverage and Firm Value: An Example 15.4 Modigliani and Miller: Proposition II (No Taxes) 15.5 T... Date Added: 2009-06-24 18:11:21 |
| SyllabusSpring2001.doc Path: Minnesota >> ECE >> 3611 Fall, 2009 Description: ECE 3611 Syllabus Spring 2001 Professor: Dr. Stanley G. Burns Office: 271 MWAH Phone: 726-7606 Office Hours: See posting and check with Departmental secretaries Email: sburns@d.umn.edu MWF 09:00-09:50 MWAH 191 Not applicable Lecture Place & Time: ... Date Added: 2009-06-24 18:13:09 |
| blonds.txt Path: Allan Hancock College >> STAT >> 100 Fall, 2009 Description: HairColour Pain LightBlond 62 LightBlond 60 LightBlond 71 LightBlond 55 LightBlond 48 DarkBlond 63 DarkBlond 57 DarkBlond 52 DarkBlond 41 DarkBlond 43 LightBrunette 42 LightBrunette 50 LightBrunette 41 LightBrunette 37 LightBrunette 45 DarkBrunette 3... Date Added: 2009-06-24 18:14:26 |
| wk5exercises.pdf Path: Allan Hancock College >> STAT >> 100 Fall, 2009 Description: STAT100: 2007 Tutorial and Practical Exercises w/c 20/8 Tutorial Exercises Exercise 10.1 It is known from census data that for a particular income group that 10% of households have no children, 25% have one child, 10 % have three children and 5% have... Date Added: 2009-06-24 18:14:27 |
| HuaweiMBR021509long.pdf Path: Dallas >> LXS >> 055000 Fall, 2009 Description: INTERNATIONALIZATION STRATEGY OF MNES FROM EMERGING ECONOMIES: THE CASE OF HUAWEI Sunny Li Sun University of Texas at Dallas School of Management SM 43, P.O. Box 830688 Richardson, Texas 75083-0688 Tel (972) 883-6041 / Fax (972) 883-6029 sunli@utdal... Date Added: 2009-06-24 18:15:16 |
| Research Paper I data Path: Cornell >> LING >> 1109 Spring, 2009 Description: Word/Phrase word+ to trying to got to want to ought to word+ have would have could have Evolution \"Text\" Final Spelling tryin to wanta tryina gotta wanna oughta would\'ve could\'ve woulda coulda should have others kind of you let me give me sho... Date Added: 2009-06-25 16:03:10 |
| T0412.t04.CB_burial_14_7-logo.pdf Path: UCSC >> T >> 0412 Fall, 2009 Description: T0412.t04 CB_burial_14_7 3 2 1 1 10 20 30 40 A 3 2 1 B D BDE BE ABEBEF G FEDA D F DE BDA FDFD 51 60 70 80 90 EBA 3 2 1 DF G FEDBA BE BE B DBDB A BE DBDB E 101 110 120 130 140 BDEB 3 2 1 EDBD EFD ABEFD FG ... Date Added: 2009-06-25 18:20:18 |
| T0412.t2k.w0.5-logo.pdf Path: UCSC >> T >> 0412 Fall, 2009 Description: T0412.t2k w0.5 3 2 1 1 10 20 30 40 T 3 2 1 H E T SE S E 51 60 70 80 90 T 3 2 1 S E EH T S H T H 101 110 120 130 140 T 3 2 1 E T H T E T S E G 151 160 H 170 KQNYDRYLELLLNGVQQLKKSDSFHQPI T 150 MARIRQVREQG... Date Added: 2009-06-25 18:20:24 |
| Excel 2.xls Path: N. Georgia >> KRPARR >> 5295 Fall, 2009 Description: Ridgedale High School Student Council Fund-Raisers (Feb 1 - Feb 28) Item Lollipops Flowers Pizza Pencils Total Before School $100.00 $175.00 $0.00 $300.00 $575.00 Lunch $25.00 $250.00 $0.00 $100.00 $375.00 After School $175.00 $75.00 $450.00 $50.00 $... Date Added: 2009-06-25 18:20:29 |
| HD93237.bigplot.ps Path: Cal Poly Pomona >> A >> 12010 Fall, 2009 Description: ... Date Added: 2009-06-25 18:21:55 |
| Math 1251_2008_quiz1_soln.pdf Path: Mt. Aloysius >> M >> 1251 Fall, 2009 Description: Math 1251 Quiz 1 17 January, 2008 1. Find the equation of the line through the points (3, 4) and (7, 12) Solution: The slope is given by m = (12 4) / (7 3) = 8/4 = 2 If we use the point slope form with the point (3,4) we obtain y 4 = 2 (x 3), w... Date Added: 2009-06-25 18:24:08 |
| YIL018W.t2k.alpha-logo.pdf Path: UCSC >> YIL >> 018 Fall, 2009 Description: YIL018W.t2k ALPHA 3 2 1 XXXXXXXXX B S E A B A B E H B S C H C E E E C T H B S D D T B S C BE S D B X EEAEE T D BA A E I B B H A S C T XXCABTABAIFXXXXXXXBXBAXX X XXXXXX X XX S EEEEEB B ABAE A CSC BDS C F D G T S B E D C F C B H E E D G ... Date Added: 2009-06-25 18:28:59 |
| YIL060W.t2k.w0.5-logo.pdf Path: UCSC >> YIL >> 060 Fall, 2009 Description: YIL060W.t2k w0.5 2 1 A M M V L L L L L L L L Y V V EILRV I V V V V I I V V C I D LL IP FYIP II LL L XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX IIIFI F L Y V I A W L E L V I I V V R R F L L L Y I V V N V V L L M A S K S S T T S... Date Added: 2009-06-25 18:29:03 |
| YIL001W.t2k.alpha-logo.pdf Path: UCSC >> YIL >> 001 Fall, 2009 Description: YIL001W.t2k ALPHA 3 2 1 E A A B I A T C 10 20 30 40 E I S B 3 2 1 H B S E B H B T A H B T B E I S E B H B S E B H HC 51 A E E B AEEEEE C S D B D A B D B C A S B G A B D G H G A B A E E A I I G I I X X XXXIIIIXXIXXXXX XX X X X X XIIIIXX 60... Date Added: 2009-06-25 18:29:28 |
| 050606_11.ps Path: Wisconsin >> SH >> 050606 Fall, 2009 Description: %!PS-Adobe-2.0 %Creator: MATLAB, The Mathworks, Inc. %Title: 050606_11.ps %CreationDate: 06/06/2005 17:14:37 %DocumentNeededFonts: Helvetica %DocumentProcessColors: Cyan Magenta Yellow Black %Extensions: CMYK %Pages: (atend) %BoundingBox: (atend) %En... Date Added: 2009-06-25 18:33:13 |
| 2954.txt Path: UNC >> DOCS >> 2954 Fall, 2009 Description: The Project Gutenberg EBook of Venetian Years: Return to Venice by Jacques Casanova de Seingalt This eBook is for the use of anyone anywhere at no cost and with almost no restrictions whatsoever. You may copy it, give it away or re-use it under the... Date Added: 2009-06-25 18:35:06 |
| 2936.txt Path: UNC >> DOCS >> 2936 Fall, 2009 Description: The Project Gutenberg EBook of Geological Contemporaneity and Persistent Types of Life, by Thomas H. Huxley This eBook is for the use of anyone anywhere at no cost and with almost no restrictions whatsoever. You may copy it, give it away or re-use ... Date Added: 2009-06-25 18:35:18 |
| 29065.txt Path: UNC >> DOCS >> 29065 Fall, 2009 Description: Project Gutenberg\'s Bremen Cotton Exchange, by Andreas Wilhelm Cramer This eBook is for the use of anyone anywhere at no cost and with almost no restrictions whatsoever. You may copy it, give it away or re-use it under the terms of the Project Gute... Date Added: 2009-06-25 18:35:51 |
| jccln10.txt Path: UNC >> DOCS >> 2952 Fall, 2009 Description: Project Gutenberg Etext A Cleric in Naples, by Jacques Casanova #2 in our series by Jacques Casanova Copyright laws are changing all over the world, be sure to check the laws for your country before redistributing these files! Please take a look at... Date Added: 2009-06-25 18:36:14 |
| othling.pdf Path: New Mexico >> CS >> 460 Spring, 2008 Description: Othling 1 Proposal: Mix CD Website Andy Othling CS460 Prof. Bridges 11 February 2008 Othling 2 Overview I propose to build a website based on the idea of mix CD exchanges that happen in a lot of message boards and forums, with a little bit of a t... Date Added: 2009-06-25 18:41:05 |
| sjb_iccv2001.ppt Path: Sveriges lantbruksuniversitet >> CMPT >> 882 Fall, 2009 Description: Matching Shapes Serge Belongie*, Jitendra Malik and Jan Puzicha U.C. Berkeley *Present address: U.C. San Diego University of California Berkeley Computer Vision Group Biological Shape DArcy Thompson: On Growth and Form, 1917 studied transformat... Date Added: 2009-06-25 18:46:14 |
| p28_031.pdf Path: St. Michael >> CH >> 212 Fall, 2009 Description: 31. (a) We rst nd the currents. Let i1 be the current in R1 and take it to be positive if it is upward. Let i2 be the current in R2 and take it to be positive if it is to the left. Let i3 be the current in R3 and take it to be positive if it is to th... Date Added: 2009-06-25 18:47:50 |
| p31_029.pdf Path: St. Michael >> CH >> 212 Fall, 2009 Description: 29. (a) By Lenzs law, the induced emf is clockwise. In the rod itself, we would say the emf is directed up the page. Eq. 31-10 leads to E = BLv = (1.2 T)(0.10 m)(5.0 m/s) = 0.60 V . (b) By Ohms law, the (clockwise) induced current is i = 0.60 V/0.40 ... Date Added: 2009-06-25 18:47:52 |
| 2SolPrelim.pdf Path: Cornell >> WEB >> 2940 Fall, 2009 Description: Answer for problem 2, Math 2940 Problem 2. For which values of a is 10 A = 1 a 20 invertible? Solution. The matrix A is invertible if equivalently, (1) the columns are linearly independent, (2) the rank of A is 3, (3) rref (A) = I3 . Notice that if ... Date Added: 2009-06-25 18:56:00 |
| Group7-Automotive Industry.ppt Path: UCSB >> ESM >> 210 Fall, 2008 Description: Automotive Industry Week 1, April 10, 2002 Group 7 The Five Forces Model Porter (1980) Threat of new entrants to Industry Bargaining Power of Suppliers Existing Competitors Bargaining Power of buyers Threat of Substitute products or services Th... Date Added: 2009-06-25 19:01:37 |
| 730standard.pdf Path: Université du Québec à Montréal >> M >> 224674 Fall, 2009 Description: IEEE Std 730-1998 (Revision of IEEE Std 730-1989) IEEE Standard for Software Quality Assurance Plans Sponsor Software Engineering Standards Committee of the IEEE Computer Society Approved 25 June 1998 IEEE-SA Standards Board Abstract: Uniform, m... Date Added: 2009-06-25 19:03:37 |
| 003346_1.pdf Path: Pittsburgh >> AEI >> 4784 Fall, 2009 Description: ... Date Added: 2009-06-25 19:05:28 |
| PAREA_PED_COLL.pdf Path: Université du Québec à Montréal >> R >> 17165 Fall, 2009 Description: Le dpistage des tudiantes et des tudiants qui cherchent obtenir un rsultat faible au test de classement en anglais, langue seconde, au collgial Gilles Rache, Universit de Moncton Jean-Guy Blais, Universit de Montral Texte propos la revue Pdagogie c... Date Added: 2009-06-25 19:09:44 |
| AA101 Course Fees.xls Path: Washington >> AA >> 101 Fall, 2009 Description: AA101 Course Fees Consumables Airplanes Rocket motors X-acto knives Glue Clay Duct Tape Gym rental Total Consumables Lab Instuments Cycle Computers Flight instruments Signal generators Vibration stands Force transducers Jet engine Water Rocket Launch... Date Added: 2009-06-25 19:11:28 |
| soci111m17div3.pdf Path: UNC >> M >> 111 Fall, 2009 Description: Regression Analysis of Divorce Rate - U.S. 1920-1996 Variables DIVMF - divorces per 1,000 married women 15 years old and over FLFPRT - female labor force participation as % women 16 years old and over MARUMF - marriages per 1,000 unmarried wome... Date Added: 2009-06-25 19:14:23 |
| v2400ai.pdf Path: Stanford >> V >> 152 Fall, 2009 Description: MVME2400 Series VME Processor Module Installation and Use V2400A/IH3 August 2001 Copyright 1999, 2000, 2001 Motorola, Inc. All rights reserved. Printed in the United States of America. Motorola and the Motorola symbol are registered trademarks of ... Date Added: 2009-06-25 19:14:38 |
| PS_2_Key.pdf Path: Montana >> CHEM >> 141 Fall, 2008 Description: Chem 141 Problem Set 2. 1. Germanium has five isotopes of appreciable (>0.005%) natural abundance. 70Ge 20.53% (abundance) 69.9243 amu (mass) 72Ge 27.43% 71.9217 73Ge 7.76% 72.9234 74 Ge 36.54% 73.9219 76 Ge 7.76% 75.9214 Compute the atomic mass of... Date Added: 2009-06-25 19:15:28 |
| Part 3a.doc Path: Cal Poly Pomona >> ACCT >> 304 Fall, 2009 Description: Soseh Pashaian Serieneh Pashaian Diana Panduro Nereyda Gutierrez Saaya Akahira Part 3: File Update and Reporting Step 1: Inventory master file (2) goes into file update and reporting from file maintenance. Step 2: Inventory transaction file goes int... Date Added: 2009-06-25 19:15:34 |
| 12-RNRR.pdf Path: BYU >> ET >> 502 Fall, 2009 Description: EngT502 Fall 2005 PELE - POISSON EQUATION-LAPLACE EQUATION 12- RNRR Kevin Jeffs The Laplace Equation: 12 RNRR (Robin-Neumann-Robin-Robin) Neumann u y = f 2 (x ) y=M M Robin Robin u + H 3u x = f3 (y) x =0 u =0 2 u + H 4u x = f 4 (y) x=L... Date Added: 2009-06-25 19:25:03 |
| Jefflessonplan.doc Path: Millersville >> ELED >> 320 Fall, 2009 Description: Jeffrey Miller and Luke Gammache Context: 1. Inclusive Class with team teaching: 20 students 10 with mild learning disabilities 2. Grade 6 3. suburban 4. 5 computers in a classroom 5. 3 students with no computers at home 6. Four people in a group eac... Date Added: 2009-06-25 19:25:40 |
| m1371.pdf Path: East Los Angeles College >> TIMETABLEF >> 0910 Fall, 2009 Description: Please note these timetables are strictly provisional and likely to change Module timetable - EK215015S, Tropical Ecology and Management (Wk 28, wk starting 25/01/2010) 08:00AM 09:00AM 10:00AM 11:00AM 12:00PM 01:00PM 02:00PM 03:00PM 04:00PM ... Date Added: 2009-06-25 19:25:53 |
| Ecommerce3.ppt Path: East Los Angeles College >> CL >> 0809 Fall, 2009 Description: Financing E-commerce Financing q q q q Raising money Valuation Winners and losers Futurology RaisingtheMoney RaisingtheMoney q q q q q FamilyandFriends Bankloan Angels VCs IPO 10K 100K 250K 2M 20M VCCriteria VCCriteria q q q q q Globalsustaina... Date Added: 2009-06-25 19:27:52 |
| indx.txt Path: Harvard >> OBS >> 00755 Fall, 2009 Description: srcid srcno ra dec x y srcname lev gl gb offset psf error ratio scale_src scale_bkg ac_ra ac_dec ac_srcname ... Date Added: 2009-06-25 19:30:38 |
| 11082006.doc Path: SUNY IT >> PHI >> 330 Fall, 2009 Description: TheThreeReligionsofChina TheoldformulaforChinesereligionwasthethreereligionsofChina:thepurelyChinese Confucianism,Taoism,andanadoptedandnaturalizedformofBuddhism.Forthelastthousandyears themostobviousfactaboutChinesereligiouslifewasthecomplexinterrel... Date Added: 2009-06-25 19:31:01 |
| ratings-good.doc Path: UT Chattanooga >> ENGR >> 331 Fall, 2009 Description: vti_encoding:SR|utf8-nl vti_timelastmodified:TR|21 Jan 1999 15:17:15 -0000 vti_extenderversion:SR|5.0.2.6738 vti_cacheddtm:TX|21 Jan 1999 15:17:15 -0000 vti_filesize:IR|20992 vti_cachedtitle:SR|clear voice, clear explanation, good diagram, gave refer... Date Added: 2009-06-25 19:32:05 |
| HW1.pdf Path: Utah >> PHYS >> 3150 Fall, 2008 Description: Homework #1 (due before next class) 1. Look up the denitions of: energy, power, and sustainability. Using your own words, dene sustainable energy and email me your denition. 2. Email me describing your previous knowledge of energy and sustainability,... Date Added: 2009-06-25 19:32:30 |
| engls124.pdf Path: Harvard >> DCE >> 32235 Fall, 2009 Description: English 124S. Shakespeare. Summer, 2009. MW 8:30-11:30 a.m. Sever Hall 102 Professor Gordon Teskey, Department of English, Harvard University Ms Jamey E. Graham, Doctoral Candidate, Comparative Literature, Harvard University. Final Examination: Frida... Date Added: 2009-06-25 19:33:17 |
| first_day_su09.pdf Path: Purdue >> ME >> 274 Fall, 2009 Description: ME 274 Basic Mechanics II Summer 2009 Notes: Instructor: Chuck Krousgrill Office: ME 367 Office phone: 49-45738 Office hours: 9:45-10:45AM on MTWThF Email: krousgri@purdue.edu ME 261, 8:40-9:40AM MTWThF J.L. Meriam and L.G. Kraige, Engineering Mecha... Date Added: 2009-06-25 19:33:40 |
| Procedure.doc Path: Minnesota >> COMP >> 3150 Fall, 2009 Description: Installation of Gaim Gaim is available for download at several different sites on the Internet, such as Source Forge. The following set of instructions outline its installation on a Windows Operating System. The user is assumed to have familiarity wi... Date Added: 2009-06-25 19:36:24 |
| Backend money flows.pdf Path: Sveriges lantbruksuniversitet >> CMNS >> 230 Fall, 2009 Description: Table of Contents 1. Introduction . 3 2. Methodology & Focus .. 4 3. Dening the Back End .. 5 4. Traditional Markets . 6 4 .1 Domestic Market .. 6 4 .2 Domestic Theatrical Market . 6 4 .3 Domestic Home Entertainment Market .. 10 4 .4 Domestic Televis... Date Added: 2009-06-25 19:38:38 |
| Fine_Ten Lies of Ethnography.pdf Path: Sveriges lantbruksuniversitet >> CMNS >> 801 Fall, 2009 Description: Journal of Contemporary Ethnography http:/jce.sagepub.com TEN LIES OF ETHNOGRAPHY: Moral Dilemmas of Field Research GARY ALAN FINE Journal of Contemporary Ethnography 1993; 22; 267 DOI: 10.1177/089124193022003001 The online version of this article ca... Date Added: 2009-06-25 19:38:52 |
| Wittgenstein excerpts.pdf Path: Sveriges lantbruksuniversitet >> CMNS >> 801 Fall, 2009 Description: ... Date Added: 2009-06-25 19:39:13 |
| 6808qz4a99.pdf Path: Colorado >> ASSIGN >> 6808 Fall, 2009 Description: quiz4_long.nb 1 The University of Colorado at Boulder Deparment of Economics ECON 6808-1998 Y Quiz Four-September 29, 1998 SCENARIO: Wilbur maximizes the linear utility function u=s+b subject to a linear money constraint m=pss+pbb and a linear time... Date Added: 2009-06-25 19:41:22 |
| lec03 lex_slides 070506.pdf Path: Western Michigan >> CS >> 4850 Fall, 2008 Description: CS4850 SummerII 2006 Lexical Analysis and Lex 3.1 the source text xy := x*100; / multiply x by hundred / and assign to xy is handled as the sequence of tokens TokenType TokenValue xy -x ; xy := x * 100 IDENT ASSIGN IDENT ARITH_OPRTR ... Date Added: 2009-06-25 19:41:43 |
| WA1.pdf Path: Drexel >> MATH >> 630 Fall, 2009 Description: WA 1 April 3, 2009 Submit your solutions on Thursday, April 9. (2 pts.) Problem 1. Find the real and imaginary parts of: 5 2 1+i 1+i 3 , (1 + i 3)6 , , 1 3i 1i 1i 4 . (2 pts.) Problem 2. Find all complex z for which (1 + z )(1 z )1 is: (i) pure... Date Added: 2009-06-25 19:42:45 |
| syl_7036_hiv_09.doc Path: Université du Québec à Montréal >> R >> 22204 Fall, 2009 Description: Dpartement des sciences conomiques UQAM Syllabus Prof Philip Merrigan (bureau-ESG R5015, poste 8385, courriel: merrigan.philip@uqam.ca) Hiver 2009 3. conomtrie des donnes de panels 3.1 MCO 3.2 Modles avec effets alatoires 3.3 Modles avec effets fixe... Date Added: 2009-06-25 19:43:53 |
| midterm_soln.txt Path: Concordia Chicago >> CS >> 521 Fall, 2009 Description: Here are the sample solutions for the midterm: Q1: ack(2,3) = ack(1,ackerman(2,2) = ack(1, ack(1, ack(2,1) = = ack(1, ack(1, ack(1,2) = ack(1, ack(1, exp(2,2) = = ack(1, ack(1, 4) = ack(1, exp(2,4) = ack(1, 16) = = exp(2,16) = 65536 Q2: It would ... Date Added: 2009-06-25 19:43:58 |
| par_30_script22.txt Path: Stanford >> EDUC >> 39108 Fall, 2009 Description: &ext... Date Added: 2009-06-25 19:46:07 |
| Homework1.pdf Path: Eastern Washington University >> TECH >> 409 Fall, 2008 Description: Fall 2003 TECH 409 RADIO AND COMMUNICATION ELECTRONICS HOMEWORK #1 Department of Engineering Technology at Eastern Washington University Assigned: October 8, 2002 Due: October 15, 2002 Instructions: Read carefully all questions and NEATLY answer a... Date Added: 2009-06-25 19:51:50 |
| page1.pdf Path: Sveriges lantbruksuniversitet >> ACA >> 320 Fall, 2009 Description: SKETCH 2 / FRAGMENTS anu chouhan david ko susan baek IAT320 E101 ... Date Added: 2009-06-25 19:53:43 |
| Grade Conversion Scale.doc Path: High Point >> HAL >> 1704 Fall, 2009 Description: Technology Product For Pre-Service Teachers Grading Conversion Scale Points Earned Letter Conversion Grade Conversion <10 F 0-60 10 C70 20 C 73 31 C+ 77 41 B80 51 B 83 62 B+ 87 72 A90 82 A 93 93 A+ 97 ... Date Added: 2009-06-25 20:05:32 |
| Distance-matters.ppt Path: CSU Channel Islands >> ICS >> 205 Fall, 2009 Description: Distance Matters Gary Olson & Judith Olson Hy Loc Distance Matters 1 Outline Collocated Work Remote Work Four Concepts base on Observation Future Technology and Issues Distance Matters 2 The Death of Distance by Frances Cairncross Geography... Date Added: 2009-06-25 20:06:22 |
| spreadsheet_functions.doc Path: UF >> EIN >> 4354 Fall, 2008 Description: Table 4S-1 FINANCIAL FUNCTIONS FOR SPREADSHEETS Financial Function Net Present Value Internal Rate of Return Future Value (F/P,i,n) Present Value (P/F,i,n) Effective Interest Rate Periods to reach FV Excel =NPV(Rate,Values) =IRR(Values,Guess) Qu... Date Added: 2009-06-25 20:07:32 |
| CANM600_mod4.doc Path: Academy of Art >> MOD >> 600 Fall, 2009 Description: Digital Techniques for Illustration Introduction We will be taking the work developed in the preliminary research part of our project in Module 3 and develop it into a final illustration. This is about matching style and technique to our concept to c... Date Added: 2009-06-25 20:09:02 |
| 23659.txt Path: UNC >> DOCS >> 23659 Fall, 2009 Description: The Project Gutenberg EBook of 21, by Frank Crane This eBook is for the use of anyone anywhere at no cost and with almost no restrictions whatsoever. You may copy it, give it away or re-use it under the terms of the Project Gutenberg License includ... Date Added: 2009-06-25 20:10:31 |
| nl092807.pdf Path: University of Illinois, Urbana Champaign >> NL >> 0708 Fall, 2009 Description: University of Illinois Department of French 28 September 2007 FILM FESTIVAL PANEL PAUSE CAF Pause Caf Thursdays at Espresso Royale (Oregon/Goodwin), 5:30pm. The Illinois Program for Research in the Humanities Presents: Paris Through the Global Lens A... Date Added: 2009-06-25 20:10:38 |
| lecture-2japan.doc Path: U. Memphis >> GEOG >> 4306 Fall, 2008 Description: Lecture 2 Prodigious Japan: Triumph of Techonology I. Geographic Qualities of Japan: 1. An archipelago of mountains islands off the east coast of Eurasia. 2. Buys raw materials and sells finished products. 3. Example in the world of modernization. 4.... Date Added: 2009-06-25 20:14:12 |
| CS520_Lect_01_Intro_2004.pdf Path: UMKC >> CS >> 520 Fall, 2009 Description: CS 520: Network Architecture I Fall 2004 Lecture 1: Introduction This lecture provides an overview of the Internet, a summary of the material to be covered in the course, and an overview of underlying network technologies upon which TCP/IP is expecte... Date Added: 2009-06-25 20:14:29 |
| THE SEASONS AND ME.doc Path: N. Georgia >> MELANE >> 3663 Fall, 2009 Description: THE SEASONS AND ME CATEGORY Excellent Very Good 8 Good 6 Needs Work 4 Absent 0 Participation 10 and Cooperation On-task behavior 10 8 6 4 0 Activity Sheet 10 8 6 4 0 Scrapbook 10 8 6 4 0 Crafts 10 8 6 4 0 Sharing your work ... Date Added: 2009-06-25 20:15:05 |
| tichy98.ps Path: Georgia Tech >> CS >> 6340 Fall, 2009 Description: %!PS-Adobe-2.0 %Creator: dvipsk 5.58f Copyright 1986, 1994 Radical Eye Software %Title: moreexperiments.dvi %Pages: 12 %PageOrder: Ascend %BoundingBox: 0 0 596 842 %DocumentPaperSizes: A4 %EndComments %DVIPSCommandLine: dvips moreexperiments.dvi -o m... Date Added: 2009-06-25 20:15:19 |
| tut9.pdf Path: Allan Hancock College >> COMP >> 2070 Fall, 2009 Description: COMP5116 Internet Protocols Semester 1, 2009 Tutorial 9 Mobile IP and IP Multicast 1. The mobile IP specification defines three conceptually separate forms of authentication: mobile to home agent, mobile to foreign agent, and foreign agent to home ag... Date Added: 2009-06-25 20:16:53 |
| Temp.doc Path: WVU >> EE >> 480 Fall, 2008 Description: TEMPERATURE SENSORS EVALUATION MATRIX: Cost (35%) Thermocouple 3.5 sensors Point wireless 0.5 HOBO 0.5 External Squitter 1.5 Accuracy (30%) 2 3 2 3 Range (15%) 1.5 1.5 1.5 1.5 Simplicity (15%) 1.5 0 1.5 1.5 Weight (5%) 0.5 0.5 0.5 0.25 Totals 9 5.5 6... Date Added: 2009-06-25 20:18:36 |
| Day20-slides.pdf Path: University of Illinois, Urbana Champaign >> ATMS >> 502 Fall, 2008 Description: A tm s 5 0 2 N u m e r ic a l F lu id D y n a m ic s Tue., Oct. 31, 2006 D iffu s io n R e f: D u r r a n C h a p . 2 , 3 , A n d e r s o n e t a l C h a p 4 ; H a ltin e r & W illia m s D iffu s io n N o w s ta r t to c o n s id e r m u ltip le p... Date Added: 2009-06-25 20:20:51 |
| 28104-pdf.pdf Path: UNC >> DOCS >> 28104 Fall, 2009 Description: The Project Gutenberg EBook of The Pulpit Of The Reformation, Nos. 1, 2 and 3. by John Welch, and Bishop Latimer and John Knox This eBook is for the use of anyone anywhere at no cost and with almost no restrictions whatsoever. You may copy it, give i... Date Added: 2009-06-25 20:24:56 |
| demam10.txt Path: UNC >> DOCS >> 2815 Fall, 2009 Description: Project Gutenberg\'s Democracy An American Novel, by Henry Adams #2 in our series by Henry Adams Copyright laws are changing all over the world, be sure to check the copyright laws for your country before posting these files! Please take a look at ... Date Added: 2009-06-25 20:25:00 |
| lotos-exposant.pdf Path: Université du Québec à Montréal >> MGL >> 7160 Fall, 2009 Description: ... Date Added: 2009-06-25 20:25:27 |
| 21490.txt Path: UNC >> DOCS >> 21490 Fall, 2009 Description: The Project Gutenberg EBook of The Two Supercargoes, by W.H.G. Kingston This eBook is for the use of anyone anywhere at no cost and with almost no restrictions whatsoever. You may copy it, give it away or re-use it under the terms of the Project Gu... Date Added: 2009-06-25 20:25:49 |
| hmkak3.doc Path: Montana >> HOMEPAGE >> 201 Fall, 2009 Description: Economics 201: Answer Key 3 1 Risk versus Return is an old adage on Wall Street. If higher expected returns are a good and greater risk of loss is a bad, what does a typical investors riskreturn indifference map look like? With risk on the y-axis ... Date Added: 2009-06-25 20:26:16 |
| csci group project.doc Path: N. Georgia >> MEPOWE >> 3052 Fall, 2009 Description: Power Point Presentation Rubric Life Cycle: _ Group Members Name: _ Component First slide has correct information Each stage of the cycle has a slide Correct Information Organization Neatness Grammar and Spelling Presentation Creativity _ Excellent V... Date Added: 2009-06-25 20:32:31 |
| Lab4PerfTests.xls Path: Michigan >> ME >> 495 Fall, 2009 Description: Test Order Test Subject Test 1: Visual Only Test 2: Haptic Only Test 3: Combo 1 1 2 3 2 1 3 2 3 2 1 3 4 2 3 1 5 3 1 2 6 3 2 1 7 1 2 3 8 1 3 2 9 2 3 1 10 2 1 3 11 3 1 2 12 3 2 1 Name Maneesh Debby Deanna Theo Ben Rob Drew Prof. Gillespie Steve Mike D... Date Added: 2009-06-25 20:38:20 |
| uc41644_01.pdf Path: Texas San Antonio >> UC >> 41644 Fall, 2009 Description: U R B A N C LU STER O U TLIN E M A P (C EN SU S 2000) Iow a Park, TX LEGEND SYMBOL DESCRIPTION International AIR (Federal) Trust Land / Home Land OTSA / TDSA / ANVSA Tribal Subdivision SYMBOL NAME STYLE CANADA LANSE RES (1880) T1880 KAW OTSA (534... Date Added: 2009-06-25 20:38:41 |
| hw1.pdf Path: Alabama >> CS >> 403 Fall, 2008 Description: CS 403 Homework 1 Fall 2005 Please read Chapters 1, 2, and 3 in the textbook before you begin. 1. Chapter 2 Exercise 1 (parts a, c, e, g, i, k) 2. Chapter 2 Exercise 3 (parts a, c, e, g, i, k) 3. Chapter 3 Exercise 1 (parts a, b, c) 4. Chapter 3 E... Date Added: 2009-06-25 20:40:12 |
| T0403.t06.str2-logo.pdf Path: UCSC >> T >> 0403 Fall, 2009 Description: T0403.t06 str2 4 3 2 1 MGRDLQVTLYGTIKAGVEVSRVKDAGTYKAQGGKSKTATQIADFGSKIGFKGQEDLGNGMKAIWQLEQKASIAGTNSGWGNRQSFIGLKGGFGTVRAGNL 1 10 20 30 40 50 60 70 80 90 HZA T Z T ZYZEZ 4 3 2 1 T T T YZY T Z T YA ETZ Y T TSTS H A ZT YA ZTZ NTVLKDSGDNVNAWES... Date Added: 2009-06-25 20:40:19 |
| ACADEMIC EXPECTATIONS OF STUDENTS.doc Path: SEMO >> UI >> 100 Fall, 2009 Description: ACADEMIC EXPECTATIONS OF STUDENTS AT SOUTHEAST MISSOURI STATE UNIVERSITY The Nature and Purpose of the University The American university constantly challenges the capacity of individuals to associate in a spirit of free inquiry, with a decent respec... Date Added: 2009-06-25 20:40:39 |
| 003238_1.pdf Path: Pittsburgh >> AEI >> 6004 Fall, 2009 Description: ... Date Added: 2009-06-25 20:44:48 |
| sup.pdf Path: UF >> COT >> 3100 Fall, 2008 Description: Supplemental Exercises Here are some review questions that you can work to help prepare for the exam. (1) Question 3 from the book, page 114. (2) Questions 16 and 17 from the book, on page 115. (2) Questions 26, 27, and 28 from the book, on page 116.... Date Added: 2009-06-25 20:45:48 |
| v004a007.pdf Path: Allan Hancock College >> V >> 004 Fall, 2009 Description: T HEORY OF C OMPUTING, Volume 4 (2008), pp. 137168 http:/theoryofcomputing.org Norms, XOR lemmas, and lower bounds for polynomials and protocols Emanuele Viola Avi Wigderson Received: July 24, 2007; published: November 18, 2008. Abstract: This pape... Date Added: 2009-06-25 20:52:22 |
| ethnic prejudice in the marketplace.doc Path: St. Johns >> KWATK >> 193 Fall, 2009 Description: Kevin Watkins Professor Campbell Theology of the Marketplace Ethnic and Homosexual Prejudice ETHNIC PREJUDICE IN THE MARKETPLACE There are a number of unseen prejudices that exist in the marketplaces of our economy. Many lawsuits have been fought an... Date Added: 2009-06-25 20:53:27 |
| Design_ReviewII(trial).ppt Path: Mississippi State >> ECE >> 4522 Fall, 2009 Description: Recalibration Alarm System 1 Notification Systems Inc. (NSI) SENIOR DESIGN II : MISSISSIPPI STATE UNIVERSITY RECALIBRATION ALARM RECALIBRATION SYSTEM SYSTEM Recalibration Alarm System 2 SENIOR DESIGN II : MISSISSIPPI STATE UNIVERSITY Team Membe... Date Added: 2009-06-25 20:56:38 |
| HW1_sol.pdf Path: UF >> COT >> 3100 Fall, 2008 Description: Solutions to Homework 1 Section 1.1 2. (a)This is not a proposition; its a command. (b)This is not a proposition; its a question. (c)This is a proposition that is false. (d)This is not a proposition;its truth value depends on the value of x. (e)This... Date Added: 2009-06-25 20:56:41 |
| Chapter12.ppt Path: UConn >> CSI >> 101 Fall, 2009 Description: Discovering Computers 2008 Chapter 12 Information System Development Chapter 12 Objectives List the phases in the system development cycle Describe the various tools used in object modeling Identify the guidelines for system development Explain the... Date Added: 2009-06-25 20:57:51 |
| main-up2.ps Path: W. Alabama >> ECE >> 427 Fall, 2009 Description: %!PS-Adobe-2.0 %Creator: dvips(k) 5.86 Copyright 1999 Radical Eye Software %Title: main.dvi %Pages: 4 0 %PageOrder: Ascend %BoundingBox: 0 0 612 792 %EndComments %BeginProcSet: PStoPS 1 15 userdict begin [/showpage/erasepage/copypage]{dup where{pop d... Date Added: 2009-06-25 21:00:37 |
| positionPaper_final.doc Path: CSU Northridge >> SMS >> 35077 Fall, 2009 Description: Position Paper 1 Position Paper: Bridging the Digital Divide Sadia M Syed California State University, Northridge SED 690: Seminar on Ed Technology in Secondary Schools 05/26/06 Instructor, Dr. Brian Foley Position Paper Background: Computers and ... Date Added: 2009-06-25 21:05:06 |
| YHR141C.t2k.stride-ebghtl-logo.pdf Path: UCSC >> YHR >> 141 Fall, 2009 Description: YHR141C.t2k EBGHTL 3 2 1 C X TEEECCTCCCCC T T TEEETTTTE X CCCT T TCE E B X X X X X X X X X X X EEETT C 10 T TT G E X T TTTTH CCCXCTCTTCCCTCCTCCCCCCTHHHHHXX H H E E ETC E H E C T TTTC X X X X X X X X X E X X X X X TTTCEEEE C C 20 EE EE T X ... Date Added: 2009-06-25 21:10:36 |
| LCO-SSAD.pdf Path: USC >> CS >> 577 Fall, 2009 Description: LCO SSAD (TEAM#4) Suim Hurr Enterprise Model (Create Internal DB) GUI fun cti on name inp ut d ata() o utput data() Don or name 1 Set of Book Image Files name 1 1 1 1 1 1 Set of Book Image Files n ame Use Zip Disks or TCP/IP to transfer files Scann... Date Added: 2009-06-25 21:12:42 |
| q4_00s_s.pdf Path: Alabama Huntsville >> MAE >> 364 Fall, 2009 Description: ... Date Added: 2009-06-25 21:15:34 |
| lecture5permission1.ppt Path: UMBC >> IS >> 451 Fall, 2008 Description: GroupAccounts; SecuringResourceswith Permissions Lecture5 GroupAccounts 1. 2. GroupADobjectsthatcontainusers,computers andotherentities.(haveSIDS) Groupsareusedforeasiermanagementofusers/ computers/resources Accesstokenidentifiesgroupstow... Date Added: 2009-06-25 21:16:48 |
| USDA_Stream_Restoration_Handbook.pdf Path: N.C. State >> CE >> 481 Fall, 2008 Description: http:/www.usda.gov/stream_restoration See this site for downloads, addenda, and a catalog of the book\'s images. By: The Federal Interagency Stream Restoration Working Group FISRWG (10/1998). Stream Corridor Restoration: Principles, Processes, and Pr... Date Added: 2009-06-25 21:19:20 |
| lab2_432.ps Path: Portland >> EE >> 432 Fall, 2009 Description: %!PS-Adobe-2.0 %Creator: dvipsk 5.58f Copyright 1986, 1994 Radical Eye Software %Title: lab2_432.dvi %Pages: 4 %PageOrder: Ascend %BoundingBox: 0 0 612 792 %EndComments %DVIPSCommandLine: /pkgs/TeX-3.1415/sun4os5/dvips lab2_432 %DVIPSParameters: dpi=... Date Added: 2009-06-25 21:19:33 |
| chapt21.pdf Path: Illinois Tech >> CS >> 425 Fall, 2009 Description: \' & Chapter 21: New Applications $ Decision-Support Systems Data Analysis Data Mining Data Warehousing Spatial and Geographic Databases Multimedia Databases Mobility and Personal Databases Information-Retrieval Systems Distributed Informa... Date Added: 2009-06-25 21:22:11 |
| means.pdf Path: SUNY Albany >> M >> 308 Fall, 2009 Description: Central Limit Theorem Inference about means X1,X2,Xn independent identically distributed random variables with mean and variance 2, then as n goes to infinity the sample mean Xbarn = (X1+X2+Xn)/n has a distribution approximate normal with mean and ... Date Added: 2009-06-25 21:24:51 |
| newABCD.pdf Path: East Los Angeles College >> ENG >> 0708 Fall, 2009 Description: 1) d 2) d 3) d a b c a b c a b c 4) d 5) d 6) d a b c a b c a b c ... Date Added: 2009-06-25 21:27:47 |
| PAE2394.t2k.n_sep-logo.pdf Path: UCSC >> PAE >> 2394 Fall, 2009 Description: PAE2394.t2k n_sep 3 2 1 1 10 20 30 40 DADA 3 2 1 D GA D D GH IDH D H 51 60 70 80 90 D 3 2 1 GD A D A D GDA D 101 110 120 130 140 A 3 2 1 D GA UD A D H D 151 160 170 180 190 H 3 2 1 D H GIA D H D AD... Date Added: 2009-06-25 21:28:13 |
| L4.pdf Path: UMass (Amherst) >> CS >> 653 Fall, 2009 Description: Intradomain routing Lecture 4 CS 653, Fall 2008 Routing as a shortest path problem 5 2 1 v 2 3 3 1 w 1 5 u z 2 x y Shortest path between u and z = uxyz with cost 4 Routing algorithm: algorithm that finds least-cost path. But how to set the... Date Added: 2009-06-25 21:28:51 |
| chapter6exampleproblem1.xls Path: N.E. Illinois >> MGT >> 3800 Fall, 2009 Description: Example Problem - Chapter 6 Grain Grain Elevators Chicago St. Louis Cincinnati Supply Shipped Kansas City 150 Omaha 175 Des Moines 275 Demand 200 100 300 Grain Shipped Cost = Total Supply = Total Demand = ... Date Added: 2009-06-25 21:29:16 |
| Which test.doc Path: UF >> STA >> 3024 Summer, 2008 Description: For each combination of response and predictor, What do we want to infer? Response has a Normal Distribution Response is Quantitative but NON-Normal Distribution = median response in the population Response is Categorical p = Proportion of Successs ... Date Added: 2009-06-25 21:32:11 |
| 1918_index.pdf Path: CSU Chico >> BCD >> 1918 Fall, 2009 Description: ... Date Added: 2009-06-25 21:32:17 |
| LeeOh07APJM.pdf Path: Dallas >> SXL >> 029100 Fall, 2009 Description: Asia Pacific J Manage (2007) 24:97114 DOI 10.1007/s10490-006-9027-y REVIEWS Corruption in Asia: Pervasiveness and arbitrariness Seung-Hyun Lee & Kyeungrae Kenny Oh Published online: 12 January 2007 # Springer Science + Business Media, LLC 2007 Abs... Date Added: 2009-06-25 21:36:24 |
| 070804_11.ps Path: Wisconsin >> TC >> 070804 Fall, 2009 Description: %!PS-Adobe-2.0 %Creator: MATLAB, The Mathworks, Inc. Version 7.4.0.287 (R2007a). Operating System: Darwin 8.10.1 Darwin Kernel Version 8.10.1: Wed May 23 16:33:00 PDT 2007; root:xnu-792.22.5~1/RELEASE_I386 i386. %Title: ./070804_11.ps %CreationDate: ... Date Added: 2009-06-25 21:42:40 |
| SPRING_05_Grade_List.pdf Path: Cincinnati >> ENFD >> 382 Fall, 2008 Description: SSN XXX-XX-0011 XXX-XX-0262 XXX-XX-0295 XXX-XX-0403 XXX-XX-0622 XXX-XX-1113 XXX-XX-1676 XXX-XX-2052 XXX-XX-2294 XXX-XX-2336 XXX-XX-2457 XXX-XX-2468 XXX-XX-2747 XXX-XX-2766 XXX-XX-2768 XXX-XX-2907 XXX-XX-2990 XXX-XX-3034 XXX-XX-3107 XXX-XX-3111 XXX-XX... Date Added: 2009-06-25 21:43:34 |
| CHAPTER_2.pdf Path: Cincinnati >> ENFD >> 382 Fall, 2008 Description: CHAPTER 2 Energy and Energy Transfer First Law of Thermodynamics To/from our system 1 MORE ON UNITS 1 N = 1 kgm/s2 1 J = 1 Nm = 1 kgm2/s2 1 Pa = 1 N/m2 = 1 kg/(ms2) 1 J/kg = 1 m2/s2 mV2 = kg(m2/s2) = energy mgz = kg(m/s2)m = energy mass acceler... Date Added: 2009-06-25 21:43:42 |
| PtyS206_L13_Earth_as_Planet.doc Path: Arizona >> PTYS >> 206 Fall, 2008 Description: Earth as a Planet February 24, 2005: Chapter 7, Pages 152173 Tuesday: Chapter 8, Pages 174186 When we look at the Earth from space or the Sun, planets, other Solar System objects, and stars from Earth, we see the history of the Universe as a snapshot... Date Added: 2009-06-25 21:47:00 |
| PtyS206_L10_Astronomical_Instrumentation.doc Path: Arizona >> PTYS >> 206 Fall, 2008 Description: ASTRONOMICAL INSTRUMENTATION February 15, 2005 Chapter 5, Pages 108133 Thursday: Assessment Activity Next Tuesday: Chapter 6, Pages 134151 I. Humans have 5 senses: taste, smell, touch, sound, and sight II. Since objects in space are far away, we cann... Date Added: 2009-06-25 21:47:00 |
| exam2f96.doc Path: CSU San Marcos >> PS >> 399 Fall, 2009 Description: Social Security # _ MID-TERM #2 PS 399 Fall 1996 Dr. Nichols I. Multiple Choice: Please select the best response for the following questions (4 points each). A. Experiments 1. Which of the following is primarily considered a threat to the internal ... Date Added: 2009-06-25 21:48:36 |
| quiz10.doc Path: CSU San Marcos >> PS >> 100 Fall, 2009 Description: PSCI 100 Spring 1998 Dr. Nichols NAME_ QUIZ #10 Both the Dye/Zeigler and Harrigan texts address the question of how much difference exists between the Republican and Democratic parties - but they reach opposite conclusions! State the conclusion of ... Date Added: 2009-06-25 21:48:50 |
| inpa.txt Path: UCSB >> CS >> 130 Fall, 2009 Description: 0 CR achille CR acampsia CR backwater CR achillea CR backy CR backwraps CR baconer CR acherontic CR acanthaceous CR backwinded CR achillein CR acampsia CR backyards CR acana CR baclava CR achiest CR achieves CR backus CR acantha CR backveld CR backwo... Date Added: 2009-06-25 21:48:56 |
| ammonium_hydroxide.pdf Path: Air Force Academy >> MSDS >> 115 Fall, 2009 Description: Ordering Products What\'s New Support Who We Are Services SEARCH HOME Franais * SECTION 1 - CHEMICAL PRODUCT AND COMPANY IDENTIFICATION * MSDS Name: Ammonium Hydroxide Catalog Numbers: A470-250, A512-500, A564-200L, A564-20L, A564-2... Date Added: 2009-06-25 21:50:37 |
| ammonium_hydroxide.pdf Path: Air Force Academy >> MSDS >> 112 Fall, 2009 Description: Ordering Products What\'s New Support Who We Are Services SEARCH HOME Franais * SECTION 1 - CHEMICAL PRODUCT AND COMPANY IDENTIFICATION * MSDS Name: Ammonium Hydroxide Catalog Numbers: A470-250, A512-500, A564-200L, A564-20L, A564-2... Date Added: 2009-06-25 21:50:39 |
| pchap5.pdf Path: Rutgers >> MATH >> 591 Fall, 2008 Description: 5. Conditional Expectation A. Denition of conditional expectation Suppose that we have partial information about the outcome , drawn from according to probability measure I ; the partial information might be in the form P of the value of a random ve... Date Added: 2009-06-25 21:51:24 |
| Contents page_08.pdf Path: Laurentian >> CHEM >> 200803 Fall, 2009 Description: Contents Page [1] Laboratory Schedule. [2] Safety Rules and Agreement. [3] Glassware and Equipment List.. [4] A Guide to the Reporting of Results. [5] Experiment 1: Spreadsheet Laboratory. [6] Experiment 2: Measurement of Volume. [7] Experiment 3: Ac... Date Added: 2009-06-25 21:55:15 |
| Expt 2_3_4_5_08.pdf Path: Laurentian >> CHEM >> 200803 Fall, 2009 Description: #2. Measurement of Volume 19 EXPERIMENT 2. MEASUREMENT OF VOLUME For making accurate measurements in analytical procedures, next in importance to the balance is equipment for the measurement of volume. In this section burets, and pipets are discuss... Date Added: 2009-06-25 21:55:16 |
| ETurnOn.ps Path: Stanford >> MEETING >> 050802 Fall, 2009 Description: %!PS-Adobe-2.0 %Title: /a/bbrnfs03/det/trg/trg/dwalker/RELEASES/18.0.4/workdir/newTurnOnPlots/ETurnOn.ps: c1 %Creator: ROOT Version 4.03/02 %CreationDate: Tue Aug 2 13:22:49 2005 %EndComments %BeginProlog /s {stroke} def /l {lineto} def /m {moveto} d... Date Added: 2009-06-25 21:55:57 |
| NormesDeProg.pdf Path: NSULA >> GEL >> 19966 Fall, 2009 Description: No r me s de p ro g ramm at i o n C+ M a rc Pa r i ze au IFT-19966 Al g o r i t hme s de li n gn ie u r I Ide n t ic ate u rs namespace class struct typedef int MonNamespace; MaClasse; MaStructure; MonInt; template<class T> MonPatronT; 2 IFT-199... Date Added: 2009-06-25 22:02:21 |
| Final3380H00.pdf Path: Neumont >> DIFT >> 3380 Fall, 2009 Description: DIRO, Universit de Montral NOM: Code permanent: IFT3380/6380 Hiver 2000 Architecture des ordinateurs contemporains Examen Final (Hiver 2000) Professeur: El Mostapha Aboulhamid Question 1 (20) Directives Toute documentation est permise. Une calcu... Date Added: 2009-06-25 22:04:23 |
| dictionary.txt Path: UNI >> EXAM >> 051 Fall, 2009 Description: vti_encoding:SR|utf8-nl vti_timelastmodified:TR|11 May 2009 15:43:19 -0000 vti_extenderversion:SR|5.0.2.6790 vti_lineageid:SR|{660A4E80-661C-4550-ABE2-722B0E8D651C} vti_backlinkinfo:VX|courses/previous/051/spring2009/assign/labs/exam2/exam2.htm vti_a... Date Added: 2009-06-25 22:08:22 |
| 27C64_EPROM.pdf Path: Oregon State >> ECE >> 573 Fall, 2008 Description: 27C64 64K (8K x 8) CMOS EPROM FEATURES High speed performance - 120 ns access time available CMOS Technology for low power consumption - 20 mA Active current - 100 A Standby current Factory programming available Auto-insertion-compatible plastic ... Date Added: 2009-06-25 22:08:43 |
| YDL055C.t2k.dssp-ebghstl-logo.pdf Path: UCSC >> YDL >> 055 Fall, 2009 Description: YDL055C.t2k EBGHSTL 3 2 1 C EEEE X C E C X X X X X X X X C S C E SSS CETTG S X C T E CCC H S H X X H S E C G H T C G C S C G S S C T S S T G G X X X X X C H X X S G CTTHCSSSGEGC H H C H SE EGEEC H T E H XXX X X XXXXXXEXHXXX X GGCTTC HH ... Date Added: 2009-06-25 22:12:00 |
| YDL033C.t2k.dssp-ebghstl-logo.pdf Path: UCSC >> YDL >> 033 Fall, 2009 Description: YDL033C.t2k EBGHSTL 3 2 1 CC X H H H HSCCC T T X X C T S X X X XXXXXXXXXXXTXXXXXXXXE X HH 1 10 20 30 40 H 3 2 1 T S E S H T CCE S C T S T T C C S C S C S C S T S T T S E T S T S T E T S S T H H S C C G E H H E H H S C S X X X X X X... Date Added: 2009-06-25 22:12:33 |
| YDL035C.t2k.alpha-logo.pdf Path: UCSC >> YDL >> 035 Fall, 2009 Description: YDL035C.t2k ALPHA 2 1 E B S B I E C H HH E C HXHXXXIIXXXXXHXX E X XXX XHHXIIIXHSIIIXXIIIIIXHHXXX X X X X X X H E 1 10 20 30 40 E 2 1 H S B H B H B S H S E B H S I I I I H I I I I I I H I I I I I I X X X XXXXXXXXXXIIIXXXXXXXXXXX 51 60 ... Date Added: 2009-06-25 22:12:41 |
| YDL056W.t2k.dssp-ebghstl-logo.pdf Path: UCSC >> YDL >> 056 Fall, 2009 Description: YDL056W.t2k EBGHSTL 3 2 1 CC X T E C C XHXXXEEEXSCTSX C E X X X X CHHHHHHHT CE H S SSC X C X X 1 10 20 30 40 H 3 2 1 T E T E T S H T H HHHHH 51 T C C H C T T TXXXXXXXXXXXXX H C H X X 60 70 80 90 E 3 2 1 E H T H E T SCCH... Date Added: 2009-06-25 22:12:47 |
| siteplandiagram.pdf Path: UF >> MEETING >> 323 Fall, 2009 Description: ... Date Added: 2009-06-25 22:14:17 |
| L21IncrementalProg.ppt Path: UMBC >> PUB >> 104 Fall, 2009 Description: Incremental Programming Topics Review of Incremental Programming Example of Incremental Programming Reading None. CMSC 104, Version 9/01 Incremental Programming Review It is best not to take the \"big bang\" approach to coding. Write your code... Date Added: 2009-06-25 22:14:37 |
| YKL132C.t2k.stride-ebghtl-logo.pdf Path: UCSC >> YKL >> 132 Fall, 2009 Description: YKL132C.t2k EBGHTL 3 2 1 CC 1 TTTTTTTTT X XXXXXX 10 20 30 40 H 3 2 1 TG T E TH HHCCCCC C T T X X X 51 60 70 80 90 H 3 2 1 E TET E T E H H T T H H C X X HCCCTXT T T X X TT X X T 3 2 1 H E T T ET E C X T X E 3 2 1 ... Date Added: 2009-06-25 22:20:56 |
| hw4.pdf Path: N.C. State >> CSC >> 401 Fall, 2008 Description: Homework 4 Issued 9/30/03, Ungraded, Uncollected 1. Consider a satelite connection with a one-way propagation delay of 0.35 seconds between the sending and receiving ground stations (via satelite) and a transmission rate of 1 Mbps with packets of 100... Date Added: 2009-06-25 22:22:54 |
| lect10.ps Path: Iowa State >> CPRE >> 558 Fall, 2009 Description: %!PS-Adobe-2.0 %Creator: dvips(k) 5.86 Copyright 1999 Radical Eye Software %Title: lect10.dvi %Pages: 3 %PageOrder: Ascend %BoundingBox: 0 0 596 842 %EndComments %DVIPSWebPage: (www.radicaleye.com) %DVIPSCommandLine: dvips lect10.dvi -o lect10.ps %DV... Date Added: 2009-06-25 22:23:28 |
| Lesson24.pdf Path: Purdue >> MA >> 527 Fall, 2008 Description: ... Date Added: 2009-06-25 22:26:25 |
| cs2130pres04_c_programmingwhatcangowrong.ppt Path: Georgia Tech >> CS >> 2130 Fall, 2009 Description: CS 2130 Presentation 04 The C Programming Language Question? Suppose you have two files containing all the functions for your C program (main.c and other.c). How can you make an executable? 1. In the file main.c place the following line at the top ... Date Added: 2009-06-25 22:27:27 |
| BQfeb16.pdf Path: Fayetteville State University >> MGF >> 1107 Fall, 2009 Description: Optional Bonus Quiz given Thr Feb 16. Solutions are in boldface. 1. PRINT LAST NAME, print first name 2. Signature 3. Thr Feb 16 4. What sort of correlation would the following pair of variables be likely to have? Altitude on a mountain hike and the... Date Added: 2009-06-25 22:28:14 |
| prog4BoundaryFill4.txt Path: Oakland University >> CSE >> 566 Fall, 2009 Description: void boundaryFill4 (int x, int y, int fillColor, int borderColor) { int interiorColor; /* Set current color to fillColor, then perform following oprations. */ getPixel (x, y, interiorColor); if (interiorColor != borde... Date Added: 2009-06-25 22:28:31 |
| prog2OGLexample.txt Path: Oakland University >> CSE >> 566 Fall, 2009 Description: #include <GL/glut.h> / (or others, depending on the system in use) void init (void) { glClearColor (1.0, 1.0, 1.0, 0.0); / Set display-window color to white. glMatrixMode (GL_PROJECTION); / Set projection parameters. gluOrth... Date Added: 2009-06-25 22:28:31 |
| Abstract - Tyler Smith.pdf Path: Penn State >> TMS >> 349 Fall, 2009 Description: THE WILMER EYE INSTITUTE Outpatient Surgery and Lab Building The Johns Hopkins Hospital Baltimore, Maryland Architect.Wilmot Sanz Design Architect.Ayers Saint Gross General Contractor.The Whiting-Turner Contracting Company Civil Engineering.Rummel Kl... Date Added: 2009-06-25 22:29:02 |
| 15_Recursion.ppt Path: UNC >> COMP >> 114 Fall, 2005 Description: Recursion COMP 114 Tuesday February 26 Lastra, 2001 Slide 1 Announcements Program #2 due, 11:00 AM Thursday Dont forget Folder, envelope Clean, working code No bugs Good documentation! Lastra, 2001 Slide 2 Topics Last Time File I/O Thi... Date Added: 2009-06-25 22:30:43 |
| NICARAGUA press.doc Path: Laurentian >> ANTH >> 3010 Fall, 2009 Description: NICARAGUA:25YEARSAFTERTHEREVOLUTION In 1979, the Frente sandinista de liberacion nacional ousted nicaraguas 40+ year somozan dictatorship in what was to become one of latin americas most famous popular revolutions. Today, nicaragua has become a micr... Date Added: 2009-06-25 22:34:12 |
| AOS105_lecture24_carbon4.ppt Path: UCLA >> AOS >> 105 Fall, 2009 Description: Lecture 25 Carbon Cycle Ocean Acidification Carbon dioxide is increasing in the atmosphere and oceans. What if the ocean stopped absorbing so much CO2? Anthropogenic CO2 Ocean CO2 Uptake Since 1750 A.D. Fossil Fuel emissions: 244 x 1015 gC Atmosp... Date Added: 2009-06-25 22:35:46 |
| handout-6.pdf Path: Wisconsin >> PH >> 060306 Fall, 2009 Description: Local Success Stories in Violence Prevention Alice Kramer, RN, MS Alice Clinical Nurse Specialist, Aurora Sinai Medical Center Clinical Mallory O\'Brien, PhD Mallory Project Director, Milwaukee Police Department Project Sheila Przesmicki Sheila Execut... Date Added: 2009-06-25 22:37:06 |
| ee106_quiz1_sol.doc Path: Glasgow Caledonian University >> ECE >> 106 Fall, 2009 Description: Name Given that find y(n). y(n) = A0.3n + B0.2n y(0) = A+B EE106 Quiz 1 y(n+1) 0.2y(n) = 0.3n (E-0.2)y(n) = 0.3n (0.3 - 0.2)0.3n = A0.3n A+B = 0 A= 0.1 B=-0.1 with y(0) = 0 Feb. 05, 08 y(n) = 0.1(0.3n 0.2n) Given that find y(n). y(n) = A + (-1)n... Date Added: 2009-06-25 22:44:06 |
| CT310spring07FinalExamWithAnswers.pdf Path: Colorado State >> YR >> 310 Fall, 2009 Description: CT 310 Final Exam May 10, 2007 Name _ ANSWER KEY _ EID _ Question Point Value Cum Value Points 1 15 15 2 10 25 3 10 35 4 10 45 5 15 60 6 15 75 7 10 85 8 15 100 TOTAL 100 1. CT 310 Final: Thursday, May 10th 2007 Page 1... Date Added: 2009-06-25 22:45:54 |
| planche_2.pdf Path: NSULA >> GGR >> 2304 Fall, 2009 Description: a b c d e f g h i j k l Figure : Microphotographies de quartz prlevs des Units 3, 5 7 et 9. a) Quartz de la sous-Unit 3a. b) Agrandissement du quartz en a c) Quartz de la . sous-Unit 3b. d) Agrandissement du quartz en c e) Quartz de la so... Date Added: 2009-06-25 22:46:30 |
| planche_3.pdf Path: NSULA >> GGR >> 2304 Fall, 2009 Description: a b c d e f Figure : Microphotographies de quartz prlevs des Units 10 et 12. a) Quartz de la sous-Unit 10a. b) Agrandissement du quartz en a c) Quartz de . la sous-Unit 12c. d) Agrandissement du quartz en c e) Quartz de la sous-Unit 12c f ) Agr... Date Added: 2009-06-25 22:46:30 |
| test.txt Path: UCSB >> MAT >> 602 Fall, 2009 Description: <!DOCTYPE html PUBLIC \"-/W3C/DTD XHTML 1.0 Strict/EN\" \"http:/www.w3.org/TR/xhtml1/DTD/xhtml1-strict.dtd\"> <html xmlns=\"http:/www.w3.org/1999/xhtml\"> <head> <title> Changeset 602 for src/data/test.txt attribute </title> ... Date Added: 2009-06-25 22:47:51 |
| lecture_24_notes.pdf Path: Rose-Hulman >> ECE >> 341 Fall, 2009 Description: 1 Transient Waves on lossless lines How are voltage waves reflected when transmission lines are terminated in reactive elements? For this case, the capacitor, the reflection will vary with time. Initially when the positively-traveling voltage wave e... Date Added: 2009-06-25 22:48:40 |
| Sacks-Lost Mariner.pdf Path: Laurentian >> NEUR >> 200901 Fall, 2009 Description: ... Date Added: 2009-06-25 22:51:37 |
| CUIN 6360_SACSyllabus_SpT07.doc Path: U. Houston >> CUIN >> 6360 Fall, 2008 Description: CUIN 6360 Principles of Curriculum Development Spring 2007 Section 01039 Tuesdays, 5:00 307 Farish Hall Instructor Professor Allen R. Warner Farish Hall 350 713-743-5059 (Voice) 713-743-4990 (Fax) awarner@uh.edu Accommodation When possible, and in a... Date Added: 2009-06-25 22:53:29 |
| The Algae_SAR.doc Path: CSU Northridge >> SD >> 51881 Fall, 2009 Description: Biol 421L Marine Biology Spring 2009 1 The Algae The algae are probably the most diverse group of organisms, in part because the word \"algae\" refers to no specific phylogenetic group. Algae are a heterogeneous group that we define as all photoaut... Date Added: 2009-06-25 22:54:47 |
| Air.pdf Path: JMU >> FALCON >> 384 Fall, 2009 Description: 00 Technical illustr ation of gasmask in use during World War I, ca. 1916. BRUNO L ATOUR air At r st we feel noth ing, we a re insensit ive, we a re nat ura l ized. A nd then sudden ly we feel not someth ing, but the absence of someth ing we d i... Date Added: 2009-06-25 22:57:49 |
| 19390825.TXT Path: Penn State >> BUB >> 1939 Fall, 2009 Description: Sheet1 STATE COLLEGE, PENNSYLVANIA DAILY WEATHER SUMMARY - Latest Complete Day [Midnight - Midnight LT] -08/25/39 High Temperature Low Temperature Mean Temperature Rain or Liquid Equivalent Snow and/or Ice Pellets Snow Depth 84 Rank (1=Warmest, 44=... Date Added: 2009-06-25 23:01:50 |
| Garbage Collection.ppt Path: Texas >> EE >> 380 Spring, 2000 Description: vti_encoding:SR|utf8-nl vti_timelastmodified:TR|06 Sep 2005 19:32:19 -0000 vti_extenderversion:SR|5.0.2.6417 vti_author:SR|ENGR\\chasec vti_modifiedby:SR|POOH\\chase vti_timecreated:TR|30 Oct 2001 20:32:02 -0000 vti_title:SR|PowerPoint Presentation vti... Date Added: 2009-06-25 23:02:13 |
| hw5.pdf Path: Elmhurst >> CHEM >> 101 Fall, 2009 Description: Chemistry 101 Homework Problem Set # 5 Due Wednesday, October 15 Name: Section (circle): 01 02 03 These questions are based on section 5.5 and chapter 6 (primarily sections 6.5-6.8) of the textbook: Timberlake, K. General, Organic and Biological Ch... Date Added: 2009-06-25 23:02:45 |
| lec5.ps Path: Iowa State >> CS >> 633 Fall, 2009 Description: %!PS-Adobe-2.0 %Creator: dvips(k) 5.86 Copyright 1999 Radical Eye Software %Title: document.dvi %Pages: 4 %PageOrder: Ascend %BoundingBox: 0 0 612 792 %EndComments %DVIPSWebPage: (www.radicaleye.com) %DVIPSCommandLine: dvips -t letter -o document.ps ... Date Added: 2009-06-25 23:02:47 |
| lec17.pdf Path: Iowa State >> CS >> 633 Fall, 2009 Description: ... Date Added: 2009-06-25 23:02:49 |
| Lecture III(b).ppt Path: UCF >> ENV >> 3001 Fall, 2008 Description: ENV 3001 Introduction to Environmental Engineering Lecture III (b) Review Session Instructor: Dr. Ni-Bin Chang Spring, 2006 HW 3.1 # Five million kilograms per day of coal are burned in an electric power plant. # The coal has an ash content of 12% b... Date Added: 2009-06-25 23:04:24 |
| sect5.2.pdf Path: Mercyhurst >> M >> 109 Fall, 2009 Description: Section 5.2: Normal Distributions: Finding Probabilities Today we will study (Part I) How to nd probabilities for normally distributed variables Last time we learned how to nd the area under The Standard Normal Distribution. Today we will look at ... Date Added: 2009-06-25 23:05:38 |
| HTTPConnections.pdf Path: Toledo >> EECS >> 4980 Fall, 2008 Description: Java Has Support for HTTP HTTP Connections Java HTTP HyperText Transfer Protocol Java has some explicit support for dealing with HTTP. It was planned as part of the language. URL - Universal Resource Locator http:/www.eecs.utoledo.edu:80/~jheuri... Date Added: 2009-06-25 23:07:18 |
| sol4.pdf Path: Allan Hancock College >> MATH >> 2400 Fall, 2009 Description: ... Date Added: 2009-06-25 23:08:26 |
| SHOEBOX.H.doc Path: Cardinal Stritch >> CS >> 306 Fall, 2009 Description: #ifndef SHOEBOX_H #define SHOEBOX_H class ShoeBox { public: ShoeBox(double l, double h, double w); double getLength() const; double getHeight() const; double getWidth() const; void Properties(); double Area() const; double Volume() const; private: do... Date Added: 2009-06-25 23:12:20 |
| input4.txt Path: ASU >> CSE >> 200 Fall, 2008 Description: A Banana 0 L A Melon 0 L A Orange 1 L A Peach 2 L A Grape 4 L T L a Apple 0 a Banana 0 a Apple 0 a Lemon 2 a Lemon 0 a Banana 0 a Banana 0 A Lemon 4 L u L Q ... Date Added: 2009-06-25 23:13:19 |
| Progress Wk9.doc Path: UCSD >> MAE >> 156 Fall, 2008 Description: Ocean Controllable Drogues Progress Report for Week 9 Group 15 Goals for next week All Finishing touches and present. Accomplishments from last week Verified waterproof end caps Wired circuit on Lab-X2 board Risks/challenges End caps can be diffi... Date Added: 2009-06-25 23:14:51 |
| cv.pdf Path: SUNY Albany >> WA >> 8538 Fall, 2009 Description: William L Adamczak Department of Mathematics and Statistics University at Albany, SUNY 1400 Washington Avenue Albany, NY 12222 EDUCATION 2008 (Expected) - Ph.D. Mathematics, University at Albany, SUNY, Albany, NY, Advisor: Cristian Lenart 2005 - M.A.... Date Added: 2009-06-25 23:18:26 |
| week_7.doc Path: WVU >> EE >> 480 Fall, 2008 Description: WEST VIRGINIA UNIVERSITY COLLEGE OF ENGINEERING AND MINERAL RESOURCES Lane Department of Computer Science and Electrical Engineering DESIGN PROJECT TEAM WEEKLY REPORT TEAM NO/TITLE 17/ Smart Measurement Device Member Bryant W. Boyce David I. Chamber... Date Added: 2009-06-25 23:20:59 |
| es210s3schedflow1a.pdf Path: Alaska Anch >> ES >> 210 Fall, 2008 Description: ... Date Added: 2009-06-25 23:22:47 |
| Chap3.pdf Path: Acton School of Business >> CHBE >> 501 Fall, 2008 Description: Chapter 3 - Cartesian Vectors and Tensors: Their Calculus Tensor functions of time-like variable Curves in space Line integrals Surface integrals Volume integrals Change of variables with multiple integrals Vector fields The vector operator -gradien... Date Added: 2009-06-25 23:24:57 |
| Aesthetic process.docx Path: Dallas >> RXI >> 082000 Fall, 2009 Description: Art(ifacts)andAestheticprocesses To my view this article is about the changes in art (in its various characteristics) in our age, t he information age. The article refers art in general and li terature in particular, and examines the changes in every... Date Added: 2009-06-25 23:26:16 |
| chapt02.ppt Path: Macon State >> CHEM >> 1211 Fall, 2009 Description: vti_encoding:SR|utf8-nl vti_timelastmodified:TR|02 Sep 2004 19:43:40 -0000 vti_extenderversion:SR|6.0.2.6551 vti_backlinkinfo:VX|chem1211_2.htm ... Date Added: 2009-06-25 23:27:38 |
| mtr.nfc.txt Path: McGill >> METEO >> 04011707 Fall, 2009 Description: MTRBNO SPECI KBNO 170013Z AUTO 16003KT 3/4SM BR OVC007 M03/M04 A3012 RMK AO2 VIS 1/2V3 CIG 006V009 TSNO MTRBNO SPECI KBNO 160008Z AUTO 03003KT 5SM BR SCT002 BKN110 M02/M03 A3006 RMK AO2 TSNO MTRBNO METAR KBNO 160053Z AUTO 00000KT 3SM BR SCT120 ... Date Added: 2009-06-25 23:30:29 |
| amos.ppt Path: Oklahoma Baptist >> WP >> 101 Fall, 2009 Description: AmosandHosea Prophetsofthe AssyriancrisisinIsrael Theprophetsbygroups Theprophetsbygroups 8thCenturyProphets Amos Hosea Isaiah139 Micah Theprophetsbygroups 8thCenturyProphets Amos Hosea Isaiah139 Micah AKAprophetsofthe A... Date Added: 2009-06-25 23:35:15 |
| chap7.pdf Path: NMT >> P >> 526 Fall, 2009 Description: 38 7. SIGNAL PROPAGATION In this chapter we introduce a very important basic tool: the speed at which a disturbance propagates through a uid. Because the disturbance were considering is compressive think of a locally overpressure region one exampl... Date Added: 2009-06-25 23:35:30 |
| CSET.pdf Path: CSU Fresno >> ZIMMER >> 100 Fall, 2009 Description: California Subject Examinations for Teachers (CSET) CSET: Multiple Subjects Practice Test Subtest II Go to page 17 Science; Mathematics Copyright*+*2003*by*National*Evaluation*Systems,*Inc.*(NES) \"California*Subject*Examinations*for*Teachers,\"*\"CS... Date Added: 2009-06-25 23:40:22 |
| Review of lecture 16.doc Path: Washington >> AA >> 506 Fall, 2009 Description: Review of lecture 16 Chapter 3 System of vortices Near- ground trajectory of trailing vortices (continued) Rebound is caused by secondary vortices induced on the ground by the adverse pressure gradient around primary vortices. Chapter 4. Azimuthal ... Date Added: 2009-06-25 23:40:29 |
| Pitts Roster.doc Path: Trinity U >> CS >> 4386 Fall, 2009 Description: Course Name and Title CSCI-4286-1 Senior Software Project II Instructors Gerald Pitts Student 1 Austin, Ryan E. 2 Barth, David A. 3 Caille, Ryan P. 4 Choo, Tai-San 5 Crowe, Loren D. 6 DeFelice, David C. Hohimer, Christopher 7 J. 8 Houck, David P. 9... Date Added: 2009-06-25 23:41:04 |
| sp96finalsoln.pdf Path: Wisconsin >> STAT >> 572 Spring, 2007 Description: Stat/For/Hart 572 - Final Exam, Spring 96 - Partial Solutions 1. Note: that the randomized design might look something like: 3. (4 (4 Source Row co1 A B AxB Error Total df 3 3 1 1 1 6 15 (b) We treat this as a one-way ANOVA. The (b) land6. 2. ... Date Added: 2009-06-25 23:44:23 |
| Grade Conversion Scale.doc Path: High Point >> TURNE >> 104 Fall, 2009 Description: Technology Product For Pre-Service Teachers Grading Conversion Scale Points Earned Letter Conversion Grade Conversion <10 F 0-60 10 C70 20 C 73 31 C+ 77 41 B80 51 B 83 62 B+ 87 72 A90 82 A 93 93 A+ 97 ... Date Added: 2009-06-25 23:51:02 |
| unitinformation07.pdf Path: Allan Hancock College >> STAT >> 502 Fall, 2009 Description: STAT502 Nonlinear Regression Introduction This unit expounds the statistical theory underlying nonlinear regression models, and presents an appreciation of the practical applications of this technique by the use of varied examples. This outline will ... Date Added: 2009-06-26 00:01:33 |
| Pairing Worksheet.pdf Path: Los Angeles Southwest College >> UNIV >> 101 Fall, 2009 Description: University 101 Fall 2009 PEER LEADER Pairing Worksheet Please fill out this form regarding your preferences for course teaching days/times, course section types, and desired level of involvement in course planning and implementation. The University 1... Date Added: 2009-06-26 00:03:28 |
| hw12-solved.pdf Path: Cornell >> P >> 213 Fall, 2009 Description: Physics 213 Problem Set 12 Solutions 1. Reading Assignment Serway Sections 19.13, 19.5, 20.13, 20.7. Next week: Chapter 21. Spring 1998 2. similar to Serway 19.42 A bubble of air from a scuba divers tank is emitted near the bottom of a lake 30 m ... Date Added: 2009-06-26 00:06:43 |
| week6.pdf Path: Colorado >> ATOC >> 5560 Fall, 2008 Description: Week 6: October 1-5 k-Distributions and Solar Heating Topics: 1. k-distributions 2. Correlated k-distributions 3. Solar heating 4. Chapman prole Reading: Liou 4.3; Thomas 10.4,10.5.4 Problems with band models: Curtis-Godson approximation for inho... Date Added: 2009-06-26 00:11:10 |
| prop_task list4.pdf Path: University of Illinois, Urbana Champaign >> AE >> 441 Fall, 2008 Description: AE 441 Spring 2009 Aerospace Vehicle Design Aircraft Design Section Task List #4 Propulsion 1. Try and catch up with the tasks if you feel you are lagging behind. 2. Prepare for the upcoming freeze date in a week. Whether or not you impose the freez... Date Added: 2009-06-26 00:14:33 |
| Math100LAB.pdf Path: New Mexico >> MATH >> 100 Fall, 2008 Description: Math 100 Lab Fall 2004 Instructor: Julie DePree, Ph.D. Office: Academic Building Telephone: 925-8607 I. Office Hours: M 2:00-3:00, W 1:45-3:00 TR 8:30-9:00 am, 2:45-3:45, R 10:15-12:00 E-mail: jdepree@unm.edu Course Description: Math 100 Lab: (1) Co... Date Added: 2009-06-26 00:21:57 |
| solhwch03.pdf Path: Oakland University >> STA >> 226 Fall, 2008 Description: Solutions to Homework of Chapters 3 and 4 Chapter 3 Problems 24: a. Possible X values are those values at which F(x) jumps, and the probability of any particular value is the size of the jump at that value. Thus we have: x p(x) 1 .30 3 .10 4 .05 6 .1... Date Added: 2009-06-26 00:21:58 |
| info.pdf Path: Toledo >> CSC >> 363 Fall, 2009 Description: CSC363 - Computational Complexity and Computability Summer 2005 Instructor: Matei David, email: matei@cs.toronto.edu, oce: SF4302-F, phone: 416-946-3924 Lectures: T6-8 in MP202 Tutorials: T8-9 your last name Akhtar - Kam Karlin - McLean Mehta - Rossi... Date Added: 2009-06-26 00:23:14 |
| 07-LifeThought.pdf Path: UCSD >> COGSCI >> 260 Fall, 2009 Description: CHAPTER 1 A View of Life and Thought Every school kid now learns that genes are made of DNA and that DNA codes for proteins. And everyone knows that human language comprehension and production typically involve coded sequences-strings of speech sou... Date Added: 2009-06-26 00:23:20 |
| Clean Energy Now.doc Path: Colorado College >> FACULTY >> 120 Fall, 2009 Description: Greenpeace Clean Energy Now! Campus Guide: How to Stop Global Warming by Making Your Campus a Leader in Clean Energy For more information, Maria Ramos at: 1-888-363-9197 or maria.ramos@wdc.greenpeace.org Global Warming: The Most Serious Environment... Date Added: 2009-06-26 01:32:55 |
| Test2.pdf Path: Lake County >> ECE >> 313 Fall, 2009 Description: Page 1 of 8 Problem 1. A/ True or false. Consider these two statements: S1: A CDF can have a negative slope S2: A pdf can have a negative slope Mark only one of the boxes below: Only S1 is true Only S2 is true Both S1 and S2 are true Neither S1 nor ... Date Added: 2009-06-26 02:13:16 |
| mid2000Sb.pdf Path: University of Toronto >> CSC >> 148 Fall, 2009 Description: bbb n 5 \" k @ ( pi c 6 i i i\'0! ! !88 (I p 6 7i rc Qi\' 9 7... Date Added: 2009-06-26 02:42:51 |
| PS2.pdf Path: University of Toronto >> CSC >> 236 Fall, 2009 Description: CSC 236 H1F Due: By 6pm on Thursday 8 November. Problem Set 2 Fall 2007 Worth: 5% Keep in mind that your proofs will be graded on their structure at least as much as on their content. In other words, when we ask you to prove a statement, it is to ... Date Added: 2009-06-26 02:43:53 |
| Jupiter-2009.pdf Path: Lake County >> ASTR >> 100 Fall, 2009 Description: Jupiter Astr100 Lecture 19 presented by Dr. Larry Maddox March 4, 2009 General Properties of Jupiter Mass: 318 x Earth Diameter: 11.2 x Earth Mean Density = 1330 kg/m3 Albedo = 0.52 Magnetic Field: 14 x Earths Year = 11.86 Earth years Day = 9 h 50 m... Date Added: 2009-06-26 02:45:09 |
| Asst1.pdf Path: University of Toronto >> CSC >> 401 Fall, 2009 Description: ( F 9 \" R \" ) \" ) 88 H F D D \" A 98 6 5 1 ) # \" S$4Q$sP3(IGE$CB@!\" 73$43 20(\'%$! C U r P y p C u BT6836n3$#8v7 G$\"G 5nSk5#ngp4f61 P m m ` P ! ` y r 1 ! F m 7 ... Date Added: 2009-06-26 02:47:47 |
| syllabus.pdf Path: National Taiwan University >> ASTRO >> 890 Fall, 2009 Description: Astronomy 890 Astronomical Instrumentation Spring Quarter 2008 Syllabus Lectures: W, 3:30-4:48am, 4054 McPherson Lab Professor: Paul Martini Office: 4021 McPherson Lab (292-8632) Office Hours: whenever my door is open (or by appointment) E-Mail: mar... Date Added: 2009-06-26 03:08:59 |
| ps7 Path: USC >> ECON >> 203 Spring, 2009 Description: Economics 205: Principles of Macroeconomics Mark Moore Fall 2008 Problem Set 7 Note: There are a number of problems requiring algebraic computation in this problem set. Do the computations, but then make sure you understand the intuition behind your ... Date Added: 2009-06-26 03:16:25 |
| econ70203_6.pdf Path: Penn >> EC >> 70204 Fall, 2009 Description: @hU H +ii 2 Odvw fodvv/ zh lqwurgxfhg wkh Oxfdv +4<:;, prgho1 Wkhuh lv d wuhh dqg wkh wuhh |lhogv d udqgrp qxpehu ri iuxlwv dw hdfk shulrg1 Wkhuh lv d uhsuhvhqwdwlyh djhqw1 Lq wkh suhylrxv fodvv/ zh vdlg wkdw wkh htxloleulxp kdv wr eh vxfk wkd... Date Added: 2009-06-26 03:56:13 |
| lect-02.fm.ps Path: Duke >> CPS >> 271 Fall, 2009 Description: <?xml version=\"1.0\" encoding=\"UTF-8\"?> <Error><Code>NoSuchKey</Code><Message>The specified key does not exist.</Message><Key>191862b8270163c6849056cdd729c10cda44c4ca.ps</Key><RequestId>C7 7F977D7557A04C</RequestId><HostId>xnSQP8JtC1hhYfueSA3uATxYTh3N... Date Added: 2009-06-26 04:14:36 |
| econ70203_6.pdf Path: Penn >> EC >> 70205 Fall, 2009 Description: @hU H +ii 2 Odvw fodvv/ zh lqwurgxfhg wkh Oxfdv +4<:;, prgho1 Wkhuh lv d wuhh dqg wkh wuhh |lhogv d udqgrp qxpehu ri iuxlwv dw hdfk shulrg1 Wkhuh lv d uhsuhvhqwdwlyh djhqw1 Lq wkh suhylrxv fodvv/ zh vdlg wkdw wkh htxloleulxp kdv wr eh vxfk wkd... Date Added: 2009-06-26 04:31:29 |
| ism50_lecture12.pdf Path: UCSC >> CMPS >> 050 Fall, 2009 Description: ISM 50 - Business Information Systems Lecture 12 Instructor: Katerina Potika UC Santa Cruz May 8, 2008 Outline Announcements Student Presentation Client-Server Computing (contd) SUN Case (contd) Student Presentation Modularity and Layering Announce... Date Added: 2009-06-26 04:49:11 |
| Lecture15.pdf Path: UCSB >> WEB >> 221 Fall, 2009 Description: ... Date Added: 2009-06-26 04:52:45 |
| hw2.pdf Path: Bergen CC >> CS >> 150 Fall, 2009 Description: University of California at Berkeley College of Engineering Department of Electrical Engineering and Computer Sciences EECS150 Spring 2000 Homework #2 This homework is due on Friday February 4th by 11am. Homework will be accepted in the EECS150 box o... Date Added: 2009-06-26 05:42:14 |
| hw5-soln.doc Path: Bergen CC >> CS >> 150 Fall, 2009 Description: University of California at Berkeley College of Engineering Department of Electrical Engineering and Computer Sciences EECS150 Spring 2000 Homework #5 Solution First, some notes about transistors. In our simplified transistor model for digital appli... Date Added: 2009-06-26 05:42:15 |
| ee232HW2.pdf Path: Bergen CC >> EE >> 232 Fall, 2009 Description: Fall 2007 EECS 232: LIGHTWAVE DEVICES HW #2 Due September 20 (Thursday) in class Prof. Ming C. Wu 1. Calculate the absorption coefficient of GaAs at 300 K as a function of the photon energy, from 1 to 2 eV, using material parameters listed in Appe... Date Added: 2009-06-26 05:43:02 |
| AssignStoryboard.pdf Path: Bergen CC >> CS >> 160 Fall, 2009 Description: Assignment: Interface Design + Application Initiation Due October 11, 2007 CS 160, Fall 2007 Overview There are two distinct parts of this assignment. For the interface design, were asking that you storyboard the main tasks for this application (at l... Date Added: 2009-06-26 05:45:28 |
| Test2-version2 Path: Waterloo >> ACTSC >> 431 Spring, 2009 Description: ACTSC 431 - Loss Models 1 FALL 2007 TEST #2 Name : ID Number : 1. (8 marks) Suppose that the per payment r.v. Yp is PAR( = 5; = 200) distributed. In addition, the number of payments Np has a zero-modi.ed BIN(n = 4; q = 0:4) distribution with a probab... Date Added: 2009-06-28 01:37:18 |
| Study Guide for text - Linear Algebra And Its Applications - David C Lay - 3rd ed.0030 Path: Penn State >> MATH >> 220 Fall, 2008 Description: ... Date Added: 2009-06-28 08:11:56 |
| Study Guide for text - Linear Algebra And Its Applications - David C Lay - 3rd ed.0068 Path: Penn State >> MATH >> 220 Fall, 2008 Description: ... Date Added: 2009-06-28 08:16:46 |
| Study Guide for text - Linear Algebra And Its Applications - David C Lay - 3rd ed.0110 Path: Penn State >> MATH >> 220 Fall, 2008 Description: ... Date Added: 2009-06-28 09:44:43 |
| Lecture06 Path: Penn >> ACCT >> 101 Summer, 2009 Description: Lecture 6 Accruals and Deferrals, Accounting Misstatements, and Academic Research 1 Review Recognized revenues (i.e. sales) and realized gains are recorded on which side of the Taccount? Recognized expenses and realized losses are recorded on whic... Date Added: 2009-06-28 11:49:03 |
| Lecture13 Path: Penn >> ACCT >> 101 Summer, 2009 Description: Lecture 13 Inventory Accounting for Harley Davidson and Steris Goals of Today\'s Class Recap of Inventory Acctg. (Lecture 12) Case Study Harley Davidson Steris Cost of Goods Available for Sale ... Date Added: 2009-06-28 11:49:44 |
| Gastrointestinal%20System Path: Texas >> BIO 311D >> bio 311d Summer, 2009 Description: ... Date Added: 2009-06-28 16:09:43 |
| Copy%20of%20Cardiovascular%20exercises Path: Texas >> BIO 311D >> bio 311d Summer, 2009 Description: Cardiovascular System 1. ANATOMICAL TERMS: (Matching terms) 1. atria 2. bicuspid valve 3. arterioles 4. leukocyte 5. endocardium 6. capillaries 7. aorta 8. erythrocyte 9. heart 10. artery a) white blood cell b) pumps blood through the body c) inner l... Date Added: 2009-06-28 16:09:43 |
| 29 Path: Texas >> PHY >> 303L Fall, 2008 Description: Kapoor (mk9499) homework29 Turner (60230) This print-out should have 13 questions. Multiple-choice questions may continue on the next column or page find all choices before answering. 001 10.0 points A transformer has input voltage and current of... Date Added: 2009-06-28 22:18:16 |
| 30 Path: Texas >> PHY >> 303L Fall, 2008 Description: Kapoor (mk9499) oldhomework 30 Turner (60230) This print-out should have 15 questions. Multiple-choice questions may continue on the next column or page find all choices before answering. 001 (part 1 of 2) 10.0 points FM radio bands range from 88... Date Added: 2009-06-28 22:18:31 |
| 35 Path: Texas >> PHY >> 303L Fall, 2008 Description: Kapoor (mk9499) oldhomework 35 Turner (60230) This print-out should have 11 questions. Multiple-choice questions may continue on the next column or page find all choices before answering. 001 10.0 points A 9.5 cm focal length converging lens is u... Date Added: 2009-06-28 22:18:33 |
| 06-Renal medulla Path: Pacific >> BIOL >> BIOL 011 Spring, 2009 Description: ... Date Added: 2009-06-30 17:32:01 |
| m3l17 Path: USC >> CE >> 358 Fall, 2006 Description: Module 3 Analysis of Statically Indeterminate Structures by the Displacement Method Version 2 CE IIT, Kharagpur Lesson 17 The Slope-Deflection Method: Frames with Sidesway Version 2 CE IIT, Kharagpur Instructional Objectives After reading this chap... Date Added: 2009-06-30 23:50:39 |
| L09S09_ManyEAtomsIonizSpin 02-09-09 Path: Berkeley >> CHEM 1A >> 232323 Spring, 2009 Description: CHEM 1A L09: \"ManyEAtomsIonizSpin\" H-Atom, One-Electron Ions Onen=1 l = 0 (s) (s ml = 0 n=2 l = 0 (s) (s ml = 0 Radial Node n=2 ml = -1, +1 l = 1 (p) (p ml = 0 z - 2px Angular Node z 2py + z y x + 2pz z 1s + z 2s + - + y x - y y x y L... Date Added: 2009-07-01 00:01:17 |
| final questions Path: Arizona >> TAR >> TAR109 Spring, 2009 Description: What are the requirements for the audience and for the stage Summer stocke and touring theatre: When is summer stock- memorial day Where is summer stock Why is there summer stick What are the diff types of touring theatre What are the problems with t... Date Added: 2009-07-01 00:27:23 |
| 1460p4 Path: Brown >> ECON >> 146 Fall, 2007 Description: Economics 1460 Industrial Organization Fall 2007 PROBLEM SET 4 (due November 30) 1. (12.1) Consider a duopoly where horizontal price dierentiation is important. Firms .rst simultaneously choose their product locations, then simultaneously set prices ... Date Added: 2009-07-06 22:54:38 |
| Chap6_2009 Path: 東京大学 >> BUS >> BAM314 Spring, 2009 Description: Chapter 6 Financial Statement Analysis Learning Objectivs After studying Chapter 6, you should be able to: Understand the purpose of basic financial statements and their contents. Explain why financial statement analysis is important to the ... Date Added: 2009-07-06 23:11:44 |
| Essentials of Business Information Systems Path: 東京大学 >> BUS >> BAM317 Spring, 2009 Description: Text Book: Laudon & Laudon, Essentials of Business Information Systems, 7th Edition, Pearson (Prentice Hall), 2007 Chapter 1 Business Information Systems in Your Career Multiple Choice Questions 1. One of the recent critical challenges facing Major ... Date Added: 2009-07-06 23:59:30 |
| draft5.pdf Path: University of Toronto >> ESC >> 300 Fall, 2009 Description: FEASIBILITY OF AN ARTIFICIAL NEURAL NETWORK APPROACH TO SOLVING THE PROTEIN FOLDING PROBLEM EXECUTIVE SUMMARY The protein folding problem articulates the issue of how a proteins structure arises from its amino acid sequence. Deterministic approaches... Date Added: 2009-07-08 06:11:21 |
| design_exercises.pdf Path: Allan Hancock College >> ELEC >> 3607 Fall, 2009 Description: ... Date Added: 2009-07-08 06:20:56 |
| arctan_examples.pdf Path: UNL >> MATH >> 107 Fall, 2009 Description: Math 107-250/350 - Analytic Geometry & Calculus I 2nd Semester, 06-07 Arctan Examples 2 Evaluate dx. x2 + 6x + 15 Notice that x2 + 6x + 15 = x2 + 6x + 9 + 6 = (x + 3)2 + 6 so the quadratic denominator is irreducible. Then we rewrite the fraction as 2... Date Added: 2009-07-08 07:07:51 |
| Stitch_bovine_DP_2008.pdf Path: Washington University in St. Louis >> ID >> 114 Fall, 2009 Description: Form Approved Through 09/30/2007 Department of Health and Human Services Public Health Services LEAVE BLANK-FOR PHS USE ONLY. Type Activity Number Review Group Formerly Council/Board (Month, Year) OMB No. 0925-0001 Grant Application Do not exceed c... Date Added: 2009-07-08 08:26:29 |
| week1 Path: UCLA >> LIFE SCI >> ls 4 Winter, 2008 Description: Cross III ... Date Added: 2009-07-08 12:56:53 |
| HourTest3_StudyGuide_summer09 Path: Clemson >> ENGL >> 101 Spring, 2009 Description: STS 101 Chapter 9 Hr Test 3 Review Summer, 2009 (1) What was the social impact of introducing new machinery in the workplace during the Industrial Revolution? What was the impact of the assembly line on worker\'s sense of personal fulfillment? (2) ... Date Added: 2009-07-08 16:57:21 |
| 213 lec8 set1 Path: MSU Bozeman >> PHYS >> 213 Spring, 2002 Description: 8 @9 8 6 4 3 0 ( ! $ ! 75#21)\' @z@ # FzbziFpzipd piXpp@i vi q`zkpitp~pzivp1 i!15ivtd@#qizvq5pz gv@z1 @p iv% p... Date Added: 2009-07-08 18:51:43 |
| project2.ps Path: Concordia Chicago >> CS >> 230 Fall, 2009 Description: %!PS-Adobe-2.0 %Creator: dvipsk 5.58f Copyright 1986, 1994 Radical Eye Software %Title: project2.dvi %Pages: 8 %PageOrder: Ascend %BoundingBox: 0 0 612 792 %DocumentPaperSizes: Letter %EndComments %DVIPSCommandLine: dvips -o project2.ps project2 %DVI... Date Added: 2009-07-10 06:39:22 |
| 5_64 Path: WVU >> MAE EE IEN >> mae ee ien Spring, 2009 Description: ... Date Added: 2009-07-10 13:26:12 |
| GH5_2 Path: WVU >> MAE EE IEN >> mae ee ien Spring, 2009 Description: ... Date Added: 2009-07-10 13:26:43 |
| Java Card Path: F & M >> TI >> 111 Spring, 2009 Description: Java Card Principais Caractersticas: Interoperabilidade Seguro Java Capacidade mltipla Dinmico Padronizado Smart Card Leitor Java Card Limitaes Processo de Desenvolvimento Arquivo CAP eCPF Bilhete nico Fonte: http:/pt.wikipedia.org/wik... Date Added: 2009-07-11 15:43:49 |
| Untitled5 Path: UCF >> COP >> 3502 Spring, 2009 Description: / Arup Guha / 10/24/01 edited 2/24/04 for COP 3502 Lecture / / Linked List Example / Edited in class on 1/28/08 to show how to insert into a circularly linked / / list. #include <stdio.h> # #include <stdlib.h> / Struct used to form a linked list of i... Date Added: 2009-07-12 14:45:40 |
| C1978 Path: Cornell >> PHYSICS >> 1112 Summer, 2009 Description: AP Physics C 1978 Scoring Guidelines The materials included in these files are intended for use by AP teachers for course and exam preparation in the classroom; permission for any other use must be sought from the Advanced Placement Program. Teacher... Date Added: 2009-07-13 19:56:30 |
| THREE TYPES OF FIBERS Path: UCSD >> BILD >> Bild1 Spring, 2007 Description: I. MICROTUBULES -made up of tubulin monomers -thickest guide movement of organelles -help separate chromosome copies in dividing cells -grow out of a centrosome: region near nucleus considered \"microtubule-organizing c... Date Added: 2009-07-14 12:35:34 |
| libcrypt.so Path: Keller Graduate School of Management >> HR >> HR587 Summer, 2009 Description: ELF# #4#88 #4# #(#4#4#4# #\\#tr# #4#4#4# # #Qtd#Rtd## #GNU#, #k#Qj(B`#? #I->LC_#=l#Z# # #3#y##k# #I#B# #P#\" #`n#4# #l#\"# #`l#-# #<# # #\"# #;# #\"# #k#u#\"# # #_gmon_start_#_cxa_finalize#_Jv_RegisterClasses#strncpy#fcrypt#st rlen#memcpy#_stp... Date Added: 2009-07-14 21:28:47 |
| OCHEM 2 EXPERIMENT 2 Path: UGA >> CHEM 2212 >> 234-54 Spring, 2009 Description: Introduction: In this experiment, we will observe an electrophilic aromatic substitution reaction through nitration. We will then determine whether the electrophilic substituent is ortho-, meta-, or para- to the original substituent. In electrophilic... Date Added: 2009-07-19 20:56:13 |
| lec4 Path: MIT >> ELECTRICAL >> 6.012 Fall, 2005 Description: 6.012 - Microelectronic Devices and Circuits - Fall 2005 Lecture 4-1 Lecture 4 - PN Junction and MOS Electrostatics (I) Semiconductor Electrostatics in Thermal Equilibrium September 20, 2005 Contents: 1. Non-uniformly doped semiconductor in thermal... Date Added: 2009-07-20 12:09:20 |
| ps2f02soln Path: MIT >> ELECTRICAL >> 6.111 Fall, 2002 Description: Problem Set 2 Solutions Problem 1. (a) F = (A*B) + (A+D)*(B xor C)* [/ (B*D)] Look at the simplest terms first, i.e. if both A and B are 1, then F is 1 independently of the rest of the circuit. Similarly, if A and D are both 0, then the second expre... Date Added: 2009-07-20 12:41:14 |
| STNotes1 Path: USC >> AME >> 341BL Spring, 2008 Description: ... Date Added: 2009-07-20 17:09:50 |
| assign62k6 Path: UBC >> PHYS >> physics 10 Spring, 2008 Description: Physics 153 Assignment 6 Due Friday October 27, 2006 by 5:30pm 1. An aircraft engine takes in 9000J of heat and discards 6400J each cycle. (a) What is the mechanical work output of the engine during one cycle? (b) What is the thermal efficiency of th... Date Added: 2009-07-20 23:13:33 |
| PPE07_Flux Path: Berkeley >> PHYSICS >> 7B Spring, 2009 Description: Electric Fields Flux RHJansen Electric Field Density When we draw electric field lines the strength of the electric field is evident by the closeness of the lines. Where the lines are closest the field is strongest. If the lines are parallel the f... Date Added: 2009-07-21 01:26:59 |
| KLtransform Path: NCTU >> CM >> EM5102 Fall, 2008 Description: Karhunen-Loeve expansion Let X be a zero-mean m x 1 random vector, and let R = E{XX H } . Let R have the factorization R = U U H , where the columns of U are the normalized eigenvectors of R. Let Y = U H X . Then Y is a zero-mean random vector with ... Date Added: 2009-07-21 09:26:36 |
| m2l1 Path: Berkeley >> UGBA >> 10 Spring, 2009 Description: Module 2: Organizational Behavior and Management Professor Cristina Banks banks@haas.berkeley.edu Office Hours: Monday 2-4 @ F526 The Conceptual Framework Status Report: The Current State of the U.S. Workforce Implications for Business Fundament... Date Added: 2009-07-21 18:44:48 |
| Ch_322a_6.012 Path: USC >> CHEM >> 322AL Summer, 2009 Description: A Mechanism for the SN1 Reaction of t-Butyl Chloride in Water The overall stoichiometry of this reaction is: CH3 CH3-C-Cl CH3 + 2H2O CH3 + CH3-C-OH + H3O + Cl CH3 The reaction of tert-butyl chloride with water to produce tert-butyl alcohol shows ... Date Added: 2009-07-22 20:29:49 |
| 15 Path: The Open University >> MATH. >> 04101 Summer, 2006 Description: 15 \" 1 ,VI.19 , dim Im T < dim ker T , dim Im T < 2 - , . dim Im T + dim ker T = dim R 4 = 4 dim Im T = 0 : dim Im T v 0 - . dim Im T + dim ker T > 4 . Tv = 0 , v v R 4 , Im T = {0} , t , T (1,1,1,1) v 0 - , [ T (1,1,1,1) ] B... Date Added: 2009-07-23 14:26:44 |
| Midterm Review Path: UCSC >> BIO >> 80J Winter, 2009 Description: Midterm Review # 2 (part 2) Answers 1. a) Cas, b) SrO, c) BaS, d) MgO 2. a) H-O(4 e-)-C (DOUBLE) O(4 E-) I O(4 E-) I H b) H I H-C-S(4E-)-H I H 3. a) II O(4 E-) H-O(4E-) Br-(double)O ( 4e-) II O ( 4E-) What does it mean all important resonanc... Date Added: 2009-07-24 18:37:43 |
| Designation and Organization of Use Path: Texas >> ARC >> 308K Spring, 2009 Description: Designation and Organization of Use culture 19:42 We can use architecture to shape and be shaped by the people and their 3 basic things humans have done and still do 1. It\'s a practical matter o We need a way to do it for safety o Polynesians hav... Date Added: 2009-07-24 19:21:44 |
| CH04_Aluminum_Talking-Points Path: Universidad Nacional de Asuncion >> CEE >> 353 Spring, 2009 Description: CEE 353 Civil Engineering Materials CHAPTER 4 Aluminum Aluminum Primarily used for containers and packaging as well as aircraft and automobiles In engineering and construction, it\'s used mostly for architectural and finishing elements like door... Date Added: 2009-07-25 13:06:11 |
| Rittenberg_Chapter 09 Path: Alabama >> ACT >> 4495 Spring, 2009 Description: Chapter 9 Auditing for Fraud Copyright 2010 South-Western/Cengage Learning Audit Opinion Formulation Process Fraud The detection of material fraud is a reasonable expecta... Date Added: 2009-07-26 15:16:45 |
| BATQUES Path: Windsor >> MKT >> 232 Summer, 2009 Description: # $# !#!# # !#L! ... Date Added: 2009-07-28 14:00:35 |
| 2009Final Exam Review 2204 Path: IIT Madras >> ORGANIC CH >> CHEM 2204 Winter, 2008 Description: Chem 2204/2206/2208 Wednesday, April 1 Optional review lecture go over sample Exam and problems TODAY! Friday April 3 Lab Exam Theatre B 11:30 1.00 Final Exam April 22nd (Sample exam is now posted) The Coach Watching his Students Approach the Fi... Date Added: 2009-07-28 21:57:55 |
| Lecture 8 Path: Texas >> BIO >> 365R Spring, 2009 Description: Ion channels and disease Hyperkalemic periodic paralysis (HYPP)-muscle. Long QT syndrome (LQT)-cardiac. Lambert-Eaton syndrome (LES)-motor neuron. Ion channels and disease Hyperkalemic periodic paralysis (HYPP)-muscle. Hyperkalemia: blood K+ lev... Date Added: 2009-07-31 17:45:47 |
| Modification of Plant Architecture in Chrysanthemum by Ectopic Expression of theTonacco Phytochrome Path: A.T. Still University >> HORT >> hor-11-12 Spring, 2009 Description: J. AMER. SOC. HORT. SCI. 126(1):1926. 2001. Modification of Plant Architecture in Chrysanthemum by Ectopic Expression of the Tobacco Phytochrome B1 Gene Zhi-Liang Zheng1 Department of Horticulture and Crop Science, The Ohio State University, Columbu... Date Added: 2009-08-01 02:51:16 |
| Section 4.3 Path: LSU >> EE >> 4720 Spring, 2008 Description: 12-1 This Set 12-1 Material from Section 4.3 This set under construction. Outline Branch Prediction Overview One-Level Predictor Two-Level Correlating Predictor Other topics to be added. Sample Problems 12-1 EE 4720 Lecture Transpare... Date Added: 2009-08-01 16:54:48 |
| Ecommerce3.ppt Path: East Los Angeles College >> CAM >> 0809 Fall, 2009 Description: Financing E-commerce Financing q q q q Raising money Valuation Winners and losers Futurology RaisingtheMoney RaisingtheMoney q q q q q FamilyandFriends Bankloan Angels VCs IPO 10K 100K 250K 2M 20M VCCriteria VCCriteria q q q q q Globalsustaina... Date Added: 2009-08-01 23:37:16 |
| Lab 8 Energy Conservation With Spring.pdf Path: Wesleyan >> PHYS >> 121 Fall, 2009 Description: Physics 121 Lab 8 Mass on a Vertical Spring and Conservation of Energy (2) measurement of mass dependence of oscillation frequency; (3) measurement of oscillation \"form\" and compare with theory; (4) evaluation of conservation of mechanical energy. Me... Date Added: 2009-08-02 05:15:35 |
| signaling_equilibrium%20binding Path: Duke >> BME >> 100 Spring, 2009 Description: Survival in changing environments Input Temperature Light Nutrient pH Cell density . cellular network Output Gene expression Enzymatic activity Motility . Example: Signaling in animals 1) (a-c) cell-to-cell signaling by extracellular chemical... Date Added: 2009-08-03 19:48:10 |
| HW_11.pdf Path: Penn State >> ME >> 106 Fall, 2009 Description: ME23, Section 03, HOMEWORK #10 Due Wednesday, 04/19/06 For new textbook 1. 9.2 (2.5 points). 2. 9.8 (1.5 points). 3. 9.11 (2.5 points). 4. 9.31 (3 points). For old textbook 1. 9.2 2. 9.4 3. 9.7 4. 9.12 Hints: Comments (0.5 point) ... Date Added: 2009-08-05 17:16:32 |
| homework%202 Path: UCSD >> BIBC >> 102 Fall, 2008 Description: BIBC 102 Fall 2008 Homework 2 Name _ Discussion section_ 1) In glycolysis, glucose-6-phosphate is converted to fructose-6-phosphate. If the reactants and products have the following concentrations at equilibrium, calculate the standard free energ... Date Added: 2009-08-05 18:02:00 |
| avoidable interest problem Path: UT Dallas >> BUSINESS >> 4444 Spring, 2009 Description: specific borrowing bondpayable not payable Expenditures 1Jan 30Apr 1Nov 31Dec total AVOIDABLE INTEREST $200,000.00 $500,000.00 $300,000.00 12% 14% 10% 24000 70000 30000 124000 from dec2005 $100,000.00 12 months $100,000.00 8/12 months... Date Added: 2009-08-06 16:22:02 |
| tute8.doc Path: Allan Hancock College >> ELEC >> 3400 Fall, 2009 Description: Elec3400 Tute 8 2002: Linear Oscillators 1) Draw a Hartley Oscillator using a BJT as a common base amplifier. Draw a Colpitts oscillator using a BJT common emitter amplifier. Draw a Colpitts oscillator using a FET common source amplifier. Using the... Date Added: 2009-08-10 19:49:46 |
| Meteoroids.pdf Path: UMass (Amherst) >> PEOPLE >> 7137 Fall, 2009 Description: Meteoroids, Meteors and Meteorites (1) Meteoroids: small, solid particles in space (2) Meteors: small meteoroids completely vapourized in atmosphere (3) Meteorites: remains of meteoroids on Earth General appearance: (a) dark rind: black, possibly rus... Date Added: 2009-08-10 19:50:16 |
| ps04_Lee_v_weisman.doc Path: Penn State >> JLG >> 484 Fall, 2009 Description: Primary Source LEE v WEISMAN Supreme Court of the United States, 1992 505 U. S. 577 JUSTICE KENNEDY delivered the opinion of the Court. School principals in the public school system of the city of Providence, Rhode Island, are permitted to invite mem... Date Added: 2009-08-10 19:50:57 |
| handout1.doc Path: Oregon >> REL >> 325 Fall, 2008 Description: Fall of Constantinople Pentarchy, Patriarch: Rome (Pope), Constantinople (Ecumenical), Alexandria, Antioch, Jerusalem; Moscow 324-Constatine; 379-Rome=Christian; 476-Fall of Western Roman Empire; Byzantine Empire; Constantinople 1071-Battle of Man... Date Added: 2009-08-10 19:51:44 |
| Egr 103 Lab wk1.doc Path: Grand Valley State >> EGR >> 103 Winter, 2008 Description: 1. n s = ( xi - x) 2 /( n - 1) 2 i =1 n s 2 = ( xi - x)( xi - x) /(n - 1) s 2 = ( xi - 2 xxi + x - 2 ) /( n - 1) 2 i =1 n i =1 n s 2 = ( xi - 2 x xi + nx - 2 ) /(n - 1) 2 n s 2 = ( xi - 2 xn x + nx -2 ) /( n - 1) ; using the definition of ... Date Added: 2009-08-10 19:52:57 |
| Luxembourg_dec_1980.pdf Path: Pittsburgh >> AEI >> 1415 Fall, 2009 Description: THE EUROPEAN COUNCIL LUXEMBOURG 2 DECEMBER 1980 Documents in the dossier include: Conclusions Session of the European Council Reproduced from The European Council Dossier of the Group of the European People s Party Luxembourg 1990 Luxembourg Europ... Date Added: 2009-08-10 19:53:18 |
| Sprungk.pdf Path: Pittsburgh >> AEI >> 7278 Fall, 2009 Description: ... Date Added: 2009-08-10 19:53:19 |
| midterm_key.ps Path: UCSD >> CSE >> 190 Spring, 1998 Description: %!PS-Adobe-2.0 %Creator: dvips(k) 5.82 Copyright 1998 Radical Eye Software %Title: midterm.dvi %Pages: 8 %PageOrder: Ascend %BoundingBox: 0 0 612 792 %EndComments %DVIPSWebPage: (www.radicaleye.com) %DVIPSCommandLine: dvips -f midterm.dvi %DVIPSParam... Date Added: 2009-08-10 19:53:52 |
| slac-pub-8167.pdf Path: Stanford >> PUBS >> 8000 Fall, 2009 Description: SLAC-PUB-8167 July 1999 The IFR Online Detector Control system at the BaBar experiment By P. Paolucci et al. Presented at the Santa Fe 99, IEEE NPSS Real Time conference, 6/14/996/18/99, Santa Fe, NM, USA Stanford Linear Accelerator Center, Stanf... Date Added: 2009-08-10 19:54:39 |
| 406_lect21_2005x6.pdf Path: Arizona >> ECOL >> 406 Fall, 2008 Description: Lecture 21, 01 November 2005 Global Climate Change Aquatic Conservation Conservation Biology 406R/506R Conservation Biology ECOL 406R/506R University of Arizona Fall 2005 Kevin Bonine Kathy Gerst 1 1. Global Climate Change, Research Example 2. Con... Date Added: 2009-08-10 19:56:13 |
| oax12z.txt Path: University of Illinois, Urbana Champaign >> ATMOS >> 20081212 Fall, 2009 Description: UPPER AIR CALCULATIONS AND PLOTTING (Ver 5.48.1-LINUX-X11) Current filename: /mnt/noaaport/nwstg/convert/08121200_upa.wxp Date: 0000Z 12 DEC 08 Searching for KOAX. Searching the city database file for: KOAX . Date:0000Z 12 DEC 08 Station: KOAX... Date Added: 2009-08-10 19:57:28 |
| auditory_angle.pdf Path: Georgia Tech >> GTG >> 120 Fall, 2009 Description: 100 80 60 40 20 0 0 1 info. max. heuristic i.i.d. info. max. i.i.d. Angle (degrees) Trial 2 x 10 4 3 ... Date Added: 2009-08-10 19:58:00 |
| SW_Review.pdf Path: Western Michigan >> ECE >> 4510 Fall, 2008 Description: ECE 4510 Introduction to Microprocessors Software R i S ft Review Dr. Bradley J. Bazuin Associate Professor Department of Electrical and Computer Engineering College of Engineering and Applied Sciences Material from or based on: The HCS12/9S12: An I... Date Added: 2009-08-10 19:59:25 |
| M112_ProblemSet07Solns_Fall_2002.pdf Path: UMBC >> MATH >> 112 Fall, 2009 Description: ... Date Added: 2009-08-10 19:59:36 |
| final_fantasy_v_e.txt Path: Binghamton >> LOCKE >> 411 Fall, 2009 Description: Final Fantasy 5 Strategy Guide Super Famicom Japanese Version Version 2.0 Made by Exdeath E-Mail: db3f@uwrf.edu Page: http:/www.uwrf.edu/~db3f Exdeath\'s Final Fantasy 5 Strategy Guide This is the Final Fantasy 5 Strategy Guide. This cop... Date Added: 2009-08-10 19:59:40 |
| COSC105_week_07_handout.pdf Path: IUP >> COSC >> 105 Fall, 2009 Description: Algorithms Chapter 5: Algorithms The Concept of an Algorithm Algorithm Representation Algorithm Discovery Iterative Structures Recursive Structures Efficiency and Correctness Recap - Introduction So, What is Computer Science? Recap - Introd... Date Added: 2009-08-10 20:04:08 |
| CIVE1331_Lecture_011.pdf Path: U. Houston >> WEEK >> 011 Fall, 2009 Description: Theodore G Cleveland Page 1 CIVE 1331 Computing for Engineers 11/12/2003 Purpose: Mat Lab environment MatLab Symbolic Expressions . 1 Integration and Differentiation .. 2 Equation Solving and Simplification . 5 MatLab Symbolic Expressions Assump... Date Added: 2009-08-10 20:06:10 |
| CIVE1331_Lecture_011.pdf Path: U. Houston >> WEEK >> 1331 Fall, 2009 Description: Theodore G Cleveland Page 1 CIVE 1331 Computing for Engineers 11/12/2003 Purpose: Mat Lab environment MatLab Symbolic Expressions . 1 Integration and Differentiation .. 2 Equation Solving and Simplification . 5 MatLab Symbolic Expressions Assump... Date Added: 2009-08-10 20:06:11 |
| KTgetwellPR.doc Path: CSU Channel Islands >> PUBLIC >> 20060504 Fall, 2009 Description: * * * * * * * * * * * * * * * PRESS RELEASE * * * * * * * * * * * * * * For Immediate Release April 18, 2006 Press Contact: Julie Rasmussen A Little Birdy Told Me. 213-622-0915 julie@alittlebirdytoldme.com \"I SEE YOU\" A 3-DAY FUNDRAISING EVENT FOR A... Date Added: 2009-08-10 20:06:42 |
| 02-AllSystemsDown_BethIsraelCrash.pdf Path: UC Davis >> ATT >> 0408 Fall, 2009 Description: All Systems Down - Network Management - CIO Magazine Feb 15,2003 http:/www.cio.com/archive/021503/systems.html Feb. 15, 2003 Issue of CIO Magazine A blow-by-blow record of one of the worst healthcare IT crises in history and what CareGroup CIO Joh... Date Added: 2009-08-10 20:07:13 |
| ln32.pdf Path: Colorado >> PHYS >> 3310 Fall, 2008 Description: ... Date Added: 2009-08-10 20:13:02 |
| test.txt Path: Boise State >> CS >> 557 Fall, 2009 Description: % Auto-generated on Fri Jul 21 15:18:32 PDT 2000 % Nodes % N: index, node_name, x_position, y_position, parameter_value; N: 0, Node 0, 103.0, 141.0, 1.0; N: 1, Node 1, 338.0, 141.0, 1.0; N: 2, Node 2, 221.0, 323.0, -4.076773433292136; % Edges % E: ... Date Added: 2009-08-10 20:13:27 |
| test307.pdf Path: Georgia Tech >> MATH >> 1512 Fall, 2008 Description: NAME: Math 1502 Test 3 November 15, 2007 TA: Mark Bilinski Instructions. Please write your name legibly on top of each page. Closed book, closed notes. Small nonprogrammable calculators are allowed. To receive credit you must show your work and justi... Date Added: 2009-08-10 20:13:35 |
| Summer_2008_ECE_340_Lecture_10.pdf Path: New Mexico >> ECE >> 340 Spring, 2008 Description: ECE 340 Probabilistic Methods in Engineering Class 10 Sampling Sample = subset of measured values of the RV Sample mean, if Xj are iid\'s Mn = 1 n Xj n j =1 - Different from E[X] ! - Sample mean is a RV itself ! - Two theorems: - On the average,... Date Added: 2009-08-10 20:14:30 |
| ES209ShearMomentDiagrams.pdf Path: Alaska Anch >> ES >> 331 Fall, 2009 Description: 160 lb/ft 2,000 lb Load Diagram 1,600 lb 5 ft 8,000 ft-lb 1,200 lb 5 ft 5 ft 5 ft 1600 lb Shear Diagram 800 lb 1200 lb 10,000 ft-lb Moment Diagram 0 ft-lb 6,000 ft-lb 2,000 ft-lb 6,000 ft-lb By: T.B. Quimby VALUE on one diagram equals t... Date Added: 2009-08-10 20:14:37 |
| 162ex2grades.pdf Path: Rutgers >> CHEM >> 162 Fall, 2009 Description: POSTING SSN 01102 01311 01533 01544 01562 01590 01821 01895 02276 04355 04868 05233 05615 07286 07646 07852 07896 08014 08179 08354 10375 14486 15083 15721 18142 19684 20074 20692 20707 20744 20770 21183 21218 21397 21529 21659 21772 21791 22038 2204... Date Added: 2009-08-10 20:14:54 |
| Syllabus.pdf Path: Cuyamaca College >> ENGLISH >> 111 Fall, 2009 Description: Cuyamaca Community College ENGLISH 111R/INTERMEDIATE READING SKILLS Spring 2004 Section 0745 Mon Thurs. 10 11:50 Room O110 (This class is linked with Eng 111, Sec. 0759) Instructor: Jackie Hider Offic... Date Added: 2009-08-10 20:16:23 |
| Grades and Attendance Fall 2006 Eng 105 TD sample GAM.xls Path: Iowa State >> ENGL >> 510 Fall, 2008 Description: Information page Information Page for GAM project for ENG 510. Workbook templates for Grading and Attendance Management (GAM). Worksheets Information Page This page describes the worksheets and functions of this gradebook. Data entered for students... Date Added: 2009-08-10 20:16:36 |
| partb-coversheet.pdf Path: Allan Hancock College >> IMS >> 5047 Fall, 2009 Description: Background Reading IMS 5047 Week 7 Identification of Recordkeeping Requirements & Assessment of Existing Systems Attached is Part B of RFP No. 215/03 - REQUEST FOR PROPOSAL - Across Government Preferred Supplier Panel for the Provision of Documen... Date Added: 2009-08-10 20:17:20 |
| homework6-solutions.pdf Path: Washington >> PHYS >> 335 Fall, 2008 Description: ... Date Added: 2009-08-10 20:17:46 |
| Harmonics.xls Path: Duke >> ECE >> 4006 Fall, 2009 Description: phase mag t*f 1.27 sin(2*pi*t*f)3*f 0.01 0.06 0.02 0.13 0.03 0.19 0.04 0.25 0.05 0.31 0.06 0.37 0.07 0.43 0.08 0.48 0.09 0.54 0.1 0.59 0.11 0.64 0.12 0.68 0.13 0.73 0.14 0.77 0.15 0.81 0.16 0.84 0.17 0.88 0.18 0.9 0.19 0.93 0.2 0.95 0.21 0.97 0.22 0... Date Added: 2009-08-10 20:18:21 |
| hw7.pdf Path: Cincinnati >> ENFD >> 371 Fall, 2008 Description: ... Date Added: 2009-08-10 20:18:22 |
| 11-virtual.memory.pdf Path: Washington >> CS >> 451 Fall, 2009 Description: Reminder: Mechanics of address translation CSE 451: Operating Systems Winter 2007 Module 11 Virtual Memory, Page Faults, Demand Paging, and Page Replacement Ed Lazowska lazowska@cs.washington.edu Allen Center 570 virtual address virtual page # offs... Date Added: 2009-08-10 20:18:48 |
| section5.ppt Path: Washington >> CS >> 451 Fall, 2009 Description: Section 5 Synchronization primitives (Many slides taken from Winter 2006) 1 Announcements Assignment grades online Mailing list for TAs: Please check them and report bugs to TAs cse451tas@cs.washington.edu Faster response time Next one... Date Added: 2009-08-10 20:19:07 |
| section06.pdf Path: Washington >> CS >> 451 Fall, 2009 Description: CSE 451 Homework 3 May 7 2009 USEFUL/OBVIOUS TIPS Due Monday May 11th before class starts Read the write-up multiple times Read the GoPosts about the HW Post questions to the GoPost Write strong tests (at least 1/3 of points) Part 1 - Semapho... Date Added: 2009-08-10 20:19:27 |
| cse451-project1.doc Path: Washington >> CS >> 451 Fall, 2009 Description: CSE451 Winter 2009 Project #1 Out: January 7, 2009 Due: January 22, 2009 by 11:59PM (late assignments will lose grade point per day) Objectives The projects in this class involve building and modifying the Microsoft Windows Operating System. This is... Date Added: 2009-08-10 20:19:35 |
| 16-rpc.ppt Path: Washington >> CS >> 451 Fall, 2009 Description: CSE 451: Operating Systems Winter 2003 Lecture 16 RPC Hank Levy levy@cs.w ashington. edu 412 Sieg Hall What\'s Interesting about RPC? RPC = Remote Procedure Call the most common means for remote communication used both by operating systems and app... Date Added: 2009-08-10 20:20:34 |
| 5-threads.ppt Path: Washington >> CS >> 451 Fall, 2009 Description: CSE 451: Operating Systems Winter 2001 Lecture 5 Threads Hank Levy levy@cs.w ashington. edu 412 Sieg Hall Processes A process includes many things: an address space (all the code and data pages) protection boundary OS resources (e.g., open file... Date Added: 2009-08-10 20:20:35 |
| lec19.pdf Path: Washington >> CS >> 451 Fall, 2009 Description: May 7, 2001 Today\'s Topics Where the does the file system and disk driver fit in the scheme of things General features and semantics presented in a disk driver (next we\'ll cover file systems) Implementation details CSE451 File System Introductio... Date Added: 2009-08-10 20:20:41 |
| 000480_2.pdf Path: Pittsburgh >> AEI >> 4443 Fall, 2009 Description: COUNCIL OF THE EUROPEAN COMMUNITIES PRESS RELEASES PRESIDENCY: PORTUGAL JANUARY-JUNE 1992 Meetings and press releases 18 30 June 1992 Meeting number 1591st 1592nd 1593rd 1594th 1595th 1596th Subject Internal Market Transport Labour/Social Affairs Co... Date Added: 2009-08-10 20:21:08 |
| 1126_204.pdf Path: Pittsburgh >> AEI >> 6634 Fall, 2009 Description: CENTRE FOR EUROPEAN POLICY STUDIES CEPS WORKING DOCUMENT NO. 204 JUNE 2004 THEORISING EUROPEAN STRATEGIC CULTURE BETWEEN CONVERGENCE AND THE PERSISTENCE OF NATIONAL DIVERSITY CHRISTOPH O. MEYER CEPS Working Documents are published to give an indi... Date Added: 2009-08-10 20:21:09 |
| cipher2.txt Path: Allan Hancock College >> INFT >> 13332 Fall, 2009 Description: FVVQK GFE FQLFTE CWECEBKP IW GFSCWM F GFRPLFRK ZIWIVIQT, KYXKVB DIR F HRCKD VKRCIP CW BGK ZCP-1990E LGKW BGKT FQQILKP XQIWK-ZFOKRE BI XIZVKBK LCBG BGKZ, HKDIRK ENHEKJNKWBQT VNBBCWM BGKZ INB ID HNECWKEE. ZFXCWBIEG GFRPLFRK LFE, XIWEKJNKWBQT, KYVKWECS... Date Added: 2009-08-10 20:22:20 |
| 2part1.pdf Path: Penn >> EPI >> 521 Fall, 2009 Description: EP 521, Spring 2005. Vol II, Part 1 1 Statistical Methods in Epidemiologic Research EP 521 Spring 2005 Course Notes Vol II (Part 1 of 9) Multivariable Regression A. Russell Localio*, and Jesse A Berlin (\"The Great Master\") *Department of Biostatis... Date Added: 2009-08-10 20:23:47 |
| invasions_outline.pdf Path: Ball State >> PRODUCTION >> 0405 Fall, 2009 Description: EFT 2005 Teacher Workshop Outline 1) What are Biological Invasions? a. Ecosystems b. Communities c. Populations d. Niche Concept e. Diff between Range expansion and invasion 2) How and Why do Invasions Occur? a. Human vs. Natural Vectors i. Human 1. ... Date Added: 2009-08-10 20:24:23 |
| sh040906_tilt04.ps Path: Wisconsin >> SH >> 040906 Fall, 2009 Description: %!PS-Adobe-3.0 %Creator: MATLAB, The Mathworks, Inc. %Title: sh040906_tilt04.ps %CreationDate: 02/24/2007 00:52:06 %DocumentNeededFonts: Helvetica %DocumentProcessColors: Cyan Magenta Yellow Black %LanguageLevel: 2 %Pages: (atend) %BoundingBox: (aten... Date Added: 2009-08-10 20:24:43 |
| ch13.pdf Path: Radford >> CPSC >> 371 Fall, 2009 Description: Chapter 13: I/O Systems Chapter 13: I/O Systems I/O Hardware Application I/O Interface Kernel I/O Subsystem Transforming I/O Requests to Hardware Operations Streams Performance Operating System Concepts 13.2 Silberschatz, Galvin and Gagne 2005 O... Date Added: 2009-08-10 20:25:04 |
| pop_quiz_sol.pdf Path: Fayetteville State University >> MAC >> 2311 Fall, 2009 Description: 1 ... Date Added: 2009-08-10 20:25:38 |
| Supplement_Dekker_SWNT_SET_RT_Science_2001.pdf Path: UMass (Amherst) >> ECE >> 697 Fall, 2009 Description: Carbon Nanotube Single-Electron Transistors at Room Temperature Henk W. Ch. Postma, et al. Science 293, 76 (2001); DOI: 10.1126/science.1061797 The following resources related to this article are available online at www.sciencemag.org (this informati... Date Added: 2009-08-10 20:26:27 |
| References.docx Path: Uni. Westminster >> TAM >> 0726 Fall, 2009 Description: References Bermond, Bob, Moormann, Peter Paul, Albach, Francine, van Dijke, Annemieke (2008). Impact of severe childhood sexual abuse on the development of alexithymia, 77(4), 260-262 This research was conducted to investigate the impact of severe ch... Date Added: 2009-08-10 20:26:53 |
| ENGR450_EngEco_HKwon_Fall07.pdf Path: Andrew >> ENGR >> 450 Fall, 2009 Description: Andrews University College of Technology Engineering and Computer Science Department ENGR 450 Engineering Economy Syllabus -Fall 2007 Instructor: Hyun J. Kwon (hkwon@andrews.edu; HYH320C; x3890) Office hours: Tue, Thu (2:00-5:00 pm) or by appointmen... Date Added: 2009-08-10 20:27:17 |
| samplemidterm1.pdf Path: San Jose State >> EE >> 160 Fall, 2008 Description: EE160. Spring 2003. San Jose State University SAMPLE MIDTERM EXAM # 1 1. (40 points) A zero-mean white Gaussian noise process with power spectral density through an ideal lowpass filter of bandwidth B. (a) Find the autocorrelation function of the o... Date Added: 2009-08-10 20:29:58 |
| pj1.pdf Path: Oregon >> P >> 686 Fall, 2009 Description: Quantum Optics Project I Carey Phelps, Tim Sweeney, Jun Yin Department of Physics and Oregon Center for Optics 25 April 2007 1 Problem I The Bloch equations for the two-level atom were integrated using numerical methods. The following are the opti... Date Added: 2009-08-10 20:30:27 |
| Meiosis201.pdf Path: Whatcom Community College >> BIOLOGY >> 211 Fall, 2009 Description: Meiosis and Sexual Life Cycles - 1 The process of mitosis, just discussed, ensures that each cell of an organism has the same DNA as the original cell from which it originated (absent mutations). Transmitting chromosomes and genetic information from ... Date Added: 2009-08-10 20:32:29 |
| mt1-practice.pdf Path: SUNY Stony Brook >> MAT >> 118 Summer, 2008 Description: Practice Midterm 1 MAT 118 Feb 26, 2005 Name: (please print) ID #: Directions: There are 4 problems on 4 pages in this exam. Do all of your work in this exam booklet, and cross out any work that should be ignored. Show your reasoning and computatio... Date Added: 2009-08-10 20:32:57 |
| Dependence.pdf Path: Alaska Anch >> MATH >> 314 Fall, 2009 Description: Connecting Ideas Solutions to linear systems (Ax = b) show a relationship between vectors. Geometric concepts are a visualization of the same concept. This concept is one of the fundamentals of linear algebra. Systems and Vectors x1 1 0 1 A = ... Date Added: 2009-08-10 20:33:50 |
| part 2 question 1 2 complete.docx Path: East Los Angeles College >> CD >> 2037 Fall, 2009 Description: ButtonHyperlink buttonOpenstheproductScreen 2 Hyperlinkdown recordmade the2selected record Button Button boxOpen thetoscreen 3 record. Drop button Lists database. numbers. SavesHyperlinkto Screen Open Add Open buttonScreen 1 Button Deletes select... Date Added: 2009-08-10 20:33:53 |
| Expectations.doc Path: Pima CC >> JGILMARTIN >> 9172 Fall, 2009 Description: Welcome to East Asian Experience I & I I Mr. Gilmartin 2004-2005 The world today is closer to realizing a global community than ever before. Each passing day brings us revolutions in technology that bring the other side of the world closer to us than... Date Added: 2009-08-10 20:34:12 |
| 06-DAY16AM.pdf Path: Washington >> PDF >> 511 Fall, 2009 Description: DAY 16 AM: ORAL CAVITY and NASAL SINUSES OBJECTIVES 1. Describe the landmarks of the Naso, oro, and laryngopharynx. GA 943-45 2. Describe the structure and function of the Eustachian tube. (Lecture) 3. Describe the clinical tests for the ninth and te... Date Added: 2009-08-10 20:34:12 |
| q1_solutions.pdf Path: S. Connecticut >> MAT >> 122 Fall, 2008 Description: MAT 122, Summer 2009 Quiz 1: Sections 1.1-1.4 June 4 NAME: Instructions: You must show ALL work in order to receive full credit. Correct answers that appear to be obtained solely from your calculator will receive only partial credit. Make sure that y... Date Added: 2009-08-10 20:34:33 |
| 321hw8s09.pdf Path: UNC Wilmington >> MAT >> 321 Fall, 2009 Description: MAT 321-1 HOMEWORK ASG. #8 Hand in Tuesday, April 21 In Problems #1 - #6, show the steps necessary to solve the problems by hand. (You may use Maple for modular exponentiation where necessary, or to check your answers.) 1. 2. 3. 4. 5. 6. 7. Find ord5... Date Added: 2009-08-10 20:34:57 |
| lab_apache_winXP.txt Path: Parkland >> CSC >> 130 Fall, 2009 Description: Lab 10 Points Installing Apache Web Server on Windows XP Name:_ FQDN: _.csit.parkland.edu IP Address: 192.168.1._ - your machine number Subnet Mask: 255.255.255.0 DNS Server 192.168.1.155 1. Make sure you have an Administrator account under your ... Date Added: 2009-08-10 20:38:11 |
| ELCE_222_Circuits_I_Lab_09.pdf Path: WVU Tech >> EE >> 222 Fall, 2009 Description: Department of Electrical and Computer Engineering ELCE 222 Laboratory 9 Sinusoids and Phase Measurements Purpose and Objectives: To learn to use the oscilloscope to determine the amplitude of a sinusoid, the frequency of a sinusoid and the phase diff... Date Added: 2009-08-10 20:38:49 |
| python2.pdf Path: SD State >> CSC >> 422 Fall, 2009 Description: Ken Gamradt Spring 2009 Python Part 2 Climbing the GUI Learning Curve \"Hello World\" in four lines (or less) from Tkinter import Label widget = Label( None, text=\'Hello GUI World\' ) widget.pack() widget.mainloop() To run the above GUI program: [gate... Date Added: 2009-08-10 20:39:26 |
| csc317l3.pdf Path: SD State >> CSC >> 317 Fall, 2009 Description: Computer Organization & Architecture Lecture #3 Flip-Flops Edge-Triggered D Flip-Flop The D flip-flop has two inputs data input (D) clock input (Ck). A small arrowhead on the flip-flop symbol identifies the clock input. The flip-flop output changes... Date Added: 2009-08-10 20:39:27 |
| syllabus_se440_spring_2009.pdf Path: SD State >> SE >> 440 Fall, 2009 Description: SE440: Embedded Systems Spring 2009 Instructor: S. Lim (Ph.D., Assistant Professor) Office: 210 Harding Hall Phone: (605) 688 - 5279 Email: sunho.lim@sdstate.edu Course meetings: 4:00 PM - 5:15 PM (M/W), SNP Room 022 Tentative office hours: 2:... Date Added: 2009-08-10 20:40:42 |
| hw4.pdf Path: South Alabama >> CSC >> 333 Fall, 2008 Description: CSC 333 - Programming Language Theory Homework #4 (100pts) Due: Mar. 2, 2009 Requirement: Read the homework submission requirement on the syllabus before you submit your homework. The electronic submission site is ready, please submit your homework... Date Added: 2009-08-10 20:41:02 |
| 3ValAbstraction.2up.pdf Path: University of Toronto >> CSC >> 2108 Fall, 2009 Description: 3-Valued Abstraction and 3-Valued Model-Checking Abstraction Abstraction: an effective technique to combat state explosion problem approximate sets of concrete states by an abstract state approximate sets of concrete transitions by an abstract trans... Date Added: 2009-08-10 20:41:49 |
| a1.pdf Path: University of Toronto >> CSC >> 418 Fall, 2009 Description: CSC 418/2504 Computer Graphics,Winter 2007 Assignment 1 Part A Written: Due in class on Mon, Jan 29, 2007 [50 marks] Part B Programming: Due online by midnight Mon, Jan 29, 2007 [50 marks] Part A [50 marks in total] Below are 5 exercises for you to ... Date Added: 2009-08-10 20:41:58 |
| SWP3990.pdf Path: East Los Angeles College >> LIB >> 629 Fall, 2009 Description: INTEGRATING DEDUCTIVE AND INDUCTIVE APPROACHES IN A STUDY OF NEW VENTURES AND CUSTOMER PERCEIVED RISK Haider Ali, Cranfield University, Silsoe, Bedfordshire MK45 4DT and Sue Birley, The Management School, Imperial College of Science, Technology an... Date Added: 2009-08-10 20:43:16 |
| hw9sols.pdf Path: Kentucky >> MA >> 213 Fall, 2008 Description: } iy i | gx } v y i x | } } x | } ~ { { { c sd hm c d df d p dwd m ufhPidV`stjf rqHngnUHs3H iy | } } { i gx ~ y i | } x } ~ | } x ~ tc efhPxdV`H!tjftir sd hm c { { dsmHr ddeHvdxdHicetf6dssHU)irHm tf } } ... Date Added: 2009-08-10 20:43:39 |
| hw17.pdf Path: Kentucky >> MA >> 213 Fall, 2008 Description: g Bq h h dBBtqBt3wBBBaewijSqBjBjaWBq p h o lqeBts ew s yx i itw nx y i h i isw q i i y i u hi x n h nx y h s i ew i hws i s h yqs ew i q q s nw i g S{ewBp5pwtiepnwES`SptBBwdpiSqnVmSx pEtiddposwea h jS gwSBro... Date Added: 2009-08-10 20:43:41 |
| exam4solns.pdf Path: MO Southern >> MATH >> 020 Fall, 2009 Description: Test 4 Math 020 Instructor: Lathrom Spring 2006 Show work for full credit. Name: KEY Math020 (4pts) Problem 1. Find F when C = 10 given the formula 9 F = C + 32. 5 Solution. Substituting 10 for C gives us 9 F = C + 32 5 - - C=10 Test 4-Key F = ... Date Added: 2009-08-10 20:45:07 |
| 201-Part9.pdf Path: National Taiwan University >> CSE >> 201 Fall, 2009 Description: Java Classes Java programs are made up of classes So far, we have written only the \"main program\" class But we have used several other classes: Scanner String FileIOHelper Student CSE 201 Elementary Computer Programming 126 Two Kinds of Classes Cla... Date Added: 2009-08-10 20:45:15 |
| lec7.pdf Path: SUNY Stony Brook >> CSE >> 303 Fall, 2008 Description: ... Date Added: 2009-08-10 20:46:11 |
| exercise1a.pdf Path: University of Baltimore >> CMAT >> 455 Fall, 2009 Description: introduction to hypermedia > > Exercise 1a / Weblogs Pa rt 1 D U E DATE > I N T ROD U C TI O N > 09.23.2002 Weblogs, or \"blogs\", are regularly-updated sites that point to other sites and pages on the Web. Generally, the links are accompanied by th... Date Added: 2009-08-10 20:46:15 |
| StatementSyntaxArithmetic.ppt Path: National Taiwan University >> CSE >> 314 Fall, 2009 Description: THE COMPUTE STATEMENT Pur pose: performs mathematical calculations Syntax Defi ni ti on: COMPUTE {data-name [ROUNDED]}. = arithmetic-expression [ON SIZE ERROR stmt-group1] [NOT ON SIZE ERROR stmt-group2] [END-COMPUTE] Symbol Reminder: + - * / * also ... Date Added: 2009-08-10 20:46:33 |
| EE351X Homework III.pdf Path: Iowa State >> EE >> 351 Fall, 2009 Description: EE351X Homework III. Due 3/13/09 Page 1 of 1 1. How does a hybrid automobile get better mileage than a normal vehicle? List at least 2 reasons. 2. Will a normal car (i.e. not the ISU solar car) covered with solar cells be useful for normal driving? Y... Date Added: 2009-08-10 20:47:48 |
| vm1.pdf Path: Washington University in St. Louis >> CS >> 422 Fall, 2009 Description: Virtual Memory Overview Virtual Memory - Part 1 (CSE 422S) Real Memory: Main memory Virtual Memory: The memory perceived by the user or programmer Properties of Paging and Segmentation Implemented through paging and segmentation with page swapping ... Date Added: 2009-08-10 20:48:08 |
| ch1-old.pdf Path: Kent State >> CHAP >> 35101 Fall, 2009 Description: COMPUTER ARCHITECTURE CS 45101 CS 55101 CHAPTER 1 Computer Abstraction and Technology Department of Computer Science Kent State University Fall 2001 Computer Architecture Fall 2001 Contents Overview Instruction Set Architecture, ISA A Brief H... Date Added: 2009-08-10 20:48:25 |
| Lect4aS02.pdf Path: E. Kentucky >> CPE >> 221 Fall, 2009 Description: 1 ... Date Added: 2009-08-10 20:48:52 |
| swb_trig1.txt Path: Berkeley >> ASTRO >> 00261664 Fall, 2009 Description: # S/N T1 T2 T90 T50 # Estimated T100 Interval: -6.530 148.230 T90= 129.320 25.8 -3.350 102.650 92.220 48.760 ... Date Added: 2009-08-10 20:48:58 |
| PAE1935.t2k.o_sep-logo.pdf Path: UCSC >> PAE >> 1935 Fall, 2009 Description: PAE1935.t2k o_sep 7 6 5 4 3 2 1 M KY V G R P I P R FE D D VI L S GR A Q YV D DI V L P G M LY A G FV R S PY A H AR V L RV D L S D AA K Q K G V V A V F G PE E M G F A P GG K V R Y Q G EA V A M V V A GD R Y L L Y D AL 1 10 20 30 40 50 60 70 80 90 D 7 6... Date Added: 2009-08-10 20:49:23 |
| ECE5570F06_HW3p4soln.pdf Path: Utah >> ECE >> 5570 Fall, 2008 Description: CONCEPTUAL TOOLS By: Neil E. Cotter ECE 5570 F06 HW 3 prob 4 sol\'n EX: For small values of , the equations for a permanent magnet \"motor\" with only one coil are approximated by the equations listed below, (see [1] Chapter 1): di 1 R = v - i - ... Date Added: 2009-08-10 20:49:57 |
| lec22.pdf Path: Texas A&M >> ELEN >> 220 Fall, 2009 Description: Design Procedure Design with JK flip-flops JA = Bx KA = x\' JB = x KB = A\' + x\' = (Ax)\' y = AB < Circuit Diagram with JK F/F > Lecture 22 ELEN 220 1 Design Procedure Design with T flip-flops Flip-Flop Inputs TA TB < Characteristic table > T 0 1 Q(... Date Added: 2009-08-10 20:50:57 |
| Klose_SPIE_2003_delta.pdf Path: Columbia >> AK >> 2083 Fall, 2009 Description: yy e 4 eeeee4 pe2Bpp p42 eHhee p 4D492eep p)p ep pB ypx e p4 ppe~pp p2 pt B9 eee 2 pp9 1 pyhw 4 H9 ppy ~ 2Bp e e2e pe $ e eeye t pHpee92p eveey p~pD9 2 7 t 2 B Dppeev p & |e p e ep w| h 4 0 H 9 p... Date Added: 2009-08-10 20:51:07 |
| sample questionschapter14.doc Path: Penn State >> MRKT >> 472 Fall, 2009 Description: Page 1 1. Which of the following is NOT recognized as a phase of the interviewing process? a. validating the interview b. making the initial contact c. asking the questions d. recording the answers According to the text, interviewer cheating can be m... Date Added: 2009-08-10 20:51:16 |
| Ed_383_Assignment_3.pdf Path: Wisc Stevens Point >> EDUC >> 902 Fall, 2009 Description: Mehgan Musbach Education 383 Sultan Assignment 3: The questions in this assignment are based on the textbook, the lecture discussion and handouts on completion and selectedresponse tests. 1. Answer the following true or false question, and... Date Added: 2009-08-10 20:52:09 |
| syllabus.pdf Path: Castleton >> MET >> 1212 Fall, 2009 Description: Survey of Meteorology II Lab (MET 1212L) Spring 2005 Instructor Name: Werner Wintels Office: Vail 434 Office hours: TBA e-mail: werner.wintels@lyndonstate.edu Time and Classroom Labs: Vail 449 Th 9-11:00 AM Webpage http:/apollo.lsc.vsc.edu/~wintelsw/... Date Added: 2009-08-10 20:53:10 |
| GBRAAdditionToMOA.pdf Path: Texas A&M >> SEP >> 0607 Fall, 2009 Description: (b) development and implementation of strategies which balance the needs of the Edwards Species with preservation of permitted Edwards Aquifer water withdrawals; (c) review, development and implementation of aquifer management measures and conservati... Date Added: 2009-08-10 20:53:19 |
| Lect39.pdf Path: Wisconsin >> GEN >> 466 Fall, 2009 Description: Lecture 39 Genetic Drift The accumulation of random changes in gene frequency 1. New neutral variation is created by mutations that neither improve nor impair reproductive success (fitness). 2. A neutral variant can become fixed (freq.= 1.0) or los... Date Added: 2009-08-10 20:54:08 |
| hw7.pdf Path: FIU >> EML >> 4608 Fall, 2009 Description: ... Date Added: 2009-08-10 20:54:29 |
| asset1.rtf Path: San Diego State >> ARCHIVED >> 344 Fall, 2009 Description: Root Directory : washington.com Absolute path to images : HTTP:/WWW.RUSSPRIOR.COM/2006/SCHOOL_DEMOS/PHASE_2/IMAGES file name format dimensions file size top_bar gif 80051 ... Date Added: 2009-08-10 20:54:58 |
| Ge161-Syllabus2005.pdf Path: Caltech >> GE >> 161 Fall, 2008 Description: Ge161-2005 : Introduction Instructor Jean-Philippe Avouac TA: Nathan Downey Outline Over this class you will be exploring the earth dynamics based on a number of physiographic, geological and geophysical observations that you will be making yourself... Date Added: 2009-08-10 20:55:09 |
| solution.pdf Path: SUNY Buffalo >> PHY >> 509 Fall, 2009 Description: PHY509: FINAL SOLUTION P1. (a) The kinetic energy K = Vg = -mg (cos 1 + cos 2 ) becomes 1 1 2 2 2 2 L = m 2 (1 + 2 ) - mg (1 + 2 ) + mg 1 2 . 2 2 (b) The Euler-Lagrange equations of motion become g 1 + 1 - g 2 + 2 - g g 2 = 0 1 = 0. 1 2 2 2 2 m (1... Date Added: 2009-08-10 20:55:15 |
| qu-13aq.pdf Path: Wisconsin >> CHEM >> 343 Fall, 2008 Description: Name Chem 343 Quiz 13A May 1, 2009 4 1. Give all products of the following reactions including stereoisomers in 3-D. You may leave out enantiomers knowing that any chiral isomer formed from an achiral starting material will have one. Cl2 (a) (b) ... Date Added: 2009-08-10 20:55:16 |
| Project_2_Home_Energy_Audit.pdf Path: Oakland University >> ENV >> 312 Fall, 2008 Description: ENV 312 Energy & the Environment Fall 2007 Project #2 Home Energy Audit General Description Team up with a partner for this project. I will accept a third partner in a group if need be, but let\'s try to stay with two students per audit if possible.... Date Added: 2009-08-10 20:55:28 |
| ite240lab.txt Path: UMBC >> CMSC >> 491 Fall, 2009 Description: ITE 240 CS Lab This is a shared lab space with CMSC classes, CMSC 421 projects , and CMSC 491U/691U projects. This is the only lab on campus that provides VMware Workstation. The software is available only under Linux. Please let me know if the l... Date Added: 2009-08-10 20:56:15 |
| page122.pdf Path: Utah Valley State >> FACTBOOK >> 0203 Fall, 2009 Description: FINANCIAL AID ACTIVITY REPORT 2001-2002 GRANTS Federal Pell Federal SEOG State Supplement UCOPE LOANS Federal Perkins PLUS Stafford Unsubsidized Stafford EMPLOYMENT Federal Work -Study UCOPE Work-Study TOTAL NUMBER OF STUDENTS 6,147 1,084 675 45 A... Date Added: 2009-08-10 20:56:32 |
| ch05_note_zhang.ppt Path: George Mason >> ASTR >> 111 Fall, 2008 Description: The Nature of Light Chapter Five ASTR 111 003 Lecture 05 Oct. 01, 2007 Fall 2007 Introduction To Modern Astronomy I: Solar System Introducing Astronomy (chap. 1-6) Planets and Moons (chap. 7-15) Ch1: Astronomy and the Universe Ch2: Knowing the He... Date Added: 2009-08-10 20:57:01 |
| GIF_16116_Examen2_H05_solution.doc Path: NSULA >> GEL >> 16116 Fall, 2009 Description: GIF-16116, 27 avril 2005 VCH-3880, 13h30 15h20 Nom/Matricule : _Solution_ Examen 2 Cet examen vaut 40% de la note totale du cours. Les 17 questions seront corriges sur un total de 50 points. La valeur de chaque question est indique avec la questio... Date Added: 2009-08-10 20:57:55 |
| Graphing the Equation of a Circle.ppt Path: Long Island U. >> OC >> 0507 Fall, 2009 Description: Graphing the Equation of a Circle 219 Equation of a Circle A Quadratic Equation ax2 + by2 = c where a = b Examples: 2x2 + 2y2 = 18 3x2 + 3y2 = 150 If a b, then the graph would be an ellipse (oval shaped) To Graph the Equation of a Circle: 1.... Date Added: 2009-08-10 20:58:57 |
| hw5.pdf Path: Arizona >> HWR >> 431 Fall, 2008 Description: Hydrogeology - HWR/GEOS 431/531 Homework 5 Date: 10 November 2008 Due: 17 November 2008 Problem 25. Do problem 3 on p. 379 of Freeze and Cherry. Problem 26. Do problem 5 on p. 379 of Freeze and Cherry. Problem 27. Do problem 7 on p. 380 of Freeze an... Date Added: 2009-08-10 20:59:49 |
| 2009326_r01oc_0211212.pdf Path: Stanford >> TPI >> 1042 Fall, 2009 Description: UNITED STATES DISTRICT COURT SOUTHERN DISTRICT OF NEW YORK USDC SDNY DOCUMENT ELECTRONICALLY FILED iI \\11 DDACTE#F1LED: : RICHARD PESHKIN, on Behalf of Himself as an Individual, on Behalf of Spectrum Select L.P. as a Limited Partner, and on Behal... Date Added: 2009-08-10 21:00:10 |
| m150hc1su07.doc Path: New Mexico >> M >> 150 Fall, 2009 Description: Math 150 CNM Pre-Calculus Homework Assignments Chapter 1 Summer 2007 1.1 None 1.2 None 1.3 Functions 9, 13, 21, 23, 33, 37, 49, 51, 53, 57 1.4 Graphs of Functions 1, 3, 41, 43, 45, 49, 51, 57 1.5 Shifting, Reflecting, and Stretching Graphs 15,... Date Added: 2009-08-10 21:00:19 |
| Ethanol.pdf Path: Maryville MO >> CHEM >> 3330 Fall, 2009 Description: ... Date Added: 2009-08-10 21:00:44 |
| inventoryanalysis.pdf Path: ASU >> BAC >> 524 Fall, 2009 Description: ... Date Added: 2009-08-10 21:00:51 |
| Le_Soleil.pdf Path: Universität St. Gallen (HSG) >> PM >> 005 Fall, 2009 Description: ... Date Added: 2009-08-10 21:01:11 |
| UNCharter.doc Path: NYU >> RB >> 215 Fall, 2009 Description: Risa Barkan Prof. Ahmad Kamal New York University September 15, 2003 NYUUNRDBA#1 AMENDMENT PROCEDURE of the UN CHARTER The purpose of this paper is to examine the amendment procedure of the UN Charter and to discuss its implications of the democrati... Date Added: 2009-08-10 21:01:19 |
| cost.pdf Path: Virginia Tech >> USERS >> 3764 Fall, 2009 Description: ... Date Added: 2009-08-10 21:01:36 |
| figure-13.1.ps Path: Purdue >> IXP >> 1200 Fall, 2009 Description: %!PS-Adobe-1.0 %Creator: devps (Pipeline Associates, Inc.) %CreationDate: Sat Dec 14 15:14:23 2002 %Pages: (atend) %DocumentFonts: (atend) /X /exch load def /r /rmoveto load def /m /moveto load def /l /lineto load def /rl /rlineto load def /lc{yc X x... Date Added: 2009-08-10 21:01:53 |
| figure-13.4.ps Path: Purdue >> IXP >> 1200 Fall, 2009 Description: %!PS-Adobe-1.0 %Creator: devps (Pipeline Associates, Inc.) %CreationDate: Sat Dec 14 15:14:46 2002 %Pages: (atend) %DocumentFonts: (atend) /X /exch load def /r /rmoveto load def /m /moveto load def /l /lineto load def /rl /rlineto load def /lc{yc X x... Date Added: 2009-08-10 21:01:54 |
| 11-BinaryTrees.ppt Path: Arizona >> CS >> 227 Fall, 2008 Description: vti_encoding:SR|utf8-nl vti_timelastmodified:TR|07 Apr 2006 18:11:03 -0000 vti_title:SR|Computing Fundamentals with C+ vti_author:SR|mercer vti_syncwith_localhost\ \\:/r\\:TR|07 Apr 2006 18:11:03 -0000 vti_modifiedby:SR|mercer vti_timecreated:TR|20 May... Date Added: 2009-08-10 21:02:49 |
| F.doc Path: Duke >> CPS >> 149 Fall, 2009 Description: Southeastern European Regional Programming Contest acm Bucharest, Romania October 18, 2003 Problem F Common Subsequence Input File: F.IN Program Source File: F.PAS or F.C or F.CPP or F.JAVA A subsequence of a given sequence is the given sequence with... Date Added: 2009-08-10 21:03:09 |
| Finalb.doc Path: UNL >> MYWEB >> 116 Fall, 2009 Description: vti_encoding:SR|utf8-nl vti_timelastmodified:TR|13 Aug 2002 16:17:06 -0000 vti_extenderversion:SR|4.0.2.3406 vti_filesize:IR|68096 vti_title:SR|Name: _ vti_assignedto:SR| vti_approvallevel:SR| vti_backlinkinfo:VX| vti_cacheddtm:TX|13 Aug 2002 17:17:0... Date Added: 2009-08-10 21:04:02 |
| ye-kyaa-hua.ps Path: Acton School of Business >> RUF >> 102 Fall, 2009 Description: %!PS-Adobe-2.0 %Creator: dvips(k) 5.92b Copyright 2002 Radical Eye Software %Title: ye-kyaa-hua.dvi %Pages: 1 %PageOrder: Ascend %BoundingBox: 0 0 596 842 %DocumentFonts: CMR12 %EndComments %DVIPSWebPage: (www.radicaleye.com) %DVIPSCommandLine: dvips... Date Added: 2009-08-10 21:04:18 |
| Assignment3.doc Path: W. Kentucky >> INF >> 286 Fall, 2009 Description: INF 286011 Summer 2009 Assignment #3 In this assignment, we are going to start to work on the JavaJam Coffee Web Site Case Study described on pages 6063. Step 1 1. Create a folder on your Desktop named \"JavaJam\". 2. Double Click on heading.html to... Date Added: 2009-08-10 21:04:27 |
| Chapter12Presidency.pdf Path: Sauk Valley CC >> GOV >> 163 Fall, 2009 Description: Who Can Be President n Constitutional Requirements 35 years of age Native-born citizen n U.S. resident for 14 years n n n Intangibles Ability to win party nomination High office holder n Prominent family n n Presidency & the Constitution n Artic... Date Added: 2009-08-10 21:04:35 |
| HW1key04.doc Path: Central Washington University >> CHEM >> 345 Fall, 2009 Description: HW#1 KEY Steady State Box Model Problem: From the hint h2o= pollutant. Calculate h2o from Mh2o/Fh2o: h2o= (4x107 m3)/(8x104 m3/day)=5x102 days Since pollutant=5x102 days=Mpollutant/(0.16 tonnes/day) Mpollutant=80 tonnes Concentration=80 tonnes/(... Date Added: 2009-08-10 21:04:38 |
| week8.pdf Path: CSU San Marcos >> BSC >> 452 Fall, 2009 Description: Ingested Energy Feces Absorbed Energy Available Metabolic Energy Specific Dynamic Action Urine Maintenance Work Storage Heat Growth somatic Reproductive gonadal ... Date Added: 2009-08-10 21:05:27 |
| 141wir409a.pdf Path: Texas A&M >> TUESDAY >> 141 Fall, 2009 Description: c Kathryn Bollinger, February 20, 2009 1 Week-In-Review #4 (3.1, 3.2, 3.3) 1. Graph the following systems of inequalities and find all corner points. State whether the solution set is bounded or unbounded. (a) x - y 10 2x + 5y 20 x>4 y1 (b) -0.5... Date Added: 2009-08-10 21:05:34 |
| instructor_session1.pdf Path: Penn >> BPUB >> 250 Spring, 2007 Description: ... Date Added: 2009-08-10 21:05:59 |
| Whole Foods Health Care Expt1.pdf Path: Penn >> BPUB >> 250 Spring, 2007 Description: Whole Food Markets\' Consumer-Driven Health Plan Whole Foods Market\'s Consumer-Driven Health Plan A Speech by John Mackey Chairman and CEO Whole Foods Market Delivered October 2004 At the State Policy Network (SPN) 12th Annual Meeting For more inform... Date Added: 2009-08-10 21:06:02 |
| 06_12_08.pdf Path: Arizona >> SHEETS >> 0708 Fall, 2009 Description: MOLECULAR AND CELLULAR BIOLOGY (MCB) TIMESHEET DUE: 2:00 P.M. JUNE 12TH U U U SUBMIT TO: LIFE SCIENCES SOUTH BLDG RM 427 _ EMPLOYEE NAME (PLEASE PRINT) _ EMPLOYEE IDENTIFICATION NUMBER PAY PERIOD: 6/2/08 MONDAY U 6/02/08 U TO 6/6/08 FRIDAY ... Date Added: 2009-08-10 21:08:08 |
| caserubric.pdf Path: New Mexico >> SHS >> 310 Spring, 2008 Description: Grading Guide for SHS 310 Case Studies Excellent Sound knowledge of normal A P are mostly clear with few errors or occasional vagueness Clear understanding of how Few errors or vagueness in explaining eff... Date Added: 2009-08-10 21:09:05 |
| F02_HW_03_Sol.pdf Path: USC >> ENGR >> 402 Fall, 2009 Description: U niversity of S outhern C alifornia School Of Engineering Department Of Electrical Engineering EE 402: Homework Assignment #03 (Due 10/07/2002) Fall, 2002 Choma Problem #10: Fig. (P10a) depicts a simple single pole RC filter driven by a transconduc... Date Added: 2009-08-10 21:09:43 |
| ch2_problem19.pdf Path: Brookdale >> CHAPTER >> 241 Fall, 2009 Description: ENGI 241 Homework - Chapter 2 Problem 19 - 7th Edition Page 1 ENGI 241 Homework - Chapter 2 Problem 19 - 7th Edition Page 2 ENGI 241 Homework - Chapter 2 Problem 19 - 7th Edition Page 3 ENGI 241 Homework - Chapter 2 Problem 19 - 7th Edition PSp... Date Added: 2009-08-10 21:09:53 |
| lecture14.ps Path: Maryland >> CMSC >> 858 Spring, 2003 Description: %!PS-Adobe-2.0 %Creator: dvips(k) 5.86 Copyright 1999 Radical Eye Software %Title: lecture14.dvi %Pages: 6 %PageOrder: Ascend %BoundingBox: 0 0 612 792 %DocumentFonts: CMBX10 CMR10 CMR12 CMTI10 CMBX12 CMR8 CMR6 CMR9 CMMI10 %+ CMSY10 CMMI8 CMMI9 CMSY9... Date Added: 2009-08-10 21:11:59 |
| Oz Chapter 12.ppt Path: S.F. State >> ISYS >> 363 Fall, 2008 Description: Chapter 12: Systems Planning and Development Management Information Systems, Fifth Edition Objectives Explain the importance of and steps in IT planning Describe the systems development life cycle, which is the traditional approach to systems d... Date Added: 2009-08-10 21:12:41 |
| satan.pdf Path: UCCS >> CS >> 591 Fall, 2009 Description: Programming Satan\'s Computer Ross Anderson and Roger Needham Cambridge University Computer Laboratory Pembroke Street, Cambridge, England CB2 3QG Abstract. Cryptographic protocols are used in distributed systems to identify users and authenticate tr... Date Added: 2009-08-10 21:13:25 |
| chap013.doc Path: WVU >> ACCT >> 331 Fall, 2008 Description: Chapter 13 Relevant Costs for Decision Making Solutions to Questions 131 A relevant cost is a cost that differs in total between the alternatives in a decision. 132 An incremental cost (or revenue) is the change in cost (or revenue) that will resul... Date Added: 2009-08-10 21:15:35 |
| Actions.pdf Path: Carnegie Mellon >> CS >> 354 Fall, 2009 Description: 1 CDM Actions and Counting Klaus Sutner Carnegie Mellon University Fall 2008 Outline 2 Outline 1 Actions 2 Burnside\'s lemma 3 Some Applications 4 Plya-Redfield o Actions 3 Counting Problems Recall the Tic-Tac-Toe problem from last tim... Date Added: 2009-08-10 21:16:11 |
| lecture_11_arrays_slicing_ufuncs.pdf Path: Arizona >> MSE >> 350 Fall, 2008 Description: Multidimensional Arrays (cont\'d) Author: Date: R. G. Erdmann 9/17/2007 Note To resize the text while viewing these slides in Firefox, press the Ctrl - or Ctrl = key combinations. Read the Tutorial! http:/www.scipy.org/Tentative NumPy Tutorial In... Date Added: 2009-08-10 21:16:58 |
| ac_signals.pdf Path: N.E. Illinois >> PHYSICS >> 204 Fall, 2009 Description: Name: Date: Lab Partners: Pre-Lab Preparation: Alternating Currents and Voltages (due at the beginning of lab) Question 1 What is the meaning of DC? Of AC? Give examples of each in terms of an electrical signal. Question 2 If the unit for time is ... Date Added: 2009-08-10 21:17:16 |
| JDANCONO.I.doc Path: UNC >> READ >> 4892966 Fall, 2009 Description: ROWAN COUNTY HUMAN RESOURCES JOB DESCRIPTION Job Title : Animal Control Officer I Department: Health Revised : February 1999 Class : Protective Service FLSA : Nonexempt This job description supersedes any prior description for the Animal Control O... Date Added: 2009-08-10 21:17:34 |
| 1yzc0no96qg.pdf Path: Richmond >> X >> 10066341 Fall, 2009 Description: baseball team extends win streak to four out by tom scioscia freshman sam pogna by mike sampogna Som stott writer staff the this bali baseball team extended its bas ball ed tober came up for his first collegiate at bat with runners on second and t... Date Added: 2009-08-10 21:18:55 |
| 2m9qpwgxhb4.pdf Path: Richmond >> X >> 10066341 Fall, 2009 Description: 2 la brief illicy policy collegian briefs iolicy briefs must be turned in to the collegian office by friday lo 10 be printed in the next thursdays issue late briefs will not be accepted briefs will likely be edited for length 289 8835 please call 2... Date Added: 2009-08-10 21:19:00 |
| 5bf1okhpdwb.pdf Path: Richmond >> X >> 10066341 Fall, 2009 Description: tiie tlle about tile ettaswssbwitbimita J the better off we are ame awe am page adjudge ajudge reported As s todays front a doug honks hanks judge may soon ba settling the running even sinister but they our departments to be asked about polic... Date Added: 2009-08-10 21:19:27 |
| kemberexam2sample.pdf Path: Brookdale >> ENGM >> 2262 Fall, 2009 Description: ... Date Added: 2009-08-10 21:20:10 |
| joe7.pdf Path: Laurentian >> BIO >> 1020 Fall, 2009 Description: Outline of lecture 7 Macrophytic photoautotrophic Protista-the sea weeds (562-64) Sea weeds are complex organisms with tissue differentiation-holdfast, stipe and blade Morphological and life-cycle diversity of sea weeds. Phylum Phaeophyta (562-64) Ph... Date Added: 2009-08-10 21:20:34 |
| arf_pc.txt Path: Berkeley >> ASTRO >> 00291292 Fall, 2009 Description: ;instrument XRT ;exposure 121981.78 ;xunit kev ;bintype counts 0.0000000 0.0049999999 13.169859 1.00000 0.0049999999 0.0099999998 13.216708 1.00000 0.0099999998 0.015000000 13.263555 1.0... Date Added: 2009-08-10 21:20:40 |
| TuffCones.pdf Path: SUNY Buffalo >> GLY >> 433 Fall, 2009 Description: Tuff Rings and Tuff Cones Origin Associated with many types of eruptions a) Hawaiian b) Strombolian c) Surtseyan (tuff cones) d) Vulcanian Scoria Cone Ubehebe Crater Sugarloaf Mountain Thin-bedded strata Dry surge beds Relatively thin section... Date Added: 2009-08-10 21:21:58 |
| virtual field trip.doc Path: Penn State >> JMB >> 5025 Fall, 2009 Description: Virtual Field Trip Facilitative Guide Author: Jessica Barnett and Colleen McCracken Website URL: http:/pbskids.org/wayback/prez/index.html Recommended Grade Level: First and Second Grade Guided Tour: We decided to make this \"field trip\" a guided tour... Date Added: 2009-08-10 21:22:56 |
| lingm3.doc Path: Georgetown >> CS >> 393 Fall, 2009 Description: Michele Ling Connection between Mobile Phones and Cancer April 19, 2001 As the number of cellular phone users escalates at a phenomenal rate, there is also increased concern regarding the possibility that exposure to mobile phone radiation puts one a... Date Added: 2009-08-10 21:23:02 |
| Programming.ppt Path: SUNY Stony Brook >> ISE >> 208 Fall, 2009 Description: ISE 208 Intermediate Programming Software http:/data360.files.wordpress.com/2008/07/the-matrix-wwwdan-dareorg.jpg How do these magic machines work? Abstraction Abstraction Abstraction Abstraction http:/www.solarnavigator.net/computers.htm Wha... Date Added: 2009-08-10 21:23:10 |
| Apple.pdf Path: SUNY Plattsburgh >> MLAZZ >> 001 Fall, 2009 Description: Apple Inc.: Computers 1 Infinity Loop, Cupertino, California 95014 December 8, 2008 CMM 321A _ _ _ _ _ Jenna Murray Nicole Montague Will Lenihan Mark Clement Michael Lazzaro 1 Brand History In 1975 computer hobbyists Steve Wozniak and Steve Jobs d... Date Added: 2009-08-10 21:23:11 |
| 12MonthProfitandLossProjection.xls Path: CSU Fullerton >> TEC >> 702 Fall, 2009 Description: Twelve Month Profit and Loss Projection ABC Sales Limited Fiscal Year Begins June 1 IND .% Ju n-0 1 B/ A Jun-01 YE AR LY Au g-0 1 No v-0 1 Se p-0 1 1 Ma r-0 2 2 2 Ap r-0 2 Ju l- 0 1 1 Ma y-0 De c-0 Fe b-0 Ja n-0 Oc t-0 2 % % % % % % % % % ... Date Added: 2009-08-10 21:23:26 |
|
|
Get Started With Course Hero Today!
Get study guides, join study groups, and more!
Sign up in seconds with your Facebook account!
Course Hero is a Facebook Application Partner.
Click below to sign-up for FREE.
Our Social Learning Network was built to provide students and key learning partners like professors a platform to share, meet and collaborate while accelerating their comprehension of course-related theories and concepts. We are committed to providing you immediate access to a growing wealth of study materials and an unparalleled academic network of students, professors and other key partners. Why do you care? Because you want the best grade possible and at times need a 24/7 resource that’s responsive to your needs. |
|
What People Are Saying About Course Hero
|
|||
|
|||
|
Explore the benefits of joining Course Hero's social learning network.
|
|||
 |
Get millions of study materials now!Need lecture notes for a missed class or want insightful explanation of the theories and concepts you learn in class? Look no further, Course Hero’s Study Materials empowers you to find a broad and deep set of materials that can help you right now!
Click below to sign-up for FREE.
|
||
 |
Get over 200,000 textbook solutions now!Having difficulty with your homework and need documents that are relevant for your Textbook? Don't be frustrated. Course Hero's Textbook Help presents you study materials from many college courses.
Click below to sign-up for FREE.
|
||
 |
Meet over 300,000 students and your fellow classmates now!Want to meet your current classmates or those that took the class last year? Don’t worry or have anxiety. Course Hero’s Study Groups gives you the seamless opportunity to develop both anonymous or direct relationships with those classmates whom you want to meet and get help from right now!
Click below to sign-up for FREE.
|
||
