Course Solutions And Notes - T0407.t06.str4-logo 1c
| practicum_2005.doc Path: Washington >> FISH >> 547 Spring, 2008 Description: Stream & River Ecology FISH/ESC 547 Spring 2005 Lab Exam NAME: _ 3 Parts (100 pts total) PLEASE WRITE LEGIBLY! PART I. Slides (15 organisms 34 points) 1 (4 pts) Family (Scientific): Species (Scientific name): 2 (4 pts) Family (Scientific): Specie... Date Added: 2009-06-24 04:52:46 |
| midterm.ps Path: Nevada >> CS >> 791 Fall, 2009 Description: %!PS-Adobe-3.0 %Creator: groff version 1.09 %CreationDate: Fri Mar 15 16:05:12 2002 %DocumentNeededResources: font Times-Roman %+ font Times-Bold %+ font Times-Italic %DocumentSuppliedResources: file fig1.ps %+ procset grops 1.09 0 %Pages: 9 %PageOrd... Date Added: 2009-06-24 04:53:09 |
| assignment 3.pdf Path: Union College >> MER >> 312 Fall, 2009 Description: MER 312: Dynamics and Kinematics /AT Assignment # 3 Problem 1: Design a Grashof four-bar, crank-rocker, quick-return mechanism with the following requirements: The mechanism must have: 1) a time ratio of 1.35. 2) an output rocker angle of 50. while m... Date Added: 2009-06-24 04:53:26 |
| template.doc Path: Butler >> BLUE >> 301 Fall, 2009 Description: TITLE OF HANDOUT HERE HEADING? Text goes here. (This is Helvetica 13 point foint. Change the font size if you need to, but please try to use Helvetica whenever possible.) HEADING? Text goes here. *Created by Your Name(s), Fall of 2006 ... Date Added: 2009-06-24 04:54:04 |
| Bio1001Ch13W.ppt Path: N.E. Illinois >> BIO >> 1001 Fall, 2009 Description: From DNA to Proteins DNA makes _ makes _. 3\' 5\' growing RNA transcript Chapter 13 3\' 5\' direction of transcription Proteins are the links between _ and _. _ and _ are the two main processes linking gene to protein The bridge between DNA and _... Date Added: 2009-06-24 04:55:31 |
| HWProblemSet4.pdf Path: Syracuse >> PHY >> 211 Fall, 2008 Description: Physics 211 Due Friday, 02/14/03 Problem Set 4 Workshop Section:_ Name:_ Please submit your homework on this sheet. If you need more space than is available, please attach additional sheets of paper. 1. Answer question (not problem!) 10 in Chapter... Date Added: 2009-06-24 04:57:50 |
| midterm_v4_A.pdf Path: UC Davis >> ECON >> 135 Fall, 2009 Description: Test Form A Instructions: Enter your ID number, Test Form (listed on the top right of this page), Name, Subject (= ECN 135), and Date on your Scantron form. Choose the best answer among the possible answers given. You will have 80 minutes to com... Date Added: 2009-06-24 04:58:15 |
| koch and poggio 1999.pdf Path: Maple Springs >> COSC >> 6390 Fall, 2009 Description: 1999 Nature America Inc. http:/neurosci.nature.com news and views Predicting the visual world: silence is golden Christof Koch and Tomaso Poggio In predictive coding, only unexpected input features are signaled to the next stage of processing. Ra... Date Added: 2009-06-24 04:59:29 |
| Lab 9.doc Path: Mercer >> CSC >> 205 Fall, 2009 Description: CSC 205 Lab 9 Recursion Programming 2 6/15/2009 After completing this lab, you should be able to: Identify recursive methods, and understand the role and power of recursion Trace through recursive methods using execution frames that display all ... Date Added: 2009-06-24 05:00:27 |
| Encapsulation.ppt Path: Mercer >> CSC >> 204 Fall, 2009 Description: Information Hiding ... Date Added: 2009-06-24 05:00:36 |
| lecture36.ppt Path: Mercer >> CSC >> 205 Fall, 2009 Description: CSC 205 Java Programming II Lecture 36 April 19, 2002 Deletion Search will be used A separate deleteNode method will also be deletItem(rootNode, searchKey) called /Deletes from the bst with root rootNode the item /whose search key equals searchK... Date Added: 2009-06-24 05:01:05 |
| Lecture_8_fill_in.doc Path: Rio Hondo College >> PSYCH >> 210 Fall, 2009 Description: Genetics: the basics Genes: responsible for _ DNA: composed of _ Chromosomes: composed of _ 23 chromosome pairs 22 _ pairs 1 sex pair Genetics: The Basics Each chromosome contains a gene There are two pairs of each gene Typically one is _over the oth... Date Added: 2009-06-24 05:07:13 |
| 423p1310.xls Path: MSOE >> IE >> 423 Fall, 2009 Description: IE423 - Break Even Example - Blank & Tarquin, 5th Ed. Road Paving Alternative Analysis MARR = Life = Paved Road Cost: AW of Cost (20 yr. Life) Ann. Cost / mi. Miles of Road $900,000.00 $84,953.63 $200.00 7.0% 20 years Oil Coating Cost: Ann. Cost / mi... Date Added: 2009-06-24 05:07:25 |
| Balance of Payments Accounting.ppt Path: Oakland University >> FIN >> 475 Fall, 2009 Description: Balance of Payments Accounting The Balance of Payments Recall the open economy accounting identity: Income = Expenditures Y = C + I + G + NX Trade Deficits imply NX< 0 Therefore, Y (C + I + G) = NX < 0 Trade deficit countries are spending m... Date Added: 2009-06-24 05:08:08 |
| Homework-4.ps Path: New Mexico >> CS >> 341 Fall, 2009 Description: %!PS-Adobe-2.0 %Creator: dvips(k) 5.95a Copyright 2005 Radical Eye Software %Title: assignment.dvi %Pages: 4 %PageOrder: Ascend %BoundingBox: 0 0 612 792 %DocumentFonts: Times-Roman Times-Bold Times-Italic Courier MSAM10 %DocumentPaperSizes: Letter %... Date Added: 2009-06-24 05:09:39 |
| JWM66(4).pdf Path: Penn State >> MJF >> 283 Fall, 2009 Description: BISON AND ELK: BRUCELLOSIS SEROPREVALENCE ON A SHARED WINTER RANGE MATTHEW J. FERRARI, 1,2 Department of Ecology, Montana State University, Bozeman, MT 59717, USA ROBERT A. GARROTT, Department of Ecology, Montana State University, Bozeman, MT 59717, ... Date Added: 2009-06-24 05:10:04 |
| HW4.ps Path: Caltech >> EE >> 160 Winter, 2008 Description: %!PS-Adobe-2.0 %Creator: dvips(k) 5.86 Copyright 1999 Radical Eye Software %Title: C:\\Andre\\EE160HW4Soln.dvi %CreationDate: Wed Apr 19 12:42:10 2000 %Pages: 3 %PageOrder: Ascend %BoundingBox: 0 0 596 842 %EndComments %DVIPSWebPage: (www.radicaleye.co... Date Added: 2009-06-24 05:10:22 |
| smartcar06.doc Path: Bethel VA >> HCIA >> 402 Fall, 2009 Description: Smart Car Moscow, Russia Smart Car has decided to open several new branches of their European-based company. Although their product is not yet widely sold in Russia they are working hard to build a strong brand identity there. They have chosen downto... Date Added: 2009-06-24 05:11:06 |
| Reading Powerpoint.ppt Path: UVA >> EDLF >> 345 Fall, 2008 Description: The Literature of ROCK Bridging the gap between listening and reading Music as Literature? A song is a collection of words set to music. Although some may disagree, I see music as poetry conveyed through sound. Thus, music could be an aide to peopl... Date Added: 2009-06-24 05:11:35 |
| Lab3UseCases.doc Path: UMBC >> COMP >> 230 Fall, 2009 Description: vti_encoding:SR|utf8-nl vti_timelastmodified:TR|29 Oct 2007 01:19:31 -0000 vti_extenderversion:SR|6.0.2.5516 vti_backlinkinfo:VX| vti_author:SR|MARW\\weston vti_modifiedby:SR|HPTEST\\testhp vti_timecreated:TR|30 Oct 2006 18:13:57 -0000 vti_title:SR|{Us... Date Added: 2009-06-24 05:12:41 |
| notes.pdf Path: UT Arlington >> CSE >> 5317 Fall, 2008 Description: o o o w z z t 2222w2222w lvz vw z%2dvt2vz% d 2222w zzvw 9bz vw)S9w v v d d 2222w22 vwz) drz d d ... Date Added: 2009-06-24 05:14:19 |
| bengiowords.ps Path: Toledo >> CSC >> 2535 Fall, 2009 Description: %!PS-Adobe-2.0 %Creator: dvipsk 5.58f Copyright 1986, 1994 Radical Eye Software %Title: nips00_lm.dvi %Pages: 7 %PageOrder: Ascend %BoundingBox: 0 0 612 792 %DocumentFonts: Times-Bold Times-Roman Times-Italic Courier %DocumentPaperSizes: Letter %EndC... Date Added: 2009-06-24 05:15:31 |
| t2993s.pdf Path: RIT >> M >> 351 Fall, 2009 Description: ... Date Added: 2009-06-24 05:16:18 |
| Immunochemistry.ppt Path: NHMCCD >> BITC >> 1402 Fall, 2008 Description: Immunochemistry BITC1402 LoomisPrice Goal: A specific Assay Immunochemistry Human Immune System Active Immune System Response to exposure Antibody structure Antibody structure 2 Antibodyantigen binding AntigenBinding Site of AntiHIV Antib... Date Added: 2009-06-24 05:16:46 |
| Carbohydrates.ppt Path: NHMCCD >> CHEM >> 1419 Fall, 2008 Description: CARBOHYDRATES CHEM1419 LoomisPrice ALDOSES KETOSES http:/www.biochem.arizona.edu/classes/bioc462/462a/NOTES/CARBO/carb_structure.htm CYCLIZATION OF SUGARS glucose Glucose starch Glucose cellulose PROTEOGLYCAN PEPTIDOGLYCAN Pentapeptide... Date Added: 2009-06-24 05:16:59 |
| exam_answers_FINAL_Exam _ Key.pdf Path: Washington >> CHEM >> 162 Fall, 2008 Description: ... Date Added: 2009-06-24 05:17:12 |
| CorbaLally.pdf Path: Virginia Tech >> CS >> 6704 Fall, 2008 Description: A Warning If You Ask About COM vs CORBA, You WILL Receive A Beating. I only show the differences to get everyone to shut up. COM An C+ ABI For x86 A Desktop System Single Vendor* Single Platform* Extensive Library of Desktop Controls Well E... Date Added: 2009-06-24 05:19:37 |
| T0434.dssp-ehl2-logo.pdf Path: UCSC >> T >> 0434 Fall, 2009 Description: T0434 dssp-ehl2 2 1 M GS S H H H H H H SS G L VP R G SK M D ME D AD M T L W T EA E F EE K C TY I V ND H P WD S G A D GG T S V Q A E A S L P RN L L F K Y A TN S E E V I G VM S K E Y I P KG T R F G P L IG 1 10 20 30 40 50 60 70 80 90 H 2 1 E E E E... Date Added: 2009-06-24 05:20:02 |
| 10-Wild Cards.doc Path: Penn State >> NC >> 5014 Fall, 2009 Description: The Millennium Project Futures Research Methodology-V3.0 WILD CARDS by John L. Petersen and Karlheinz Steinmller with assistance from Hanna Adeyema I. History of the Method II. Description of the Method III. How to Do It IV. Strengths and Weakness... Date Added: 2009-06-24 05:21:00 |
| T0427.t2k.dssp-ehl2-logo.pdf Path: UCSC >> T >> 0427 Fall, 2009 Description: T0427.t2k DSSP-EHL2 2 1 1 10 20 30 40 E 2 1 T E T S E H H 2 1 T S H T E S T E 101 110 120 130 140 G H 2 1 T H H 151 160 170 180 190 T 2 1 S H T S H T T E 201 210 220 230 240 S 2 1 H T E 251 260 270... Date Added: 2009-06-24 05:22:01 |
| homework5.pdf Path: Ohio State >> LING >> 201 Spring, 2009 Description: Ling 201 Spring 2004 1 Homework #5 (due 05/10/2004) 1. In this exercise I want you to try to determine what various sounds of English have in common. For each of the following sets of sounds, figure out which is the misfit (i.e., which one does no... Date Added: 2009-06-24 05:22:42 |
| M.W.Track.Rosters.2005.doc Path: Wisc River Falls >> SPORTS >> 0405 Fall, 2009 Description: 2004-05 UW-River Falls Track & Field Rosters as of Dec. 28, 2004 Women Name Lisa Alland Amy Bengtson Vicki Cooper Jill Crandall Andrea Dudley Tiffany Gardner Jenny Koecher Amanda Kozicky Holly Kromray Molly Larson Hannah Miller Laura Murphy Katherine... Date Added: 2009-06-24 05:23:13 |
| wkst8.pdf Path: Kentucky >> AS >> 100 Fall, 2009 Description: | n e x p v p s p vt s v e x s ~ v x t t p ~ s qutq{dwdduIiwIWsWgdq n ~ x t v x s x s h x et v d t | v t s s t h nt zdtbbSwddIud{zquwtjWtjdqb9GCWzdtt{uiwqdwt h s ~t s h t v v t x p x v v v ~ }... Date Added: 2009-06-24 05:24:09 |
| T0508.t04.o_notor2-logo.pdf Path: UCSC >> T >> 0508 Fall, 2009 Description: T0508.t04 o_notor2 3 2 1 1 10 20 30 40 N 3 2 1 H N H N G N B P B N H 51 60 70 80 90 M H 3 2 1 N P N H N H N 101 110 120 130 140 M P 3 2 1 N H M H N B 151 160 170 180 N H M H N H B 190 KQ F QGDMT NDFIAIWRK... Date Added: 2009-06-24 05:24:33 |
| mttn8th.doc Path: CSB-SJU >> OR >> 355846 Fall, 2009 Description: Spanish Class Seora Rak Orqudea Rak Graduated from Universidad Tecnolgica in El Salvador and St. Josephs University with Master\'s Degrees in Languages and Education. Came to the US in 1996 Teaching at PV for 7 years Hold PA Certifications in ... Date Added: 2009-06-24 05:25:33 |
| hw2.pdf Path: UMass Lowell >> CS >> 404 Fall, 2009 Description: Analysis of Algorithms, 91.404 Homework Set #2 Due: Tuesday February 22,2005 * Work to be typed rather than handwritten and you should include your name on each sheet! 1. Solve the following recurrences using the Master Theorem: In each case show yo... Date Added: 2009-06-24 05:25:46 |
| erins_resume.doc Path: Penn State >> EMK >> 190 Fall, 2009 Description: ~ Erin M. Kennedy ~ 4701 College Drive Mailbox #851 ~ Erie, PA 16563 Home: 724-758-5433 Cell: 724-657-7824 emk190@psu.edu _ ~ PROFIL E ~ _ Energetic, dependable Student with academic experience in communications, public relations, and English. Curre... Date Added: 2009-06-24 05:25:48 |
| direct_indirect_cf.doc Path: WVU >> ARE >> 543 Fall, 2008 Description: Direct Method Cash Flow From Operating Activities Cash inflows received from customers Net sales Plus decreases in accounts Receivable Less increases in accounts Receivable _ Cash inflows from customers (-) Cash paid to suppliers COGS Less decreases ... Date Added: 2009-06-24 05:27:56 |
| sn74107.pdf Path: New Hampshire >> ECE >> 543 Fall, 2008 Description: SN54107, SN54LS107A, SN74107, SN74LS107A DUAL J-K FLIP-FLOPS WITH CLEAR SDLS036 DECEMBER 1983 REVISED MARCH 1988 PRODUCTION DATA information is current as of publication date. Products conform to specifications per the terms of Texas Instruments s... Date Added: 2009-06-24 05:28:13 |
| alg_specs_lec.txt Path: Scranton >> SE >> 507 Fall, 2009 Description: SE 507 Algebraic Specifications STILL UNDER CONSTRUCTION Last updated on Feb. 20, 2002 (10:30pm) The idea behind algebraic specifications is that an abstract data type can be described by giving (1) a \"signature\", which is a list of the names... Date Added: 2009-06-24 05:28:33 |
| satyaputraautobiography1.doc Path: Purdue >> ENGL >> 106 Fall, 2008 Description: Alfa Satyaputra Engl 106I Section 06/01 Assignment 2: Writer\'s Autobiography Draft 1 My memory of my writings is a complicated and twisted one, I must say. I\'ve went through a lot to made it to this point, and its quite a story on how I managed to ... Date Added: 2009-06-24 05:28:44 |
| js.pdf Path: Taylor IN >> COS >> 264 Fall, 2009 Description: Javascript intro Jonathan Geisler September 14, 2005 Jonathan Geisler Javascript intro What\'s in a name? Livescript (Netscape) Jonathan Geisler Javascript intro What\'s in a name? Livescript (Netscape) Javascript (Netscape & Sun partnership) ... Date Added: 2009-06-24 05:29:10 |
| jini-presentation.ppt Path: CSU Channel Islands >> CS >> 237 Fall, 2009 Description: Jini Architectural Overview Li Ping liping@uci.edu Goals Enabling users to share services and resources over a network Providing users easy access to resources anywhere on the network while allowing the network location of the user to change Simp... Date Added: 2009-06-24 05:29:48 |
| examinfo1002.pdf Path: Allan Hancock College >> MATH >> 1002 Fall, 2009 Description: THE UNIVERSITY OF SYDNEY Semester 1, 2009 Examination Information for MATH1002 Linear Algebra For general information about exams, go to the University\'s \"Examination Information\" page. http:/www.usyd.edu.au/studentcentre/exams/students.shtml The... Date Added: 2009-06-24 05:30:43 |
| Group Discussion Questions Microteaching.doc Path: San Diego State >> MATHED >> 502 Fall, 2009 Description: GROUP DISCUSSION QUESTIONS MICROTEACHING The microteacher will ask these questions and note (not word for word, just paraphrase) the answers that the group gives. The activity should take 20 minutes and this part no more than another 10 min. Then the... Date Added: 2009-06-24 05:32:25 |
| thermalwinter.doc Path: Montana >> BIOL >> 415 Spring, 2008 Description: Measuring Growth Rates Radiocarbon uptake The rate at which 14 C is incorporated into the collagenous structure of the scale is directly proportional to the amount of beta radiation emitted. Therefore a correlation curve can be formed to determine gr... Date Added: 2009-06-24 05:34:49 |
| 01EvoProks.ppt Path: Carnegie Mellon >> BIO >> 03240 Fall, 2009 Description: How did cellular life originate? Steps from molecules to prokaryotic cells small organic molecules polymers: evolve catalytic activities replication, templated: RNA: information, function, evolving molecule protein synthesis: by RNA, increases cataly... Date Added: 2009-06-24 05:36:18 |
| P5.pdf Path: RPI >> ECSE >> 6640 Spring, 2009 Description: PP04 ASSIGNMENT #P5 - Vectorization Due April 16, 2004 Please write a program to convert an image into a set of vectors.The images must be vectorized, NOT skeletonized: in other words, you should convert them into pairs of (x,y) coordinates as far fr... Date Added: 2009-06-24 05:37:01 |
| 091604.ppt Path: UNC >> COMP >> 120 Fall, 2008 Description: September 16 Assignment 4 due date pushed back to 23rd, better start anyway Questions? Test 1 review 9/16/2004 Comp 120 Fall 2004 1 Question 1 [10] Assume that multiply instructions take 12 cycles and account for 10% of the instructions in a t... Date Added: 2009-06-24 05:37:38 |
| ensemble.pdf Path: Northeastern >> CSG >> 220 Fall, 2009 Description: Ensemble Learning Ronald J. Williams CSG220, Spring 2007 Main General Idea Train several learners (called base learners) L1, L2, ., Lm to produce different hypotheses h1, h2, ., hm. Given a test input x, combine each of these hypotheses h1(x), h2(... Date Added: 2009-06-24 05:38:35 |
| mktg380_ f07_review sheet.doc Path: Winthrop >> FACULTY >> 380 Fall, 2009 Description: MKTG 380 Review Topics, Exam 3 The following chapters will be on the exam: 12, 13, 14, and 15. There are 35 multiple choice and two short answer questions on the exam. Like the previous exams, know all key terms in each chapter, as many of the questi... Date Added: 2009-06-24 05:38:55 |
| jayresume.doc Path: WVU >> EE >> 180 Fall, 2009 Description: JAY WILHELM OBJECTIVE To Complete the senior desing project correctly and using proper ethics. EXPERIENCE Summer 1999 United States Steel, Headquaters Technical Support Pittsburgh,PA Intern Prepared new PC\'s for use throughout the company Pr... Date Added: 2009-06-24 05:39:09 |
| topics.ps Path: CSU San Bernardino >> CS >> 546 Fall, 2009 Description: %!PS-Adobe-2.0 %Creator: dvips(k) 5.86 Copyright 1999 Radical Eye Software %Title: topics.dvi %Pages: 1 %PageOrder: Ascend %BoundingBox: 0 0 596 842 %EndComments %DVIPSWebPage: (www.radicaleye.com) %DVIPSCommandLine: dvips topics -o topics.ps %DVIPSP... Date Added: 2009-06-24 05:40:43 |
| Test 1.doc Path: Purdue >> CE >> 399 Spring, 2008 Description: Name_ Recitation number or meeting time_ CE399 Exam 1 January 29, 2007 1 Chapter 1, \"An Overview of Technical Writing\" (10 pts) 1. Your text states that writing at work creates liability for the writer and organization and that your signature on t... Date Added: 2009-06-24 05:41:24 |
| 23slides.pdf Path: Auburn >> FINC >> 3200 Fall, 2008 Description: L. Lee Colquitt Production (Sales) FINC 3200 Risk and Insurance Chapter 23 - Functions and Organization of Insurers The sales function, while quite significant to the insurer\'s success, is not unlike sales in other industries L. Lee Colquitt Depa... Date Added: 2009-06-24 05:42:04 |
| win00syl.pdf Path: Auburn >> FINC >> 3200 Fall, 2008 Description: Finance 320: Risk & Insurance Winter 2000 PROFESSOR: OFFICE: CLASS HOURS: OFFICE HOURS: OFFICE PHONE: EMAIL: WEB SITE: L. Lee Colquitt Room 313 - Lowder Business Building Mon and Wed 7:30 - 10:00 and Mon and Wed 12:30 - 3:00 Mon and Wed 3:00 - 5:00 o... Date Added: 2009-06-24 05:42:16 |
| IOE 481 Expectations of Participants.doc Path: Michigan >> IOE >> 481 Fall, 2008 Description: Structure and Expectations for IOE 481 Projects: Clients, Mentors, and Students Course: Industrial and Operations Engineering 481, Special Projects in Hospital Systems Key Information and Expectations: Client, Mentor, and Student Roles IOE 481: Pract... Date Added: 2009-06-24 05:42:30 |
| AdamsJ.rtf Path: Glendale Community College >> ENG >> 102 Fall, 2008 Description: Glendale Community College Main Campus ENGLISH 102 Summer 2009 Section 12235 MW 6-8:45 p.m. LA 105 Instructor: Jim Adams 480-731-8866x13541 Jadams@Student.gc.Maricopa.Edu Texts: Retellings: A Thematic Literature Anthology, Clarke, M.B., A.G. Clarke A... Date Added: 2009-06-24 05:44:45 |
| SchiedatM.rtf Path: Glendale Community College >> ENG >> 101 Fall, 2008 Description: English 101 Spring 2006 Section 1255, MWF 8:008:50 LA 104 Section 2163 MWF 11:00 HU105 Required Textbooks: Wyrick. Steps to Writing Well. Boston: Thomson/ Wadsworth, 2005 A hardbound (not pocket size) collegiate dictionary p... Date Added: 2009-06-24 05:44:56 |
| F0906.ps Path: Trinity U >> CS >> 2321 Fall, 2009 Description: %!PSAdobe3.0 %Title: (F.09.06) %Creator: (Adobe Illustrator\\252 5.5: PSPrinter 8.1.1) %CreationDate: (12:29 PM Saturday, October 18, 1997) %For: (Morgan Kaufmann Publishers) %Pages: 1 %DocumentFonts: FranklinGothicBook % %DocumentNeededFonts: Frank... Date Added: 2009-06-24 05:46:22 |
| F0533.ps Path: Trinity U >> CS >> 2321 Fall, 2009 Description: %!PSAdobe3.0 %Title: (F.05.33) %Creator: (Adobe Illustrator\\252 5.5: PSPrinter 8.1.1) %CreationDate: (11:16 AM Monday, September 29, 1997) %For: (Morgan Kaufmann Publishers) %Pages: 1 %DocumentFonts: FranklinGothicBook FranklinGothicDemi Helvetica... Date Added: 2009-06-24 05:46:40 |
| F0622.ps Path: Trinity U >> CS >> 2321 Fall, 2009 Description: %!PSAdobe3.0 %Title: (F.06.22) %Creator: (Adobe Illustrator\\252 5.5: PSPrinter 8.1.1) %CreationDate: (5:11 PM Wednesday, October 1, 1997) %For: (Morgan Kaufmann Publishers) %Pages: 1 %DocumentFonts: FranklinGothicBook FranklinGothicDemi %DocumentN... Date Added: 2009-06-24 05:46:52 |
| Introduction_and_Overview.ppt Path: Boise State >> NTCOMM >> 425 Fall, 2009 Description: Wireless Data Communication and Networking Introduction and Overview Know your units . . . 10x -18 -15 -12 -9 -6 -3 -2 -1 Abbrev. atto fempto pico nano micro milli centi deci Symb. a f p n m c d 10x 1 2 3 6 9 12 15 18 Abbrev. deca hecto kilo mega g... Date Added: 2009-06-24 05:48:04 |
| Welch-ClusterWorld-Grid-Security-April-04.ppt Path: Virginia Tech >> CS >> 6204 Spring, 2007 Description: Grid Security: What is it? Where is it going? Why? Von Welch vwelch@ncsa.uiuc.edu National Center for Supercomputing Applications Globus Alliance Outline q q q q q q Some quick terminology What is Grid Security? Current State of the Art OGSA Grid ... Date Added: 2009-06-24 05:48:36 |
| wirelesssecuritysurvey.pdf Path: Virginia Tech >> CS >> 6204 Spring, 2007 Description: UNCLASSIFIED Information Technology and Operations Center Department of Electrical Engineering and Computer Science United States Military Academy West Point, New York 10996 TECHNICAL REPORT ITOC-TR-2003-101 A Survey of 802.11a Wireless Security T... Date Added: 2009-06-24 05:48:45 |
| 1926_Part_1.pdf Path: Bucknell >> ISR >> 1926 Fall, 2009 Description: Copgrighred 1921 by The Williamsport Prinling d Binding Co. Compiled by The Junior Glctss of Bucknell University As Volume XXXIII of The College Annual The Staff of agenda 0f 1926 Editor-in-Chief LEONARD JAMESCOATES Business Manager JOHN PAU... Date Added: 2009-06-24 05:48:59 |
| 290outline2002.pdf Path: Virgin Islands >> CENG >> 290 Fall, 2009 Description: CENG 290 Digital Design I Course Outline April 2002 CENG 290 is the first course in digital design. The course has three 50 minute lectures sessions per week and eight 3 hour lab sessions during the term. Throughout the course, independent thinking... Date Added: 2009-06-24 05:49:14 |
| both.txt Path: Berkeley >> ASTRO >> 00350311 Fall, 2009 Description: 1.9600000 2.2600000 2570.9780 820.75301 2.2600000 2.9799999 2539.0670 607.05617 2.9800000 3.0400000 13741.768 3135.0512 3.0400000 3.0999999 20134.158 ... Date Added: 2009-06-24 05:50:08 |
| 312appendix8_1.doc Path: CSU LA >> UNIV >> 312 Fall, 2009 Description: Appendix 8.2. Positions of Risk Classifications recognized as \"Positions of Risk\" when an employee has responsibilities as set forth in section 5.5. of the Fingerprint Procedure, include but are not limited to the following: All Mana... Date Added: 2009-06-24 05:50:19 |
| dlec05.pdf Path: BU >> MA >> 572 Fall, 2009 Description: MA 572 Introduction to Mathematical Finance Lecture #5 Paolo Guasoni guasoni@bu.edu Boston University c 2004 by Paolo Guasoni p. 1/8 Mean-Variance Optimization We now return to the one-period model, and study the set oof mean-variance pairs (E, ... Date Added: 2009-06-24 05:50:41 |
| practicetest3.pdf Path: W. Alabama >> ECONOMICS >> 101 Fall, 2009 Description: Practice Questions For Test # 3 Economics 101_003 MULTIPLE CHOICE. Choose the one alternative that best completes the statement or answers the question. 1) uy has an income (Y) of $50 with which he can purchase records (R) at 1) _ G $10 ... Date Added: 2009-06-24 05:51:22 |
| 2006-November.txt Path: Portland >> PA >> 510 Winter, 2008 Description: From kristen.cross at gmail.com Wed Nov 1 02:09:19 2006 From: kristen.cross at gmail.com (Kristen Cross) Date: Wed Nov 1 02:09:23 2006 Subject: Worldbank recap Message-ID: <e2dbe1ef0611010209g3dd8d282hfe37500f316e651@mail.gmail.com> Hey everybody... Date Added: 2009-06-24 05:51:57 |
| GQ2_ansr.pdf Path: Carleton >> CHEM >> 234 Fall, 2009 Description: ... Date Added: 2009-06-24 05:52:13 |
| firsta.ps Path: SUNY Buffalo >> CS >> 114 Fall, 2009 Description: %!PS-Adobe-2.0 %Creator: dvipsk 5.58c Copyright 1986, 1994 Radical Eye Software %Title: first.dvi %Pages: 4 %PageOrder: Ascend %BoundingBox: 0 0 612 792 %EndComments %DVIPSCommandLine: dvips -o firsta.ps first.dvi %DVIPSParameters: dpi=600, compresse... Date Added: 2009-06-24 05:52:16 |
| corsten.pdf Path: Rose-Hulman >> JP >> 212 Fall, 2009 Description: ... Date Added: 2009-06-24 05:52:27 |
| TQM_Session10-ISO9000.ppt Path: NJIT >> IE >> 673 Fall, 2009 Description: Quality Management System ISO 9000 IE673 Session 10 - ISO 9000 1 What is ISO 9000? A series of standards that outline the requirements for a quality management system. IE673 Session 10 - ISO 9000 2 The ISO 9000 Series ISO 9000 - Quality Mana... Date Added: 2009-06-24 05:52:56 |
| d14-taylorSeries.pdf Path: Calvin >> M >> 162 Spring, 2007 Description: MATH 162: Calculus II Framework for Fri., Feb. 23 Taylor Series In the section on power series, we seemed to be interested in finding power series expressions for various functions f , but able to find such series only when the function f , or some... Date Added: 2009-06-24 05:53:01 |
| March15.doc Path: JMU >> ISAT >> 493 Fall, 2008 Description: Project Title: A Multimedia Tutorial About X-Linked Genetic Diseases Group Member: Jennifer Butt Project Advisor: Jeff Kushner External Sponsor: none Reader: Jeff Kushner Abstract (exactly 100 words): X-linked genetic diseases are relatively rare, bu... Date Added: 2009-06-24 05:53:19 |
| L21.pdf Path: USC >> CHEM >> 432 Fall, 2008 Description: L21 summary Ligand A binds to Macromolecule M Scatchard Plot NK N independent, identical binding sites [ A] K ( N ) [ A] Slope = - K N [A]: The unbound ligand concentration K: equilibrium constant for each binding site {# of bound ... Date Added: 2009-06-24 05:54:17 |
| TUTORIALS.xls Path: East Los Angeles College >> MAS >> 271 Fall, 2009 Description: Foundations of Probability Data Sheet Q1 Q2 Q3 Q4 F F F M M M M F M M M M M M F F M M M F M F F M M M F M M F F M M F M M M M F M M M F F F M M F M F M F M M * 68 69 74 75 64 74 62 65 74 69 70 66 72 73 69 67 68 74 63 73 74 73 67 69 70 71 71 65 66 63... Date Added: 2009-06-24 05:55:01 |
| proj2.pdf Path: East Los Angeles College >> MAS >> 131 Fall, 2009 Description: MAS131/231: Introduction to Statistics Project 2: Sampling Distribution of the Mean This project extends the simulation work on the Central Limit Theorem presented in H6, where we investigated the sampling distribution of n(Xn - ) Yn = where Xn ... Date Added: 2009-06-24 05:55:19 |
| summary07.pdf Path: Allan Hancock College >> COSC >> 3011 Fall, 2009 Description: COSC 3011/3911 Lecture 7 Hyperbolic PDEs: wave and advection equations advection with FTCS: unstable for all von Neumann analysis Lax method for advection stabilizes by adding diffusion CFL condition for stability diffusion dominates for small La... Date Added: 2009-06-24 05:56:30 |
| PreliminaryAnalysis_revised.doc Path: UMBC >> IFSM >> 436 Fall, 2009 Description: IFSM 436 Group No.3 Prepared for Dr. Norcio 10/08/2003 Description of the Current System ImmigrationPortal.com discussions forum is a free service that is being provided by the Law offices of Rajiv Khanna, PC. This web site is specifically develope... Date Added: 2009-06-24 05:56:38 |
| 2.7 Project 4.ppt Path: Seattle Pacific >> PP >> 3441 Fall, 2009 Description: MAT 3441 Axiomatic Geometry 2.7 Project 4 http:/myhome.spu.edu/lauw Lab Report After exam 1, read 7.1 (for next Friday) Quiz writer? When doing proof, AVOID. Exam The Definitions Constructions Proofs (discussed in class, HW) More? exa... Date Added: 2009-06-24 05:57:11 |
| Ch14Ex02Aliasing.pdf Path: E. Kentucky >> COMMON >> 360 Fall, 2009 Description: ... Date Added: 2009-06-24 05:57:27 |
| JapanEconomyUpdate.ppt Path: Charleston Law >> HOME >> 272 Fall, 2009 Description: Economic Update November 2000 Economics 285 Michael Smitka Annual Real Rates, Seasonally Adjusted 16.0% 15.0% 14.0% 13.0% 12.0% 11.0% 10.0% 9.0% 8.0% 7.0% 6.0% 5.0% 4.0% 3.0% 2.0% 1.0% 0.0% (1.0%) (2.0%) (3.0%) (4.0%) (5.0%) 1956 1958 1960 1962 1964... Date Added: 2009-06-24 05:57:49 |
| YMR244W.t2k.w0.5-logo.pdf Path: UCSC >> YMR >> 244 Fall, 2009 Description: YMR244W.t2k w0.5 4 3 2 1 I V L X S 10 20 30 40 E 4 3 2 1 L I F Y V D C T G T E S E T H T E XX XXXXXXX L P K G F GG D W Y L M F S V I G A A L XX XX Q D E G X X K XXX N G G W L F Y X A XX XXXXX XXXX L M S G T S A X S... Date Added: 2009-06-24 05:58:27 |
| YMR246W.t2k.dssp-ehl2-logo.pdf Path: UCSC >> YMR >> 246 Fall, 2009 Description: YMR246W.t2k DSSP-EHL2 2 1 E X X X CCCCE C 1 S 2 1 E 10 20 30 40 G H T H G H HCCCCCCCH HH C X X X X HHHH X X X X X X X X X H C CHHHHHHHXCCXXXCCCCCCXHHE C H H C H C X X X X X X X X X X X X X X X X X CCC CCCCCCC 51 60 70 80 90 H 2 1... Date Added: 2009-06-24 05:58:39 |
| Lab1F07.pdf Path: BYU >> ET >> 217 Fall, 2009 Description: CM 217 Lab #1- Discover Concrete! Name_ Section: 1 (T) 2 (Th) Due Date_ (Circle one) Your Assignment: There are 5 spots in particular for you to look at here on campus. They are listed below. Between each of the 5 locations, watch where you walk and... Date Added: 2009-06-24 06:00:11 |
| l7-handout.pdf Path: Stanford >> CS >> 243 Fall, 2009 Description: Lecture 7 Partial Redundancy Elimination I Forms of redundancy - global common subexpression elimination - loop invariant code motion - partial redundancy Algorithm Reading: Chapter 9.5 II Advanced Compilers M. Lam Overview Eliminates many form... Date Added: 2009-06-24 06:03:26 |
| cal.ps Path: BYU >> CS >> 452 Fall, 2008 Description: %!PS-Adobe-2.0 %Creator: dvips(k) 5.90a Copyright 2002 Radical Eye Software %Title: cal.dvi %CreationDate: Wed Jan 07 17:42:36 2009 %Pages: 1 %PageOrder: Ascend %BoundingBox: 0 0 596 842 %DocumentFonts: CMBX12 CMR12 %EndComments %DVIPSWebPage: (www.r... Date Added: 2009-06-24 06:04:11 |
| YOR226C.t2k.w0.5-logo.pdf Path: UCSC >> YOR >> 226 Fall, 2009 Description: YOR226C.t2k w0.5 3 2 1 D L L Y F L W I X X 1 10 20 30 40 H 3 2 1 G T H E H T S T G T T C L V N S L XXXXXXXXXX V A A P V E G G L I L I V DA H EV D L V V I W XXXXXXFXXXXXXXXXXXXXXXXXXXA X X M A I Y 51 60 70 80 90 E 3 2 1... Date Added: 2009-06-24 06:05:20 |
| forecastingsales.xls Path: Cal Poly Pomona >> HRT >> 395 Fall, 2009 Description: Forecasting Sales Monday 6-7 7-8 8-9 9 - 10 10 - 11 11 - 12 Total Ck avg Sales $0.00 0 number customers 12 - 1 1-2 2-3 3-4 4-5 5-6 Total Ck avg Sales $0.00 0 number customers 6-7 7-8 8-9 9 - 10 10 - 11 11 - 12 Total Ck avg Sales $0.00 0 Monday Total ... Date Added: 2009-06-24 06:06:37 |
| Final_Messengers_Third_Iteration_Requirements.doc Path: Columbia >> CS >> 4156 Fall, 2009 Description: A PatientCentered Asynchronous Messaging System Third Iteration Plan for Advanced Software Engineering W4156 by Team: Messengers Davis Bu db398@columbia.edu Maryam Kamvar mkamvar@cs.columbia.edu Larry McKnight mcknight@dmi.columbia.edu Pe... Date Added: 2009-06-24 06:07:56 |
| resume.doc Path: Penn State >> JMQ >> 5009 Fall, 2009 Description: E-mail jmq5009@psu.edu Jeff Quinn Objective Education To obtain a finance internship for the summer of 2007. 2006-present Pennsylvania State University Major: Finance, Minor: Economics Dean\'s List Fall 2006 3.67 GPA 2002-2006 Faculty Scholar Hig... Date Added: 2009-06-24 06:08:48 |
| lectures 10 11 and 12.ppt Path: Auburn >> UZB >> 411 Fall, 2009 Description: Space Environment Plasma Environment Introduction to Plasma Physics Introduction to Ionosphere Introduction to Ionospheric Plasmas Transparencies are NOT used for these topic October 3, 2003 Lecture-10, 11, and 12 H. Kirkici Istanbul Technical Uni... Date Added: 2009-06-24 06:11:40 |
| KatoK_IEEETransMicro47_7.pdf Path: Caltech >> EE >> 243 Fall, 2009 Description: IEEE TRANSACTIONS ON MICROWAVE THEORY AND TECHNIQUES, VOL. 47, NO. 7, JULY 1999 1265 Ultrawide-Band/High-Frequency Photodetectors Kazutoshi Kato, Member, IEEE (Invited Paper) Abstract- The two main trends in the progress of ultrawideband/high-freq... Date Added: 2009-06-24 06:11:51 |
| BIS-240R_Lab04.doc Path: DeVry Mesa >> BIS >> 240 Fall, 2009 Description: BIS240R Database Essentials for DecisionMaking 04BDP1 Summer Page 1 of 4 Course Code: BIS240R Course Title: Database Essentials for DecisionMaking Section: 04BDP1 Professor: J. Anagbogu Lab Assignment #: 4 Due Date... Date Added: 2009-06-24 06:12:17 |
| 100 PA-4.pdf Path: UMass (Amherst) >> PHILO >> 160 Fall, 2009 Description: Philosophy 100b Introduction to Philosophy Fall, 2007 Some Alleged Advantages of CD 1. 2. 3. 4. Allows for literal interpretation of mindful sentences. Allows for possibility of survival of (bodily) death. Allows for possibility of strong psychic phe... Date Added: 2009-06-24 06:12:50 |
| Lec12PRS.pdf Path: WVU >> MATH >> 121 Fall, 2008 Description: Section 5.3: The Rational Numbers Dr. Fred Butler Math 121 Fall 2004 Other Numbers on the Number Line The numbers that fall between the integers on the number line are either rational or irrational numbers. rational -1 -4 -3 -2 -1 0 irrational 2 1... Date Added: 2009-06-24 06:13:08 |
| thngs3knw.pdf Path: Ohio State >> MATH >> 131 Fall, 2008 Description: THINGS TO KNOW This list comes as a completion of the list I designed for the second midterm. Again, it\'s not exhaustive, and contains a bare minimum. Notations: x, y stand for variables and/or functions; f , g, h stand for functions; n stands for c... Date Added: 2009-06-24 06:15:33 |
| prob6.ps Path: Ill. Chicago >> M >> 503 Fall, 2009 Description: %!PS-Adobe-2.0 %Creator: dvips 5.76 Copyright 1997 Radical Eye Software (www.radicaleye.com) %Title: prob6.dvi %CreationDate: Thu Mar 5 08:08:03 1998 %Pages: 1 %PageOrder: Ascend %BoundingBox: 0 0 596 842 %EndComments %DVIPSCommandLine: dvips32.exe -... Date Added: 2009-06-24 06:16:35 |
| outline.pdf Path: University of Illinois, Urbana Champaign >> MATSE >> 584 Fall, 2009 Description: MatSE 584 Point and Line Defects in Materials Schedule: MW(F) 2:003:20, MSEB 305. See calendar for specific dates. Instructor: Dallas Trinkle (dtrinkle@uiuc.edu; 46519; 202A MSEB). Office hours: TR 10:0011:00am; appointments: R 11:00am12:00pm or by... Date Added: 2009-06-24 06:17:49 |
| Dreamweaver Tutorials.pdf Path: Linfield >> CSC >> 121 Fall, 2009 Description: Dreamweaver MX Tutorials TM macromedia Trademarks Afterburner, AppletAce, Attain, Attain Enterprise Learning System, Attain Essentials, Attain Objects for Dreamweaver, Authorware, Authorware Attain, Authorware Interactive Studio, Authorware Star... Date Added: 2009-06-24 06:19:35 |
| 5-Eukaryotes-1.pdf Path: San Diego State >> BIO >> 201 Fall, 2009 Description: 3 major groups (Domains) of life: Bacteria, Archaea, and Eukaryotes Eukarya - the Eukaryotes Bacteria Lack: nucleus, endopla... Date Added: 2009-06-24 06:20:33 |
| my cs resume.doc Path: MD University College >> CS >> 100 Fall, 2009 Description: Grant A. Sevek College Address: 1972 Clark Ave. Alliance OH 44601 Permanent address: 1568 North Ellsworth Ave Salem OH 4460 Email: gsevek10@hotmail.com Box # 1807 Email: sevekga@muc.edu OBJECTIVE Internship or summer job in the area of Business Adm... Date Added: 2009-06-24 06:22:10 |
| iguana_2.1.1.pdf Path: Allan Hancock College >> CS >> 9242 Fall, 2009 Description: Iguana Reference Manual Open Kernel Labs DRAFT Document Number: Software Version: Date: OK 40008:2007 (revision 4) 2.1.1 May 9, 2008 Copyright 20072008 Open Kernel Labs, Inc. This publication is distributed by Open Kernel Labs Pty Ltd, Australia... Date Added: 2009-06-24 06:22:18 |
| multilevelsyn.pdf Path: Arizona >> ECE >> 571 Fall, 2008 Description: ... Date Added: 2009-06-24 06:22:26 |
| hw6_p1.pdf Path: Arizona >> CE >> 210 Fall, 2009 Description: ... Date Added: 2009-06-24 06:22:52 |
| EE 505 Lab 3 Spring 2008.pdf Path: Iowa State >> EE >> 505 Fall, 2009 Description: EE 505 Experiment 3 Spring 2008 Statistical Analysis and Yield Prediction in Data Converters Statistical variations in process parameters play a key role in the parametric performance of data converters and correspondingly on the yield and correspond... Date Added: 2009-06-24 06:23:32 |
| section1.xls Path: UConn >> MATH >> 105 Fall, 2009 Description: Subject Number Section MATH 105Q 004 ID 1368221 Name Anderson,Jona than Henry Berg,Megan Lynne Credits 3 Level Sophomore Program ACES Phone JONATHAN.AND MATH 105Q 004 0896065 3 Sophomore ACES 603/43 MEGAN.BERG@ 2-0990 MATH 105Q 004 ... Date Added: 2009-06-24 06:24:04 |
| 201_syllabus_2009.doc Path: Washington >> POLS >> 201 Fall, 2009 Description: Political Science 201: INTRODUCTION TO POLITICAL THEORY Professor Jamie Mayerfeld Office: Gowen Hall 46 Office Hours: Mon. 2:00-3:30, Thur. 11:00-12:00 Spring 2009 Smith 120 MWF 10:30-11:20 TAs: Deepa Bhandaru, James Chamberlain, Talal Hattar, Kathe... Date Added: 2009-06-24 06:27:28 |
| dailyrounds.doc Path: Skidmore >> CL >> 311 Spring, 2009 Description: DAILY ROUNDS: PATRONS AND CLIENTS Pliny the Younger Letters 9.36 C. PLINIUS FUSCO SUO S. (1) Quaeris, quemadmodum in Tuscis diem aestate disponam. Evigilo cum libuit, plerumque circa horam primam, saepe ante, tardius raro. Clausae fenestrae manent; ... Date Added: 2009-06-24 06:28:01 |
| 40evaluationbysponsor.pdf Path: Wisconsin >> ENGR >> 398 Fall, 2009 Description: To: TCC Internship Sponsors EVALUATION Technical Communication Internship Student At the end of a project, the Sponsor should complete this form to evaluate the Internship Student and the completed work. It is often useful for Sponsor and Student ... Date Added: 2009-06-24 06:28:37 |
| 1470Ch5Template.pdf Path: Texas A&M University, Corpus Christi >> FACULTY >> 1470 Fall, 2009 Description: Names (up to three, legible roster names): MATH 1470 Tintera CH 5 Exercise Template 1. For this exercise, you don\'t need to show any calculations, just report what calculations you did and the results. Those results may include numbers (models, RMSR,... Date Added: 2009-06-24 06:29:23 |
| logicBases.pdf Path: CSU Northridge >> COMP >> 110 Fall, 2009 Description: Logical Bases: Representation of Numbers Decimal numbers most commonly used by humans are in base 10 and consist of the ten decimal digits 0, 1, 2, 3, 4, 5, 6, 7, 8, 9. For example, the decimal number 373 is 373 = 3*100 + 7*10 + 3 Positional notation... Date Added: 2009-06-24 06:29:43 |
| Chapter 10 - OO Analysis and Modeling.ppt Path: Illinois State >> ITK >> 432 Fall, 2008 Description: Chapter 10: Object-Oriented Analysis and Modeling Using the UML 1 Objectives Define object modeling and explain its benefits. Recognize and understand the basic concepts and constructs of object modeling. Define the UML and its various type... Date Added: 2009-06-24 06:31:36 |
| gandhi.pdf Path: UGA >> PHIL >> 1000 Fall, 2008 Description: Gandhi: Selected Political Writings Part I: Satyagraha: The Power of Nonviolence 1. How does Gandhi answer the Polish professor\'s question concerning human access to absolute truth and certainty? (30-31) Compare with Augustine and Socrates. [Note hi... Date Added: 2009-06-24 06:33:14 |
| S06_10.pdf Path: Wisconsin >> LING >> 365 Fall, 2009 Description: Sapir-Whorf Hypothesis Claim of S-W: We are linguistically conditioned into our thought world and into our behavior patterns People act in ways which are like the ways they talk about them. My conclusion: Some degree of correspondence between cul... Date Added: 2009-06-24 06:35:32 |
| PRB8.pdf Path: Acton School of Business >> PHYS >> 311 Fall, 2009 Description: Physics 311: Problem Set # 8 Due: Fri. 11/18/2005, in class 1 1. (20 Pt) Consider a particle with energy E coming from - and scattering over the -function potential barrier: V (x) = (x) where > 0. Find the probability of reflection and transmissio... Date Added: 2009-06-24 06:35:47 |
| C5S1F04.pdf Path: Illinois State >> CHE >> 232 Fall, 2008 Description: Chapter 5 Sheet 1 Chiral Carbons 1) Indicate all the chiral carbons in the structures shown below. Some structures may have no chiral centers! a) b) c) d) e) f) g) h) i) j) k) l) OH m) Br HO Cl ... Date Added: 2009-06-24 06:35:55 |
| C2A4F04.pdf Path: Illinois State >> CHE >> 230 Fall, 2008 Description: Chapter 2 Sheet 4 Alkane Nomenclature 1) Give the IUPAC name for the following molecules. a) b) c) 4-ethyl-3-methylheptane 2,3-dimethylbutane 2,2-dimethylpropane d) e) f) 2,2-dimethylbutane 2,2,4,4,6-pentamethylheptane 3-ethyl-6-(1,1-dimethy... Date Added: 2009-06-24 06:36:35 |
| xmlhtp1_14.ppt Path: E. Michigan >> IS >> 681 Fall, 2009 Description: Chapter 14 - XLink, XPointer, XInclude and XBase Outline 14.1 14.2 14.3 14.4 14.5 14.6 Introduction XML Linking Language (XLink) 14.2.1 Simple Links 14.2.2 Extended Links XLink and DTDs XML Pointer Language (XPointer) XML Inclusions (XInclude) XML Ba... Date Added: 2009-06-24 06:36:40 |
| 2007_03_02_Ch14No61.pdf Path: N. Illinois >> Z >> 167165 Fall, 2009 Description: ... Date Added: 2009-06-24 06:40:12 |
| Ch22.pdf Path: FIU >> MCB >> 4653 Fall, 2008 Description: 2/18/2009 Enteric Diseases Caused by Protozoa, Worms, Viruses Chapter 22 and more Worm Infestations Covered completely in ZOO 4234 General Parasitology 1990 - World as about 2 billion people infested with worms resulting in 80,000 deaths. Trichinos... Date Added: 2009-06-24 06:46:25 |
| In Class exercise on recycling.doc Path: New College FL >> BSC >> 4057 Fall, 2009 Description: In Class exercise on recycling Have each person in your group write down items that were purchased in the last week. Give as much detail about the material as possible. Make a list for the entire group of materials. Divide the materials into two cate... Date Added: 2009-06-24 06:49:06 |
| skeleton-written.ps Path: Allan Hancock College >> CS >> 1721 Fall, 2009 Description: %!PS-Adobe-2.0 %Creator: dvips(k) 5.92b Copyright 2002 Radical Eye Software %Title: sample-written.dvi %Pages: 20 %PageOrder: Ascend %BoundingBox: 0 0 596 842 %DocumentFonts: CMBX12 CMR12 CMR9 CMBX10 CMR10 CMTI10 CMSY10 CMBX7 %+ CMTT10 %DocumentPaper... Date Added: 2009-06-24 06:51:30 |
| PS6.pdf Path: City College SF >> CHEM >> 101 Fall, 2009 Description: CHEM 101A 1. PROBLEM SET #6 Due Thursday, March 26, 2009 Carry out the necessary calculations to fill in the items of the table given below. Kind of Radiation X-ray Microwave Infrared (IR) 1.54 x 106 Wavelength () (in meters) Frequency () (in Hert... Date Added: 2009-06-24 06:54:33 |
| trees-4.pdf Path: Allan Hancock College >> CS >> 1011 Fall, 2009 Description: An alternative tree structure: Each path in the tree represents a word Characters at the end of a word are marked How many children can a node have? \'e\' \'a\' \'r\' \'l\' \'t\' \'s\' \'y\' \'y\' \'e\' Such a data structure is called a Trie (retrieval) 1 A Has... Date Added: 2009-06-24 06:57:24 |
| 007a.pdf Path: Amarillo College >> ADOR >> 0304 Fall, 2009 Description: PROPERTY TAX DIVISION COST PER PARCEL 2003/2004 CAD SURVEY -TOTAL TOTAL 2003 FINAL 2003 COST PER 2003 COST AS 2004 COST PER CAD CAD NAME PARCELS TAX LEVY BUDGET EXPENSES PARCEL % OF LEVY BUDGET AMOUNT PARCEL (ITEM 6B) FOR 2003 (BDGT/LEVY*100) (ITEM 6... Date Added: 2009-06-24 06:59:55 |
| 017a.pdf Path: Amarillo College >> ADOR >> 0304 Fall, 2009 Description: APPRAISAL DISTRICT PERSONNEL AND SALARIES - 2003/2004 CAD SURVEY DISTRICT NUMBER 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 6... Date Added: 2009-06-24 06:59:58 |
| sampmid353.doc Path: S.F. State >> FIN >> 353 Fall, 2008 Description: San Francisco State University FIN 353.01 2004 Fall Midterm I Multiple Choices (Chose the one which is the most correct) Form A Name: _ 1. Asset transformation consists of: a. Altering the liquidity and maturity features of funds sources used to fi... Date Added: 2009-06-24 07:00:36 |
| gender.pdf Path: Cascadia Community College >> ANTH >> 206 Fall, 2009 Description: Tori M Saneda 2005-2008 Gender and culture \"The biological nature of men and women *should be seen+ not as a narrow enclosure limiting the human organism, but rather as a broad base upon which a variety of structures can be built\" ,Friedl 1975, p. ... Date Added: 2009-06-24 07:00:56 |
| ELC363-La4-Sp08_1.pdf Path: TCNJ >> ELC >> 363 Fall, 2008 Description: ELC 363 - LABORATORY #4 SIMPLE PROCESSOR In this laboratory, the students will obtain experience with the architecture of a simple processor, and will design the processor using the Xilinx design package for FPGAs and CPLDs. Consider a simple accumul... Date Added: 2009-06-24 07:01:06 |
| 215_Lecture7-Notes.pdf Path: National Taiwan University >> PHIL >> 215 Fall, 2009 Description: Lecture 7 Major Branches of Buddhism 1 Two Major Branches Southern Branch Southeast Asia Sri Lanka, Cambodia, Laos, Thailand, Burma Abhidharma Schools Theravada 2 Two Major Branches Northern Branch Central and East Asia Tibet, Mongolia, ... Date Added: 2009-06-24 07:01:53 |
| 04-CmpE202-due-dates-Spr08-update-01.doc Path: San Jose State >> CMPE >> 202 Spring, 2008 Description: CmpE 202 Software System Engineering Spring 2008 Due Dates Team Projects Your Contact Info Your Team Name & Contact Info Team Projects\' Reqs. Statements Starts at Due Date Sunday, February 03, 2008 Midnight Sunday, February 10, 2008 Midnight Sun... Date Added: 2009-06-24 07:05:42 |
| finstgd.pdf Path: N. Illinois >> BIOS >> 313 Fall, 2008 Description: Study Guide BIOS 313 Final December 11, 2001 12-2 pm The Comprehensive Final will be approximately 60% on material since last exam-starting with Microorganisms of the Environment-and 40% on rest of the course. If you have been doing well, then a read... Date Added: 2009-06-24 07:06:25 |
| MOLECBIO.pdf Path: N. Illinois >> BIOS >> 313 Fall, 2008 Description: MOLECULAR BIOLOGY/INFORMATIONAL MOLECULES Certain macromolecules carry and store information DNA deoxyribonucleic acid RNA ribonucleic acid Protein All carry info in the SEQUENCE of simple subunits 1st thought that protein must be the genes 20 amino ... Date Added: 2009-06-24 07:06:25 |
| Math100ReviewCh8.pdf Path: American River >> MATH >> 100 Fall, 2008 Description: Math 100: Practice Problems for Chapter 8 Exam 1. Simplify each expression as much as possible (a) (b) 32 + 50 + 125 ( 2 + 8) ( 2 2 (c) 5 + 3 (d) 2 3 ) (5 ! 3 ) 2 2 ( ) (3 2 ) 2 (e) 16 !1 / 2 + 25 !1 / 2 2. Rationalize each denominator: (a) ... Date Added: 2009-06-24 07:06:45 |
| 237outlines.doc Path: Ill. Chicago >> HIST >> 200 Fall, 2009 Description: 1Lecture 1: Introduction to the Course: Geography and background Lecture 2: The East Slavs, Kievan Russia, and the Mongol Yoke Lecture 3: From Early Muscovy to the Time of Troubles Lecture 4: Early Romanov Russia Lecture 5: Peter the Great: Russian W... Date Added: 2009-06-24 07:07:42 |
| ch19sc6skeleton.pdf Path: UPenn >> MATH >> 241 Fall, 2008 Description: Math 241 Rimmer 19.6 Evaluating Real integrals 2 F ( cos , sin ) d 0 Convert to a complex integral with contour C being the _. z= dz = d = cos = 1 i ( e + e-i ) 2 sin = 1 i ( e - e-i ) 2i cos = cos = 2 sin = sin = F ( cos ,sin ... Date Added: 2009-06-24 07:11:19 |
| 0913.pdf Path: Hudson VCC >> BCOR >> 101 Fall, 2009 Description: Lecture Outline 9/13 Finish talking about chromosome structure and packaging Linkage of genes on chromosomes Estimating recombination fraction Chi-square tests for independence What\'s wrong with this picture? A a Two-point mapping Predicting ... Date Added: 2009-06-24 07:19:37 |
| Concept Generation.ppt Path: RIT >> P >> 09712 Fall, 2009 Description: Evan DeCotis Levi Stuck Cinthia Sanchez Joe Fitzery Ryan Dennison Different from other projects Not a specific product, but an overall process Dynamic, constantly changing workplace Line personell and engineering team both have voices and ne... Date Added: 2009-06-24 07:20:09 |
| sy1101s00.pdf Path: Colorado >> SOCSCI >> 1101 Fall, 2008 Description: University of Colorado Department of Political Science The American Political System Political Science 1101 Spring 2000 http:/socsci.colorado.edu/~esadler/CourseWebsites.htm (you must download the syllabus from this site) Professor Scott Adler 131A K... Date Added: 2009-06-24 07:24:00 |
| REZ06012-LA.pdf Path: Cuyamaca College >> DOCS >> 080926 Fall, 2009 Description: ERIC GIBSON INTERIM DIRECTOR County of San Diego DEPARTMENT OF PLANNING AND LAND USE 5201 RUFFIN ROAD, SUITE B, SAN DIEGO, CALIFORNIA 92123-1666 INFORMATION (858) 694-2960 TOLL FREE (800) 411-0017 NOTICE OF INTENT TO ADOPT A NEGATIVE DECLARATION OR... Date Added: 2009-06-24 07:33:37 |
| Lab_10_pred_prey_2005.pdf Path: Oregon State >> FRWS >> 3810 Fall, 2009 Description: FRWS 3810: Plant and Animal Population Ecology Lab 10: Predator-Prey Dynamics- 4 April 2005 DUE: 11 April 2005 at the beginning of lab In this lab you will build a simple model of predator-prey dynamics and then modify it by including prey refuges (... Date Added: 2009-06-24 07:33:50 |
| Lecture_7_elasticity.pdf Path: Oregon State >> FRWS >> 3810 Fall, 2009 Description: Create a conceptual model Assume 3 stages for the toads A Toad Transition Matrix 0 0.02 0 Pre-juveniles Juveniles Adults (based on Biek et al. 2002) 18 0.2 0.01 1000 0 0.75 Sensitivity analysis Sensitivity: changes in popn growth rate with respe... Date Added: 2009-06-24 07:33:53 |
| exam3keyf02.pdf Path: Rutgers >> CHEM >> 161 Fall, 2009 Description: Chemistry 161 Solid Gems Exam III key Fall 02 Question 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 Version 1( White ) B C D D C B E E A A A D C D A B C A D A B B C D B A Version 2( Yellow ) B A C E D D B B D A C E C E C C A D... Date Added: 2009-06-24 07:34:42 |
| T0497.t06.pb-logo.pdf Path: UCSC >> T >> 0497 Fall, 2009 Description: T0497.t06 pb 4 3 2 1 10 20 30 40 D 4 3 2 1 F K M B D E H F K N O P A D E H J K H I A D F K 4 3 2 1 M B D D E H I A D D B F K M 101 110 120 130 G N O A D F K B D F K B D D E H J A F K M 140 NP Y VAAWY EGGKDDPKLALLRL... Date Added: 2009-06-24 07:36:11 |
| wilson.pdf Path: Delta MI >> ENG >> 111 Fall, 2009 Description: Deford, Susann - Staff <sldeford@delta.edu> From: Sent: To: Subject: Wilson, Ryan - Faculty <ryanwilson2@delta.edu> Tuesday, January 13, 2009 1:59 PM Deford, Susann - Staff <sldeford@delta.edu> RE: [ENGDIV-L] The Check List of Stuff I need image001.... Date Added: 2009-06-24 07:36:42 |
| G603_instructions.doc Path: S.F. State >> GEOG >> 603 Fall, 2009 Description: Instructions for using the Geographic Teaching Lab (HSS290) If you\'re reading these instructions you are currently enrolled in Geography 603 (Introduction to GIS) and you will be using the computers in HSS290. Please read the following instructions... Date Added: 2009-06-24 07:48:05 |
| Online Shopping Cart Project.ppt Path: YCP >> IFS >> 440 Fall, 2009 Description: Online Shopping Cart Project Group Members Barry Boltz PM David Ross Mark Yingling Stacey Enders Project Description Iron Wind Metals Small manufacturing company Produces pewter game miniatures Needs updated online shopping cart All custom... Date Added: 2009-06-24 07:50:34 |
| Biol260-SYLLABUS_s09.pdf Path: Canada College >> BIOL >> 260 Fall, 2009 Description: BIOL260: Human Physiology - Syllabus, Spring 2009 Professor: Dr. Nathan Staples Biology 260 HyE/HyA: Introduction to Human Physiology Biology 260 HyE HyA: Introduction to Human Physiology Syllabus: Lecture Caada Collllege, Spring 2009... Date Added: 2009-06-24 07:51:55 |
| LICENSE.txt Path: University of South Dakota >> MATH >> 475 Fall, 2009 Description: LICENSE AGREEMENT for CPLEX Student Edition for AMPL Software 1. The CPLEX Student Edition for AMPL Software (\"software\") is provided by ILOG, Inc. (\"ILOG\") and is subject to the following terms and conditions. By downloading, accessing or using th... Date Added: 2009-06-24 07:59:38 |
| Geologictime06.pdf Path: El Paso CC >> BIOL >> 102 Fall, 2009 Description: Geologic Time Organization of Time Periods Often Divided into Eons, Eras, Periods, Epochs I. Archean Eon and earlier Solar System 4.5 billion years ago (bya) Supernova explosion Sun forms Surrounding particles unite, gravity produces planets Remainin... Date Added: 2009-06-24 08:03:33 |
| computinggrade.pdf Path: CSU San Marcos >> ECON >> 201 Fall, 2009 Description: Explanation of final grade The final grade was computed based on a 1000 point scale as indicated in the course syllabus. The points were calculated as follows: Assignmnet points (20% of final grade) = Sum of highest 10 assignm ent scores x200 100 Mid... Date Added: 2009-06-24 08:04:47 |
| es21209_02_pdf.pdf Path: Colby >> ES >> 212 Fall, 2008 Description: Evaluation of the Conservation Lands of Maine Based on Presence of Habitat Suitable for Listed Species INTRODUCTION \"Conservation Lands\" refer broadly to both public and private lands that serve as areas devoted to the protection of wildlife. There a... Date Added: 2009-06-24 08:06:06 |
| Lecture8a.pdf Path: Alabama >> EC >> 570 Summer, 2008 Description: ... Date Added: 2009-06-24 08:06:52 |
| Num_IO.ppt Path: Mississippi State >> ECE >> 3724 Fall, 2009 Description: Binary Number Output To display a number in binary format, a program looks at each bit in the number and sends the ASCII equivalent of a `1\' (31h) or a `0\' (30h) to the screen using the DOS single character Int 21h function 2. The 8-bit value E6h (... Date Added: 2009-06-24 08:07:04 |
| strainplot.ps Path: Michigan >> PHYSICS >> 825 Spring, 2009 Description: %!PS-Adobe-2.0 %Title: ./s3/h1/825/strainplot.ps (Portrait A 4) %Pages: (atend) %Creator: HIGZ Version 1.27/03 %CreationDate: 2004/06/25 12.50 %EndComments %BeginProlog /s {stroke} def /l {lineto} def /m {moveto} def /t {translate} def /sw {stringwid... Date Added: 2009-06-24 08:07:20 |
| strainplot.ps Path: Michigan >> PHYSICS >> 750 Fall, 2008 Description: %!PS-Adobe-2.0 %Title: ./s3/h1/750/strainplot.ps (Portrait A 4) %Pages: (atend) %Creator: HIGZ Version 1.27/03 %CreationDate: 2004/06/25 12.50 %EndComments %BeginProlog /s {stroke} def /l {lineto} def /m {moveto} def /t {translate} def /sw {stringwid... Date Added: 2009-06-24 08:07:20 |
| MICE0059.pdf Path: Illinois Tech >> MICE >> 0059 Fall, 2009 Description: LBNL-52082 SCMAG-798 Comments on Liquid Hydrogen Absorbers for MICE Michael A. Green Lawrence Berkeley National Laboratory Introduction The Muon Ionization Cooling Experiment (MICE) consists of superconducting solenoid magnets, RF cavities, and abso... Date Added: 2009-06-24 08:08:00 |
| 120lecture4.pdf Path: Richland Community College >> PHIL >> 120 Fall, 2009 Description: Philosophy 120: Ethics Lecture Four: Normative Ethics 1 Lecture Four: Normative Ethics 1 Philosophy 120: Ethics Lecture Four: Normative Ethics 2 Normative ethics is the attempt to characterize and justify the correct moral theory. There are two... Date Added: 2009-06-24 08:16:51 |
| SPSS_Assignment_3.pdf Path: Wisc La Crosse >> MATH >> 145 Fall, 2009 Description: MTH 145 SPSS Assignment Instructions: You can work in pairs or group of 3 for this assignment. For each problem, use SPSS to do the calculations. Perform the instructions and answer the questions in the \"To be included in your work\" section. This is ... Date Added: 2009-06-24 08:21:36 |
| ma153quiz08.pdf Path: Purdue >> MATH >> 153 Fall, 2009 Description: Math 153 Name: Quiz # 8 At noon, water is poured into an empty vat which has a capacity of 12 liters. After 30 minutes, the vat is completely full and is allowed to slowly drain. By 4 pm, the vat is completely empty again. Let V (t) be the number o... Date Added: 2009-06-24 08:24:20 |
| OHCh11.pdf Path: National Taiwan University >> ECON >> 520 Fall, 2009 Description: Chapter 11: Economic Analysis of Banking Regulation 1 Asymmetric Information and Banking Regulation 1.1 Government Safety Net: Deposit Insurance and the FDIC The FDIC started operations in 1934 to provide deposit insurance. Before this, bank pan... Date Added: 2009-06-24 08:26:32 |
| observation11.pdf Path: Coastline Community College >> EDU >> 180 Fall, 2009 Description: OBSERVATION 11 IEP Conference for a Student with a Disability (14b) Your Name: Grade Level Observed: Date: If possible, attend a disabled student\'s Individual Education Plan (IEP) Conference where you can hear teachers, parents, and other school pro... Date Added: 2009-06-24 08:30:26 |
| q9sol.pdf Path: Texas A&M >> MATH >> 171 Fall, 2008 Description: ... Date Added: 2009-06-24 08:30:58 |
| Syllabus.pdf Path: Virginia Tech >> CS >> 3114 Fall, 2009 Description: CS2984: Data Structures and Algorithms Spring, 2009 Note: This course will eventually be renumbered CS3114 Class: Instructor: CRN 17401: TuTh 11:00-12:15am in GBJ 100 Dr. C.A. Shaffer, Torgerson 2000A, 540-231-4354 Office Hours: TuTh 2:003:00 E-Mail:... Date Added: 2009-06-24 08:31:08 |
| Math181-Quiz4key.pdf Path: Montana >> MATH >> 181 Fall, 2009 Description: September 28, 2007 Math 181 Quiz 4: Sections 2.5-2.7 Instructions: You are expected to show proper work to receive full credit. Name: Answer Key 1. Use the Intermediate Value Theorem to show that there is a root of the given equation in the specifi... Date Added: 2009-06-24 08:34:41 |
| conclu.pdf Path: Université du Québec à Montréal >> R >> 23351 Fall, 2009 Description: Conclusion gnrale Je suis depuis longtemps convaincu de la maxime voulant qu\'il en va des familles (qui, par exemple, consistent en un mari et une femme, 4 8 enfants, une femme de chambre, quelques servantes et hommes de main, un cocher, etc., de mm... Date Added: 2009-06-24 08:36:40 |
| HW4 Solutions.pdf Path: Berkeley >> ME >> 106 Fall, 2009 Description: ... Date Added: 2009-06-24 08:37:20 |
| q7_solution.pdf Path: Wilfrid Laurier >> CPSC >> 313 Fall, 2009 Description: CPSC 313 - Fall, 2003 Solutions for Selected Lab Exercises Question 7 on Lab Exercise #11 In this question you were asked to consider two similar languages, LQuestion and LKnown . Suppose that you know that LKnown is undecidable and you wish to show ... Date Added: 2009-06-24 08:44:09 |
| Ass3.pdf Path: National Taiwan University >> SOC >> 464 Fall, 2009 Description: Sociology 464 Assignment #3 Due Wednesday, May 18 Drawing from Iain Levison\'s Working Stiff\'s Manifesto, provide a 2 page write-up on marginal work. Systematically identify the key components that make particular kinds of work \"bad jobs.\" Use your t... Date Added: 2009-06-24 08:47:11 |
| LmLC- 11.txt Path: UCLA >> DNA >> 174 Fall, 2009 Description: >LmLC-\\11 MFRRLSPAAATRSMATMTHPLTSATQSQSVTSTRAAVSRVAMRGCSSSSGTSSGDVSSTKGAAFSVSRSG QRAPSINCVTLVGVVHDIQTGYVFEDAVTQFTLTTTSLDAANQAQECVVEKDHHTVRCYGDVFSREVRAK LSEGNVVCVNGRLRLNPQMEPSCNKYYYFPYIQVQPPHGQVSVVYGDRRSPPSPVNAATGELNNGNGDPT NSAAPAEDGDPSATTQKTP* ... Date Added: 2009-06-24 08:49:26 |
| 3b9b0bd1.pdf Path: Wisconsin >> WILL >> 0014 Fall, 2009 Description: ... Date Added: 2009-06-24 08:50:44 |
| 3b9b20f5.pdf Path: Wisconsin >> WILL >> 0031 Fall, 2009 Description: ... Date Added: 2009-06-24 08:51:47 |
| 3b9b211b.pdf Path: Wisconsin >> WILL >> 0031 Fall, 2009 Description: ... Date Added: 2009-06-24 08:52:44 |
| 3b9b0303.pdf Path: Wisconsin >> WILL >> 0025 Fall, 2009 Description: ... Date Added: 2009-06-24 08:54:24 |
| 4876e98b.pdf Path: Wisconsin >> WILL >> 0070 Fall, 2009 Description: ... Date Added: 2009-06-24 08:56:04 |
| 487709c2.pdf Path: Wisconsin >> WILL >> 0078 Fall, 2009 Description: ... Date Added: 2009-06-24 08:58:57 |
| 4877329d.pdf Path: Wisconsin >> WILL >> 0090 Fall, 2009 Description: ... Date Added: 2009-06-24 09:00:35 |
| 48778a0b.pdf Path: Wisconsin >> WILL >> 0115 Fall, 2009 Description: ... Date Added: 2009-06-24 09:05:17 |
| 48778a24.pdf Path: Wisconsin >> WILL >> 0115 Fall, 2009 Description: ... Date Added: 2009-06-24 09:05:34 |
| 3b9ace8d.pdf Path: Wisconsin >> WILL >> 0002 Fall, 2009 Description: ... Date Added: 2009-06-24 09:08:01 |
| 3b9b3f83.pdf Path: Wisconsin >> WILL >> 0039 Fall, 2009 Description: ... Date Added: 2009-06-24 09:09:59 |
| 100b.pdf Path: Wisconsin >> WILL >> 0055 Fall, 2009 Description: ... Date Added: 2009-06-24 09:10:27 |
| 1029.pdf Path: Wisconsin >> WILL >> 0055 Fall, 2009 Description: ... Date Added: 2009-06-24 09:10:45 |
| 48776a06.pdf Path: Wisconsin >> WILL >> 0106 Fall, 2009 Description: ... Date Added: 2009-06-24 09:11:48 |
| 48774ebf.pdf Path: Wisconsin >> WILL >> 0098 Fall, 2009 Description: ... Date Added: 2009-06-24 09:12:44 |
| 48774f50.pdf Path: Wisconsin >> WILL >> 0098 Fall, 2009 Description: ... Date Added: 2009-06-24 09:13:18 |
| 3b9b1e64.pdf Path: Wisconsin >> WILL >> 0015 Fall, 2009 Description: ... Date Added: 2009-06-24 09:15:23 |
| 3b9b61d1.pdf Path: Wisconsin >> WILL >> 0049 Fall, 2009 Description: ... Date Added: 2009-06-24 09:18:03 |
| 3b9b62c7.pdf Path: Wisconsin >> WILL >> 0049 Fall, 2009 Description: ... Date Added: 2009-06-24 09:18:18 |
| 3b9afaf3.pdf Path: Wisconsin >> WILL >> 0024 Fall, 2009 Description: ... Date Added: 2009-06-24 09:21:06 |
| 4876ec50.pdf Path: Wisconsin >> WILL >> 0071 Fall, 2009 Description: ... Date Added: 2009-06-24 09:22:53 |
| 4876ed5d.pdf Path: Wisconsin >> WILL >> 0071 Fall, 2009 Description: ... Date Added: 2009-06-24 09:23:25 |
| 4876ed14.pdf Path: Wisconsin >> WILL >> 0071 Fall, 2009 Description: ... Date Added: 2009-06-24 09:23:31 |
| 3b9aca1e.pdf Path: Wisconsin >> WILL >> 0001 Fall, 2009 Description: ... Date Added: 2009-06-24 09:23:36 |
| 3b9aca1a.pdf Path: Wisconsin >> WILL >> 0001 Fall, 2009 Description: ... Date Added: 2009-06-24 09:23:36 |
| 3b9acc07.pdf Path: Wisconsin >> WILL >> 0001 Fall, 2009 Description: ... Date Added: 2009-06-24 09:25:01 |
| 487736a5.pdf Path: Wisconsin >> WILL >> 0091 Fall, 2009 Description: ... Date Added: 2009-06-24 09:26:36 |
| 487737aa.pdf Path: Wisconsin >> WILL >> 0091 Fall, 2009 Description: ... Date Added: 2009-06-24 09:26:55 |
| 30be.pdf Path: Wisconsin >> WILL >> 0065 Fall, 2009 Description: ... Date Added: 2009-06-24 09:28:11 |
| 4877210c.pdf Path: Wisconsin >> WILL >> 0085 Fall, 2009 Description: ... Date Added: 2009-06-24 09:30:36 |
| 487784eb.pdf Path: Wisconsin >> WILL >> 0114 Fall, 2009 Description: ... Date Added: 2009-06-24 09:31:24 |
| 3b9ad8a2.pdf Path: Wisconsin >> WILL >> 0016 Fall, 2009 Description: ... Date Added: 2009-06-24 09:37:17 |
| 3b9ad895.pdf Path: Wisconsin >> WILL >> 0016 Fall, 2009 Description: ... Date Added: 2009-06-24 09:37:38 |
| 3b9b36e4.pdf Path: Wisconsin >> WILL >> 0037 Fall, 2009 Description: ... Date Added: 2009-06-24 09:39:12 |
| 11d3.pdf Path: Wisconsin >> WILL >> 0056 Fall, 2009 Description: ... Date Added: 2009-06-24 09:40:25 |
| 12d2.pdf Path: Wisconsin >> WILL >> 0056 Fall, 2009 Description: ... Date Added: 2009-06-24 09:40:44 |
| 13d9.pdf Path: Wisconsin >> WILL >> 0056 Fall, 2009 Description: ... Date Added: 2009-06-24 09:41:05 |
| 13e5.pdf Path: Wisconsin >> WILL >> 0056 Fall, 2009 Description: ... Date Added: 2009-06-24 09:41:07 |
| 122f.pdf Path: Wisconsin >> WILL >> 0056 Fall, 2009 Description: ... Date Added: 2009-06-24 09:41:39 |
| 126a.pdf Path: Wisconsin >> WILL >> 0056 Fall, 2009 Description: ... Date Added: 2009-06-24 09:41:43 |
| 3b9af2b1.pdf Path: Wisconsin >> WILL >> 0008 Fall, 2009 Description: ... Date Added: 2009-06-24 09:41:56 |
| 3b9af3a6.pdf Path: Wisconsin >> WILL >> 0008 Fall, 2009 Description: ... Date Added: 2009-06-24 09:42:05 |
| 3b9b0f32.pdf Path: Wisconsin >> WILL >> 0027 Fall, 2009 Description: ... Date Added: 2009-06-24 09:42:53 |
| 3b9b132c.pdf Path: Wisconsin >> WILL >> 0027 Fall, 2009 Description: ... Date Added: 2009-06-24 09:44:21 |
| 48778f79.pdf Path: Wisconsin >> WILL >> 0117 Fall, 2009 Description: ... Date Added: 2009-06-24 09:46:20 |
| 3b9b5d82.pdf Path: Wisconsin >> WILL >> 0048 Fall, 2009 Description: ... Date Added: 2009-06-24 09:46:55 |
| 3b9b5db0.pdf Path: Wisconsin >> WILL >> 0048 Fall, 2009 Description: ... Date Added: 2009-06-24 09:46:57 |
| 2d8b.pdf Path: Wisconsin >> WILL >> 0064 Fall, 2009 Description: ... Date Added: 2009-06-24 09:48:21 |
| 2ebf.pdf Path: Wisconsin >> WILL >> 0064 Fall, 2009 Description: ... Date Added: 2009-06-24 09:49:30 |
| 3b9b5a97.pdf Path: Wisconsin >> WILL >> 0047 Fall, 2009 Description: ... Date Added: 2009-06-24 09:51:48 |
| 48779b5b.pdf Path: Wisconsin >> WILL >> 0120 Fall, 2009 Description: ... Date Added: 2009-06-24 09:53:51 |
| 48779b47.pdf Path: Wisconsin >> WILL >> 0120 Fall, 2009 Description: ... Date Added: 2009-06-24 09:54:03 |
| 487703ab.pdf Path: Wisconsin >> WILL >> 0077 Fall, 2009 Description: ... Date Added: 2009-06-24 09:54:45 |
| 4877045d.pdf Path: Wisconsin >> WILL >> 0077 Fall, 2009 Description: ... Date Added: 2009-06-24 09:55:55 |
| 487763a6.pdf Path: Wisconsin >> WILL >> 0104 Fall, 2009 Description: ... Date Added: 2009-06-24 09:56:20 |
| 487764b8.pdf Path: Wisconsin >> WILL >> 0104 Fall, 2009 Description: ... Date Added: 2009-06-24 09:56:41 |
| 3b9aeea6.pdf Path: Wisconsin >> WILL >> 0007 Fall, 2009 Description: ... Date Added: 2009-06-24 09:57:23 |
| 3b9af2a2.pdf Path: Wisconsin >> WILL >> 0007 Fall, 2009 Description: ... Date Added: 2009-06-24 09:58:03 |
| 3b9b0e0c.pdf Path: Wisconsin >> WILL >> 0026 Fall, 2009 Description: ... Date Added: 2009-06-24 09:58:56 |
| 3b9b0781.pdf Path: Wisconsin >> WILL >> 0026 Fall, 2009 Description: ... Date Added: 2009-06-24 09:59:47 |
| 3b9b0791.pdf Path: Wisconsin >> WILL >> 0026 Fall, 2009 Description: ... Date Added: 2009-06-24 09:59:49 |
| 15dd.pdf Path: Wisconsin >> WILL >> 0057 Fall, 2009 Description: ... Date Added: 2009-06-24 10:00:16 |
| 17b2.pdf Path: Wisconsin >> WILL >> 0057 Fall, 2009 Description: ... Date Added: 2009-06-24 10:00:44 |
| 150f.pdf Path: Wisconsin >> WILL >> 0057 Fall, 2009 Description: ... Date Added: 2009-06-24 10:01:00 |
| 166e.pdf Path: Wisconsin >> WILL >> 0057 Fall, 2009 Description: ... Date Added: 2009-06-24 10:01:19 |
| 48777adf.pdf Path: Wisconsin >> WILL >> 0111 Fall, 2009 Description: ... Date Added: 2009-06-24 10:01:31 |
| 36d2.pdf Path: Wisconsin >> WILL >> 0067 Fall, 2009 Description: ... Date Added: 2009-06-24 10:03:13 |
| 36d7.pdf Path: Wisconsin >> WILL >> 0067 Fall, 2009 Description: ... Date Added: 2009-06-24 10:03:14 |
| 37d0.pdf Path: Wisconsin >> WILL >> 0067 Fall, 2009 Description: ... Date Added: 2009-06-24 10:03:33 |
| 38a6.pdf Path: Wisconsin >> WILL >> 0067 Fall, 2009 Description: ... Date Added: 2009-06-24 10:03:44 |
| 38b0.pdf Path: Wisconsin >> WILL >> 0067 Fall, 2009 Description: ... Date Added: 2009-06-24 10:03:46 |
| 39fa.pdf Path: Wisconsin >> WILL >> 0067 Fall, 2009 Description: ... Date Added: 2009-06-24 10:04:22 |
| 377e.pdf Path: Wisconsin >> WILL >> 0067 Fall, 2009 Description: ... Date Added: 2009-06-24 10:04:32 |
| 48771a9a.pdf Path: Wisconsin >> WILL >> 0083 Fall, 2009 Description: ... Date Added: 2009-06-24 10:04:59 |
| 48771b01.pdf Path: Wisconsin >> WILL >> 0083 Fall, 2009 Description: ... Date Added: 2009-06-24 10:05:41 |
| 48771b06.pdf Path: Wisconsin >> WILL >> 0083 Fall, 2009 Description: ... Date Added: 2009-06-24 10:05:41 |
| 48771b9e.pdf Path: Wisconsin >> WILL >> 0083 Fall, 2009 Description: ... Date Added: 2009-06-24 10:05:49 |
| 3b9ade3f.pdf Path: Wisconsin >> WILL >> 0017 Fall, 2009 Description: ... Date Added: 2009-06-24 10:06:36 |
| quiz_answers_quiz_4_CHEM530Aau05.pdf Path: Washington >> CHEM >> 530 Fall, 2008 Description: ... Date Added: 2009-06-24 10:07:53 |
| 3b9b2bf4.pdf Path: Wisconsin >> WILL >> 0034 Fall, 2009 Description: ... Date Added: 2009-06-24 10:08:12 |
| 3b9b2ca4.pdf Path: Wisconsin >> WILL >> 0034 Fall, 2009 Description: ... Date Added: 2009-06-24 10:08:47 |
| 3b9b2d26.pdf Path: Wisconsin >> WILL >> 0034 Fall, 2009 Description: ... Date Added: 2009-06-24 10:09:18 |
| 48773e0f.pdf Path: Wisconsin >> WILL >> 0093 Fall, 2009 Description: ... Date Added: 2009-06-24 10:10:18 |
| 48773e06.pdf Path: Wisconsin >> WILL >> 0093 Fall, 2009 Description: ... Date Added: 2009-06-24 10:10:19 |
| 48773e2c.pdf Path: Wisconsin >> WILL >> 0093 Fall, 2009 Description: ... Date Added: 2009-06-24 10:10:22 |
| 3b9ae3ad.pdf Path: Wisconsin >> WILL >> 0018 Fall, 2009 Description: ... Date Added: 2009-06-24 10:12:46 |
| 3b9b561a.pdf Path: Wisconsin >> WILL >> 0046 Fall, 2009 Description: ... Date Added: 2009-06-24 10:14:34 |
| 3b9b563c.pdf Path: Wisconsin >> WILL >> 0046 Fall, 2009 Description: ... Date Added: 2009-06-24 10:14:37 |
| 3b9b66d6.pdf Path: Wisconsin >> WILL >> 0050 Fall, 2009 Description: ... Date Added: 2009-06-24 10:15:51 |
| 4877a044.pdf Path: Wisconsin >> WILL >> 0121 Fall, 2009 Description: ... Date Added: 2009-06-24 10:17:33 |
| 48779db0.pdf Path: Wisconsin >> WILL >> 0121 Fall, 2009 Description: ... Date Added: 2009-06-24 10:18:09 |
| 4876f98d.pdf Path: Wisconsin >> WILL >> 0074 Fall, 2009 Description: ... Date Added: 2009-06-24 10:20:19 |
| 1b5d.pdf Path: Wisconsin >> WILL >> 0058 Fall, 2009 Description: ... Date Added: 2009-06-24 10:21:22 |
| 3b9aeac6.pdf Path: Wisconsin >> WILL >> 0006 Fall, 2009 Description: ... Date Added: 2009-06-24 10:23:14 |
| 3b9aeb41.pdf Path: Wisconsin >> WILL >> 0006 Fall, 2009 Description: ... Date Added: 2009-06-24 10:23:32 |
| 3b9aee02.pdf Path: Wisconsin >> WILL >> 0021 Fall, 2009 Description: ... Date Added: 2009-06-24 10:24:02 |
| 3b9aee2e.pdf Path: Wisconsin >> WILL >> 0021 Fall, 2009 Description: ... Date Added: 2009-06-24 10:24:06 |
| 3b9aee34.pdf Path: Wisconsin >> WILL >> 0021 Fall, 2009 Description: ... Date Added: 2009-06-24 10:24:16 |
| 3b9aeef1.pdf Path: Wisconsin >> WILL >> 0021 Fall, 2009 Description: ... Date Added: 2009-06-24 10:24:38 |
| 33db.pdf Path: Wisconsin >> WILL >> 0066 Fall, 2009 Description: ... Date Added: 2009-06-24 10:25:18 |
| 34cb.pdf Path: Wisconsin >> WILL >> 0066 Fall, 2009 Description: ... Date Added: 2009-06-24 10:25:32 |
| 487718e8.pdf Path: Wisconsin >> WILL >> 0082 Fall, 2009 Description: ... Date Added: 2009-06-24 10:27:23 |
| 4877175d.pdf Path: Wisconsin >> WILL >> 0082 Fall, 2009 Description: ... Date Added: 2009-06-24 10:27:44 |
| 487740a9.pdf Path: Wisconsin >> WILL >> 0094 Fall, 2009 Description: ... Date Added: 2009-06-24 10:28:12 |
| 487741b1.pdf Path: Wisconsin >> WILL >> 0094 Fall, 2009 Description: ... Date Added: 2009-06-24 10:28:31 |
| 4877423a.pdf Path: Wisconsin >> WILL >> 0094 Fall, 2009 Description: ... Date Added: 2009-06-24 10:29:38 |
| 3b9afbb6.pdf Path: Wisconsin >> WILL >> 0010 Fall, 2009 Description: ... Date Added: 2009-06-24 10:29:56 |
| 3b9afd95.pdf Path: Wisconsin >> WILL >> 0010 Fall, 2009 Description: ... Date Added: 2009-06-24 10:30:55 |
| 3b9afdad.pdf Path: Wisconsin >> WILL >> 0010 Fall, 2009 Description: ... Date Added: 2009-06-24 10:30:56 |
| 3b9b2fe7.pdf Path: Wisconsin >> WILL >> 0035 Fall, 2009 Description: ... Date Added: 2009-06-24 10:31:37 |
| 48775b57_x1a.pdf Path: Wisconsin >> WILL >> 0102 Fall, 2009 Description: ... Date Added: 2009-06-24 10:36:32 |
| 48775bd7.pdf Path: Wisconsin >> WILL >> 0102 Fall, 2009 Description: ... Date Added: 2009-06-24 10:37:14 |
| 3b9ae5a7.pdf Path: Wisconsin >> WILL >> 0019 Fall, 2009 Description: ... Date Added: 2009-06-24 10:37:39 |
| 3b9ae5f6.pdf Path: Wisconsin >> WILL >> 0019 Fall, 2009 Description: ... Date Added: 2009-06-24 10:37:53 |
| 3f5d.pdf Path: Wisconsin >> WILL >> 0069 Fall, 2009 Description: ... Date Added: 2009-06-24 10:40:29 |
| 3b9b6a14.pdf Path: Wisconsin >> WILL >> 0051 Fall, 2009 Description: ... Date Added: 2009-06-24 10:41:00 |
| 3b9b6ad7.pdf Path: Wisconsin >> WILL >> 0051 Fall, 2009 Description: ... Date Added: 2009-06-24 10:41:31 |
| 3b9b6b3c.pdf Path: Wisconsin >> WILL >> 0051 Fall, 2009 Description: ... Date Added: 2009-06-24 10:41:52 |
| 3b9b6b76.pdf Path: Wisconsin >> WILL >> 0051 Fall, 2009 Description: ... Date Added: 2009-06-24 10:42:11 |
| 3b9b6b94.pdf Path: Wisconsin >> WILL >> 0051 Fall, 2009 Description: ... Date Added: 2009-06-24 10:42:15 |
| 23d7.pdf Path: Wisconsin >> WILL >> 0061 Fall, 2009 Description: ... Date Added: 2009-06-24 10:42:46 |
| 256a.pdf Path: Wisconsin >> WILL >> 0061 Fall, 2009 Description: ... Date Added: 2009-06-24 10:43:56 |
| 1c2e.pdf Path: Wisconsin >> WILL >> 0059 Fall, 2009 Description: ... Date Added: 2009-06-24 10:44:23 |
| 1cfb.pdf Path: Wisconsin >> WILL >> 0059 Fall, 2009 Description: ... Date Added: 2009-06-24 10:45:09 |
| 1d8d.pdf Path: Wisconsin >> WILL >> 0059 Fall, 2009 Description: ... Date Added: 2009-06-24 10:45:26 |
| 1dc6.pdf Path: Wisconsin >> WILL >> 0059 Fall, 2009 Description: ... Date Added: 2009-06-24 10:45:53 |
| 3b9ad9f5.pdf Path: Wisconsin >> WILL >> 0005 Fall, 2009 Description: ... Date Added: 2009-06-24 10:46:14 |
| 3b9ada91.pdf Path: Wisconsin >> WILL >> 0005 Fall, 2009 Description: ... Date Added: 2009-06-24 10:46:34 |
| 3b9adcc9.pdf Path: Wisconsin >> WILL >> 0005 Fall, 2009 Description: ... Date Added: 2009-06-24 10:47:02 |
| 3b9ae7e0.pdf Path: Wisconsin >> WILL >> 0020 Fall, 2009 Description: ... Date Added: 2009-06-24 10:47:37 |
| 3b9ae8c3.pdf Path: Wisconsin >> WILL >> 0020 Fall, 2009 Description: ... Date Added: 2009-06-24 10:47:50 |
| 3b9ae824.pdf Path: Wisconsin >> WILL >> 0020 Fall, 2009 Description: ... Date Added: 2009-06-24 10:48:30 |
| 3b9b27f5.pdf Path: Wisconsin >> WILL >> 0032 Fall, 2009 Description: ... Date Added: 2009-06-24 10:49:51 |
| 3b9b262a.pdf Path: Wisconsin >> WILL >> 0032 Fall, 2009 Description: ... Date Added: 2009-06-24 10:50:06 |
| 3b9b52d9.pdf Path: Wisconsin >> WILL >> 0045 Fall, 2009 Description: ... Date Added: 2009-06-24 10:50:51 |
| 3b9b53bc.pdf Path: Wisconsin >> WILL >> 0045 Fall, 2009 Description: ... Date Added: 2009-06-24 10:51:04 |
| 3b9b53fd.pdf Path: Wisconsin >> WILL >> 0045 Fall, 2009 Description: ... Date Added: 2009-06-24 10:51:17 |
| 3b9b542b.pdf Path: Wisconsin >> WILL >> 0045 Fall, 2009 Description: ... Date Added: 2009-06-24 10:51:54 |
| 3b9b551e.pdf Path: Wisconsin >> WILL >> 0045 Fall, 2009 Description: ... Date Added: 2009-06-24 10:52:05 |
| 3b9b5327.pdf Path: Wisconsin >> WILL >> 0045 Fall, 2009 Description: ... Date Added: 2009-06-24 10:52:19 |
| 487798a2.pdf Path: Wisconsin >> WILL >> 0119 Fall, 2009 Description: ... Date Added: 2009-06-24 10:52:54 |
| 487746e1.pdf Path: Wisconsin >> WILL >> 0095 Fall, 2009 Description: ... Date Added: 2009-06-24 10:53:47 |
| 487747c3.pdf Path: Wisconsin >> WILL >> 0095 Fall, 2009 Description: ... Date Added: 2009-06-24 10:54:00 |
| 3b9aff2d.pdf Path: Wisconsin >> WILL >> 0011 Fall, 2009 Description: ... Date Added: 2009-06-24 10:55:16 |
| 487713af.pdf Path: Wisconsin >> WILL >> 0081 Fall, 2009 Description: ... Date Added: 2009-06-24 10:57:10 |
| 487713d3.pdf Path: Wisconsin >> WILL >> 0081 Fall, 2009 Description: ... Date Added: 2009-06-24 10:57:16 |
| 487715d9.pdf Path: Wisconsin >> WILL >> 0081 Fall, 2009 Description: ... Date Added: 2009-06-24 10:57:53 |
| 4877124c.pdf Path: Wisconsin >> WILL >> 0081 Fall, 2009 Description: ... Date Added: 2009-06-24 10:58:01 |
| 4877137b.pdf Path: Wisconsin >> WILL >> 0081 Fall, 2009 Description: ... Date Added: 2009-06-24 10:58:16 |
| 3b9b173f.pdf Path: Wisconsin >> WILL >> 0028 Fall, 2009 Description: ... Date Added: 2009-06-24 10:59:45 |
| 48772ede.pdf Path: Wisconsin >> WILL >> 0089 Fall, 2009 Description: ... Date Added: 2009-06-24 10:59:58 |
| 48772f10.pdf Path: Wisconsin >> WILL >> 0089 Fall, 2009 Description: ... Date Added: 2009-06-24 11:00:19 |
| 4876ef3e.pdf Path: Wisconsin >> WILL >> 0072 Fall, 2009 Description: ... Date Added: 2009-06-24 11:01:32 |
| 4876ef40.pdf Path: Wisconsin >> WILL >> 0072 Fall, 2009 Description: ... Date Added: 2009-06-24 11:01:40 |
| 4876f0b5.pdf Path: Wisconsin >> WILL >> 0072 Fall, 2009 Description: ... Date Added: 2009-06-24 11:02:13 |
| 48775efb.pdf Path: Wisconsin >> WILL >> 0103 Fall, 2009 Description: ... Date Added: 2009-06-24 11:03:55 |
| 3a5e.pdf Path: Wisconsin >> WILL >> 0068 Fall, 2009 Description: ... Date Added: 2009-06-24 11:04:16 |
| 3b43.pdf Path: Wisconsin >> WILL >> 0068 Fall, 2009 Description: ... Date Added: 2009-06-24 11:05:12 |
| 3b78.pdf Path: Wisconsin >> WILL >> 0068 Fall, 2009 Description: ... Date Added: 2009-06-24 11:05:23 |
| 3b92.pdf Path: Wisconsin >> WILL >> 0068 Fall, 2009 Description: ... Date Added: 2009-06-24 11:05:26 |
| 27d.pdf Path: Wisconsin >> WILL >> 0052 Fall, 2009 Description: ... Date Added: 2009-06-24 11:07:31 |
| 20e1.pdf Path: Wisconsin >> WILL >> 0060 Fall, 2009 Description: ... Date Added: 2009-06-24 11:08:24 |
| 320groupproject.pdf Path: Idaho >> AIST >> 320 Spring, 2008 Description: Celluloid Indian Group Project Film List Go to www.imdb.com for summaries and cast lists GROUPS ONE Early \"Indian\" Films The Massacre (1913) The Last of the Mohicans (1920) The Paleface (1922) Redskin (1929) TWO Early Animation/Cartoons \"Pioneer Da... Date Added: 2009-06-24 11:08:41 |
| 21e4.pdf Path: Wisconsin >> WILL >> 0060 Fall, 2009 Description: ... Date Added: 2009-06-24 11:08:48 |
| 487782aa.pdf Path: Wisconsin >> WILL >> 0113 Fall, 2009 Description: ... Date Added: 2009-06-24 11:09:52 |
| 4877813e.pdf Path: Wisconsin >> WILL >> 0113 Fall, 2009 Description: ... Date Added: 2009-06-24 11:10:46 |
| 4877819a.pdf Path: Wisconsin >> WILL >> 0113 Fall, 2009 Description: ... Date Added: 2009-06-24 11:10:53 |
| 4877832b.pdf Path: Wisconsin >> WILL >> 0113 Fall, 2009 Description: ... Date Added: 2009-06-24 11:11:12 |
| 3b9b4f2e.pdf Path: Wisconsin >> WILL >> 0044 Fall, 2009 Description: ... Date Added: 2009-06-24 11:13:31 |
| 3b9b4fb5.pdf Path: Wisconsin >> WILL >> 0044 Fall, 2009 Description: ... Date Added: 2009-06-24 11:14:02 |
| 3b9b51be.pdf Path: Wisconsin >> WILL >> 0044 Fall, 2009 Description: ... Date Added: 2009-06-24 11:14:41 |
| 3b9b02d2.pdf Path: Wisconsin >> WILL >> 0012 Fall, 2009 Description: ... Date Added: 2009-06-24 11:15:38 |
| 487777ae.pdf Path: Wisconsin >> WILL >> 0110 Fall, 2009 Description: ... Date Added: 2009-06-24 11:17:28 |
| 3b9ad5ca.pdf Path: Wisconsin >> WILL >> 0004 Fall, 2009 Description: ... Date Added: 2009-06-24 11:18:21 |
| 3b9ad7ac.pdf Path: Wisconsin >> WILL >> 0004 Fall, 2009 Description: ... Date Added: 2009-06-24 11:18:45 |
| 3b9ad8bc.pdf Path: Wisconsin >> WILL >> 0004 Fall, 2009 Description: ... Date Added: 2009-06-24 11:18:59 |
| 3b9ad676.pdf Path: Wisconsin >> WILL >> 0004 Fall, 2009 Description: ... Date Added: 2009-06-24 11:19:44 |
| 3b9ad742.pdf Path: Wisconsin >> WILL >> 0004 Fall, 2009 Description: ... Date Added: 2009-06-24 11:19:51 |
| 3b9af741.pdf Path: Wisconsin >> WILL >> 0023 Fall, 2009 Description: ... Date Added: 2009-06-24 11:21:19 |
| 48774a1b.pdf Path: Wisconsin >> WILL >> 0096 Fall, 2009 Description: ... Date Added: 2009-06-24 11:21:33 |
| 48774a5c.pdf Path: Wisconsin >> WILL >> 0096 Fall, 2009 Description: ... Date Added: 2009-06-24 11:21:39 |
| 48774a8c.pdf Path: Wisconsin >> WILL >> 0096 Fall, 2009 Description: ... Date Added: 2009-06-24 11:21:43 |
| 48774a8a.pdf Path: Wisconsin >> WILL >> 0096 Fall, 2009 Description: ... Date Added: 2009-06-24 11:21:43 |
| 48774a59.pdf Path: Wisconsin >> WILL >> 0096 Fall, 2009 Description: ... Date Added: 2009-06-24 11:21:55 |
| 487710df.pdf Path: Wisconsin >> WILL >> 0080 Fall, 2009 Description: ... Date Added: 2009-06-24 11:24:33 |
| 6ac.pdf Path: Wisconsin >> WILL >> 0053 Fall, 2009 Description: ... Date Added: 2009-06-24 11:25:15 |
| 7e0.pdf Path: Wisconsin >> WILL >> 0053 Fall, 2009 Description: ... Date Added: 2009-06-24 11:25:44 |
| 48772af4.pdf Path: Wisconsin >> WILL >> 0088 Fall, 2009 Description: ... Date Added: 2009-06-24 11:26:36 |
| 48772afb.pdf Path: Wisconsin >> WILL >> 0088 Fall, 2009 Description: ... Date Added: 2009-06-24 11:26:38 |
| 48772bfb.pdf Path: Wisconsin >> WILL >> 0088 Fall, 2009 Description: ... Date Added: 2009-06-24 11:27:27 |
| 4876f3b2.pdf Path: Wisconsin >> WILL >> 0073 Fall, 2009 Description: ... Date Added: 2009-06-24 11:28:13 |
| 4876f3b7.pdf Path: Wisconsin >> WILL >> 0073 Fall, 2009 Description: ... Date Added: 2009-06-24 11:28:14 |
| 4876f5b9.pdf Path: Wisconsin >> WILL >> 0073 Fall, 2009 Description: ... Date Added: 2009-06-24 11:28:55 |
| 3b9b4bfc.pdf Path: Wisconsin >> WILL >> 0043 Fall, 2009 Description: ... Date Added: 2009-06-24 11:30:32 |
| 3b9b4d4d.pdf Path: Wisconsin >> WILL >> 0043 Fall, 2009 Description: ... Date Added: 2009-06-24 11:31:30 |
| 2aeb.pdf Path: Wisconsin >> WILL >> 0063 Fall, 2009 Description: ... Date Added: 2009-06-24 11:32:05 |
| 2b5a.pdf Path: Wisconsin >> WILL >> 0063 Fall, 2009 Description: ... Date Added: 2009-06-24 11:32:18 |
| 2b66.pdf Path: Wisconsin >> WILL >> 0063 Fall, 2009 Description: ... Date Added: 2009-06-24 11:32:33 |
| 487756a0.pdf Path: Wisconsin >> WILL >> 0100 Fall, 2009 Description: ... Date Added: 2009-06-24 11:33:28 |
| 487756e8.pdf Path: Wisconsin >> WILL >> 0100 Fall, 2009 Description: ... Date Added: 2009-06-24 11:33:40 |
| 3b9b1d84.pdf Path: Wisconsin >> WILL >> 0030 Fall, 2009 Description: ... Date Added: 2009-06-24 11:34:11 |
| 3b9b1e9b.pdf Path: Wisconsin >> WILL >> 0030 Fall, 2009 Description: ... Date Added: 2009-06-24 11:34:28 |
| 3b9b1eb3.pdf Path: Wisconsin >> WILL >> 0030 Fall, 2009 Description: ... Date Added: 2009-06-24 11:34:46 |
| 3b9b1f3f.pdf Path: Wisconsin >> WILL >> 0030 Fall, 2009 Description: ... Date Added: 2009-06-24 11:34:58 |
| 3b9b203f.pdf Path: Wisconsin >> WILL >> 0030 Fall, 2009 Description: ... Date Added: 2009-06-24 11:35:31 |
| 48774b7a.pdf Path: Wisconsin >> WILL >> 0097 Fall, 2009 Description: ... Date Added: 2009-06-24 11:35:36 |
| 48774b7c.pdf Path: Wisconsin >> WILL >> 0097 Fall, 2009 Description: ... Date Added: 2009-06-24 11:35:36 |
| 48774baf.pdf Path: Wisconsin >> WILL >> 0097 Fall, 2009 Description: ... Date Added: 2009-06-24 11:35:55 |
| 48774cde.pdf Path: Wisconsin >> WILL >> 0097 Fall, 2009 Description: ... Date Added: 2009-06-24 11:36:59 |
| 3b9b0777.pdf Path: Wisconsin >> WILL >> 0013 Fall, 2009 Description: ... Date Added: 2009-06-24 11:39:06 |
| 3b9b3ac4.pdf Path: Wisconsin >> WILL >> 0038 Fall, 2009 Description: ... Date Added: 2009-06-24 11:39:37 |
| 48772a14.pdf Path: Wisconsin >> WILL >> 0087 Fall, 2009 Description: ... Date Added: 2009-06-24 11:41:25 |
| Syllabus.pdf Path: ASU >> FOUCH >> 419 Fall, 2009 Description: GLG419/598J: GEODYNAMICS LAST UPDATED 10/22/2004 FALL 2004 Professor Matt Fouch SYLLABUS Week 1 1 2 3 4 Date 08/24/2004 08/26/2004 08/31/2004 09/02/2004 09/07/2004 09/09/2004 09/14/2004 09/16/2004 09/21/2004 09/23/2004 09/28/2004 09/30/2004 10/05... Date Added: 2009-06-24 11:41:31 |
| 487728ae.pdf Path: Wisconsin >> WILL >> 0087 Fall, 2009 Description: ... Date Added: 2009-06-24 11:42:23 |
| 48777e59.pdf Path: Wisconsin >> WILL >> 0112 Fall, 2009 Description: ... Date Added: 2009-06-24 11:43:25 |
| 48777f83.pdf Path: Wisconsin >> WILL >> 0112 Fall, 2009 Description: ... Date Added: 2009-06-24 11:44:15 |
| 3b9ad2e9.pdf Path: Wisconsin >> WILL >> 0003 Fall, 2009 Description: ... Date Added: 2009-06-24 11:45:25 |
| 3b9ad10d.pdf Path: Wisconsin >> WILL >> 0003 Fall, 2009 Description: ... Date Added: 2009-06-24 11:45:47 |
| 3b9af3df.pdf Path: Wisconsin >> WILL >> 0022 Fall, 2009 Description: ... Date Added: 2009-06-24 11:46:40 |
| 3b9af48f.pdf Path: Wisconsin >> WILL >> 0022 Fall, 2009 Description: ... Date Added: 2009-06-24 11:47:32 |
| a60.pdf Path: Wisconsin >> WILL >> 0054 Fall, 2009 Description: ... Date Added: 2009-06-24 11:48:59 |
| a88.pdf Path: Wisconsin >> WILL >> 0054 Fall, 2009 Description: ... Date Added: 2009-06-24 11:49:03 |
| 3b9b4b35.pdf Path: Wisconsin >> WILL >> 0042 Fall, 2009 Description: ... Date Added: 2009-06-24 11:50:32 |
| Class3.pdf Path: Oregon >> MATH >> 315 Fall, 2008 Description: Class Notes #3 - Math 315. Limsups and Liminfs. Friday, January 27. Here we want to take an ever so slightly different look at the notions of limsup and liminf of a sequence and also look at several more examples. We think it can be helpful to use ... Date Added: 2009-06-24 11:51:39 |
| YHL050W-A.t2k.stride-ebghtl-logo.pdf Path: UCSC >> YHL >> 050 Fall, 2009 Description: YHL050W-A.t2k EBGHTL 3 2 1 CC 1 CH C TTHCHXHHXXXXXXXXHHHHTC H T X X X X T T X X X X X H C C C H HHHHHHH C T T T X X T H X X X C T T H X X X C T C X G H G G G H H T T H H T H E HHCXTTTE T T C H C C X X X X X X X X X X X X X X X X X H X ... Date Added: 2009-06-24 11:52:07 |
| YHL023C.t2k.dssp-ebghstl-logo.pdf Path: UCSC >> YHL >> 023 Fall, 2009 Description: YHL023C.t2k EBGHSTL 3 2 1 C X C S S H C E C C T T T T S S G E T G H S X XXTXXXXTTXXC X X X X CC T CTTC S S SCC CEE EE C 1 10 20 30 40 T 3 2 1 E S E T H TS G H TS C CSCSCTCTCCSHGGH SSSSS T C G T T C S G T T XXXXXHXXTHHXXXXX X X... Date Added: 2009-06-24 11:52:12 |
| YHL007C.t04.n_sep-logo.pdf Path: UCSC >> YHL >> 007 Fall, 2009 Description: 1 C D H G A G A G A A H X X X X X X X X X X X X X X XXXXXX D 51 60 70 80 90 DGD 7 6 5 4 3 2 1 DDD G P G C A H D GD DADAD AD AD AD A C A C X X XXXGCCGCG X X X X X X D 7 6 5 4 3 2 1 G H D ADADAD D D D D DX A XXXXXXXXXDCXD XD DCCCGC... Date Added: 2009-06-24 11:52:22 |
| PS 314 - Quiz6 - Sample Answers.pdf Path: Michigan >> PERSONAL >> 314 Fall, 2009 Description: Political Parties 314: Quiz 6 Name: Section Day and Time: The goal of this quiz is to prepare you for the exam, in particular the amount of time that youll have to answer the questions and the grading rubrics. Given the length of the exams you have t... Date Added: 2009-06-24 11:54:11 |
| YMR158W-B.t2k.dssp-ebghstl-logo.pdf Path: UCSC >> YMR >> 158 Fall, 2009 Description: YMR158W-B.t2k EBGHSTL 3 2 1 CC X H S E C E T C H T X X X X C X C H X HHHHEEEHEHEHH H H H H E E H EXXXXX E E X X X X X X X X X X X X H H H X X X H H E T T E E E C E C X X X X X X X X X E E H H XX H H H X X H H H H H H X X X X X X X ... Date Added: 2009-06-24 11:58:32 |
| Dan Ruth amakudari.ppt Path: Middlebury >> PSCI >> 0327 Fall, 2009 Description: East Asian Democracy PSCI 0327 Dan Ruth Does the institution of amakudari facilitate democracy or does it inhibit its development? Considering recent scandals from the 1990s and the political arena\'s proclivity for elitism in the past, does the a... Date Added: 2009-06-24 12:06:13 |
| irsim_fa99.ps Path: USC >> EE >> 577 Fall, 2009 Description: %!PS-Adobe-3.0 %BoundingBox: (atend) %Pages: (atend) %PageOrder: (atend) %DocumentFonts: (atend) %DocumentNeedsFonts: (atend) %DocumentSuppliedFonts: (atend) %Creator: Frame 5.5 %DocumentData: Clean7Bit %EndComments %BeginProlog % % Frame ps_prolog 5... Date Added: 2009-06-24 12:06:14 |
| teaching_&_learning_strategies.pdf Path: CSU San Marcos >> IT >> 709 Fall, 2009 Description: teaching and learning strategies http:/www.rmcdenver.com/eetnet/stratl.htm Search FAQ About Us Home Teaching and Learning Strategies Technology Plan Template Technology Success Stories Online Resources Strategies Grant Opportunities Network Sit... Date Added: 2009-06-24 12:16:17 |
| section16.pdf Path: ASU >> STAT >> 371 Fall, 2009 Description: 16. Integration Exercise 16.1. Let f be bounded on [a, b] and P = {xi }n P[a, b]. Prove that 0 Mi - m i = sup x,y[xi-1 ,xi ] |f (x) - f (y)| for all i = 1, . . . , n. Exercise 16.2. Let f be integrable on [a, b]. Let (Pn ) be a sequence of partit... Date Added: 2009-06-24 12:23:01 |
| Final-review.pdf Path: Kentucky >> MS >> 507 Fall, 2009 Description: Math/Physics 507 Final Review We\' covered the following topics this semester: ve 1. Fourier Series: sine series, cosine series, orthogonal functions 2. Solution of the heat and wave equations in one-dimension by Fourier series 3. Fourier integrals: F... Date Added: 2009-06-24 12:26:26 |
| homework2.pdf Path: Arizona >> MATH >> 456 Spring, 2008 Description: Homework 2: Wave equations Math 456/556 1. Text, problem 1.2.1. 2. Text, problem 1.2.9. This is easiest by first making the change of variables in equation (3). 3. (Step initial condition) Consider the wave equation utt = uxx on the whole real lin... Date Added: 2009-06-24 12:35:31 |
| Nutrition_Metabolism_Part_1.pdf Path: Harford CC >> BIO >> 204 Fall, 2009 Description: Chpt. 25: Nutrition & Metabolism (part I) Metabolism: catabolism anabolism -for structural maintenance or repairs - to support growth - secretions - build nutrient reserves: glycogen, fats nutrient pool: source of substrates for both catabolic and an... Date Added: 2009-06-24 12:40:56 |
| quiz10.pdf Path: UVA >> STAT >> 112 Fall, 2009 Description: \" 4 ! ~ G! }087 % u}1 dFDidCXEA 6 53 fi3 dixVdQ ! % 7 c 6 3 %B A 6 4 ! 1 3 % 1 3 \' ) g (id$(kA FfU c 6 3 %B A 6 9 6W \" ! c % 3 v 7 !B 9 % ! 1 3 U 3 c ! \" c ! A ! \" c ! W Gf{@f(6 #CA @87 fiX6 FGddE#dd{ b% g FDidCXEA F|U Gf{@f(oGDCA @87 fizyQ c 6... Date Added: 2009-06-24 12:41:10 |
| initial project list 4802.xls Path: Allan Hancock College >> ELEC >> 4802 Fall, 2009 Description: Initial list of thesis projects in COMP/ELEC4802 & COMP4808 in 2002/3 Supervisor No PA Bailes PAB1 N Bergmann NB2B NB2C NB3C NB4A NB4B NB4C NB5C NB6A NB6B ME Bilakowski MEB1 MEB2 MEB3 MEB4 MEB5 MEB6 D Carrington DC1 DC2 DC3 DC4 R Cocks RC1 RC2 A RC2 ... Date Added: 2009-06-24 12:41:18 |
| revmid1eco685s2005.pdf Path: UMiami >> ECO >> 685 Spring, 2008 Description: Review, First Quiz Managerial Economics: Eco 685 Quiz Date: Friday, February 4, 2005 All questions come from the class notes: Introduction, Production Theory, and Cost Theory up to section V. Notice that we skipped sections III and VI of production t... Date Added: 2009-06-24 12:42:25 |
| mtnotes_implementation.pdf Path: UMiami >> ECO >> 403 Spring, 2008 Description: POLICY IMPLEMENTATION The charter of the FED states that the FED should endeavor to keep inflation low (price stability) and promote growth (low unemployment). Suppose at the end of the day the FED decides that inflation should be 4%. How, on a day t... Date Added: 2009-06-24 12:42:31 |
| enzyme.pdf Path: Great Lakes >> BIO >> 106 Fall, 2009 Description: ENZYME LAB Name_ Review chapter 2 topics: pH, buffers, proteins and enzymes in your text book. From your reading you will note that without enzymes life would not be possible. All chemical reactions required for any kind of life would happen far to... Date Added: 2009-06-24 12:45:44 |
| code.ps Path: Duke >> CPS >> 100 Fall, 2009 Description: %!PS-Adobe-3.0 %Title: CollisionSystem.java, Event.java, Particle.java %For: Jeffrey R.N. Forbes %Creator: a2ps version 4.13 %CreationDate: Fri Apr 4 11:44:54 2008 %BoundingBox: 24 24 588 768 %DocumentData: Clean7Bit %Orientation: Landscape %Pages: 3... Date Added: 2009-06-24 12:46:40 |
| expuncert.pdf Path: SUNY Stony Brook >> CHE >> 133 Fall, 2008 Description: Uncertainties in Logarithmic and Exponential Measures The general relationship between uncertainties in logarithmic quantities and their exponential equivalents is best shown as follows. Suppose x and y are related by y = 10 x (i.e., x = log y) Let y... Date Added: 2009-06-24 12:47:12 |
| susb054.pdf Path: SUNY Stony Brook >> CHE >> 133 Fall, 2008 Description: SUSB- 054 Analysis of a Mixture of Sodium Hydrogen Carbonate and Sodium Chloride Prepared by M. J. Akhtar (Revised 12/06) Objective: To use two analytical methods, gasometry, and gravimetry, to analyze mixtures of sodium hydrogen carbonate and sodium... Date Added: 2009-06-24 12:47:18 |
| p115-syllabus-spring08.pdf Path: Maryland >> P >> 115 Fall, 2008 Description: Spring 2008 (last updated: 3/23/08) TITLE INSTRU CTO R PHYSICS 115 University of Maryland Department of Physics Inquiry into Physics (4 Cred its) Prof. Hamilton Section 0201 Prof. Douglas C. Hamilton Room 3201, Compu ter and Sp ace Sciences Buildi... Date Added: 2009-06-24 12:47:46 |
| m410test_2_sols.pdf Path: NMT >> M >> 410 Fall, 2009 Description: M410 Take Home Test # 2 due by Wednesday, Dec 6, 2006 SOLUTIONS Name 1. Finite Dierences: (a) Find the 3-point nite dierence approximation to f 0 (0) using the values f (0), f (2h), and f (3h), i.e. nd A, B , and C so that f 0 (0) = Af (0) + Bf (2... Date Added: 2009-06-24 12:54:32 |
| ECE5241-HW4.doc Path: Benjamin Franklin Institute of Technology >> ECE >> 5245 Fall, 2009 Description: ECE5241 DIGITAL SIGNAL PROCESSING I HOMEWORK 4 For the systems defined below, establish which properties (from the ones that were discussed in the class; e.g., superposition, linearity, time invariance, stability, causality) hold for each one of the... Date Added: 2009-06-24 12:58:42 |
| assignment3.doc Path: Washington >> TCSS >> 343 Fall, 2009 Description: Computing and Software Systems 343, Winter 2005 Mathematical Principles of Computing II Assignment 3. Version 1.0. Due Monday, Jan. 31st. Scientist Bob on the planet Khitomer recently studied the reproductive life cycle of tribbles, a furry animal cr... Date Added: 2009-06-24 13:04:06 |
| Quiz_3B.pdf Path: Harford CC >> BIO >> 204 Fall, 2009 Description: Name: BIO 204 Quiz #3 1. Which of the following blood types is termed the universal donor? a. A b. B c. AB d. O Explain why it is the \"universal donor\"? 2. 3. Which of the following situations is potentially dangerous? a. Rh- mother and Rh+ baby c.... Date Added: 2009-06-24 13:08:00 |
| YNL097W-A.t2k.CB_burial_14_7-logo.pdf Path: UCSC >> YNL >> 097 Fall, 2009 Description: YNL097W-A.t2k CB_BURIAL_14_7 2 1 AAAA A 10 20 30 40 BA DA DA DA BEFAF E DBA 2 1 A B C D X 51 C 50 1 A A AA ABB ABAA A BB BBA BA BBBBBXXX C C C X X X X XX X MANGTILAHSLRHHTPPFPRMPLGYSSSRAVRRSRWFLVLISCCCCCFRR D D X X X X X A X A A ... Date Added: 2009-06-24 13:15:50 |
| YNL067W.t2k.stride-ebghtl-logo.pdf Path: UCSC >> YNL >> 067 Fall, 2009 Description: YNL067W.t2k EBGHTL 3 2 1 C X TXTCECECTCCTXXEXC C E T T E T T E T X X X X X X X CEECTTEC EC C EEEET X X CE X 1 10 20 30 40 E 3 2 1 T E T E T E T E T E T TE X X T ECX C 51 60 70 80 90 E 3 2 1 T H E E EEEEE TTT T E XHH... Date Added: 2009-06-24 13:16:23 |
| YNL006W.t2k.str2-logo.pdf Path: UCSC >> YNL >> 006 Fall, 2009 Description: YNL006W.t2k STR2 5 4 3 2 1 T CCCYZZZ TSS Y A Z A YCAY Z B M A T C MYMTY CMY S S S C M M YM M XXZXMXXCXXXXCXZYXXSXXXXXXX X X X X 10 20 30 40 ZT A T S ZEZ YZ S ZYA Z T S A 5 4 3 2 1 Y A X C ZZY C Z ZS CZC Z T A A T CYAZCSCCSY Z M ... Date Added: 2009-06-24 13:16:39 |
| YNL013C.t2k.dssp-ehl2-logo.pdf Path: UCSC >> YNL >> 013 Fall, 2009 Description: YNL013C.t2k DSSP-EHL2 2 1 C C C H X X X 1 10 20 30 40 H 2 1 HHH X X X E H H C C C X 51 60 70 80 90 HE 2 1 H H T H C HX C C C C C C C C C C C C H X X 101 110 H 120 HH H C CCCC PNFVSQILSKFCRMRNNNDTTFKSF X X X X X X X X X X X ... Date Added: 2009-06-24 13:16:55 |
| YNL053W.t06.str2-logo.pdf Path: UCSC >> YNL >> 053 Fall, 2009 Description: YNL053W.t06 str2 4 3 2 1 YC C CCZCZC Z Y H M G CSSSST SYGGTTSSTTSSST S Z S S TS CTC STTCH S S T Z E A H A Q T T T Q Z S S Q S STTSSGCG S H G H S G G H H TT G M T T H G G G G XXXX XSXSHXGXXTXGXXGXTXXBXGXHXXXXXXSXXXTXXXXXXXHXX X X X X X X X X AA Y ... Date Added: 2009-06-24 13:17:29 |
| ELEG648_lec5_SP07.pdf Path: Delaware >> ELEG >> 648 Fall, 2008 Description: ... Date Added: 2009-06-24 13:18:59 |
| Hydro08.pdf Path: Tennessee >> GEOL >> 485 Fall, 2009 Description: Fall 2008 PRINCIPLES OF HYDROGEOLOGY Civil Engineering 485 Geology 485 3 credit hours DESCRIPTION Physical properties of aquifers, principles of groundwater movement, saturated flow equations, analytical and numerical models, hydraulic properties of... Date Added: 2009-06-24 13:25:38 |
| YKL059C.t2k.alpha-logo.pdf Path: UCSC >> YKL >> 059 Fall, 2009 Description: YKL059C.t2k ALPHA 3 2 1 E X EAB A T E H ABB E E A H B B B S A S B H B I B B T T B B B T B X X X X X X X X EAA X EEEEEA AA A B E B XXXX E A I EE XXXXXX C E I I SB S XXXX H I D B A A SBC E D T T C A C B H E F E C E H IIIIIXIIXIIG I X ... Date Added: 2009-06-24 13:26:01 |
| YKL016C.t2k.dssp-ehl2-logo.pdf Path: UCSC >> YKL >> 016 Fall, 2009 Description: YKL016C.t2k DSSP-EHL2 2 1 C C C C C C C C C H H X 1 10 20 30 40 H 2 1 TH H T H T CC 51 C C C E E E C H H H C C C C C C CCHHHCCCCCCCCCCCCXE X X X X X X X X X X X X X X X X X 60 70 80 90 E 2 1 H H T E H HHH 101 H C H CCCCCCCCCC... Date Added: 2009-06-24 13:26:13 |
| bio425class.pdf Path: Central Connecticut State University >> BIO >> 425 Fall, 2009 Description: COURSE SCHEDULE Aquatic Plant Biology Biology 425, Fall 2000 (T, Th: 0930-1045; T, 1100-1350) Dr. Clayton A. Penniman, 341 Copernicus 860-832-2658, penniman@ccsu.edu DATE 07, 12 Sep 14, 19 Sep 21, 26, 28 Sep 03 Oct 05 Oct 10, 12, 17, 19 Oct 24 Oct 26... Date Added: 2009-06-24 13:26:49 |
| YKL047W.t2k.w0.5-logo.pdf Path: UCSC >> YKL >> 047 Fall, 2009 Description: YKL047W.t2k w0.5 3 2 1 L M N XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX GGEEP V I L L L V P V L N N F I S T K Q T LLN N GE L P GA I V V I F V A L F A I IL V L FD LE Y N I S V G S K A A K A KEA S K G V I IW LI L F Y ... Date Added: 2009-06-24 13:26:54 |
| CS590L Lab3.doc Path: UMKC >> CS >> 590 Fall, 2009 Description: JavaSpaces Lab 3 UMKC CS590L Prof. Yugi Lee 3/15/04 Jeff Schott Introduction This lab introduced JavaSpaces, which is a Jini service that provides a persistent object store and exchange mechanism.1 JavaSpaces implements a space into which objects ma... Date Added: 2009-06-24 13:27:22 |
| MCFinal_2005_MC_Solutions.pdf Path: Acton School of Business >> PHYS >> 102 Fall, 2008 Description: Last Name: Key First Name: Key Physics 102 Spring 2004: Final ExamMultiple-Choice Answers 9:00 AM - 12:00 PM, 1 May, 2004 For each question, mark a single X in the box corresponding to the correct answer. AB 1X 2X 3 4 5 X 6 7 X 8 X 9 X 10 X 11 X 1... Date Added: 2009-06-24 13:36:59 |
| obshartwig.pdf Path: Wisc Stevens Point >> JHETZ >> 441 Fall, 2009 Description: ... Date Added: 2009-06-24 13:47:29 |
| precisionPHY_users.pdf Path: Lake County >> ECE >> 412 Fall, 2009 Description: Precision Physical Synthesis Users Manual Release 2003c Update1 January 2004 Copyright Mentor Graphics Corporation 2002-2004. All rights reserved. This document contains information that is proprietary to Mentor Graphics Corporation. The original r... Date Added: 2009-06-24 13:50:44 |
| set5.pdf Path: Creighton >> CHM >> 446 Fall, 2009 Description: CHM 446 STATISTICAL MECHANICS: PROBLEM SET FIVE Due: Wednesday, Apr 29 As always, it\'s best to start on these early. Please see me or drop me an email if you have any questions, or would just like a hint to get you past a hurdle that has blocked y... Date Added: 2009-06-24 13:53:39 |
| randell_srds86.pdf Path: CSU Channel Islands >> EECS >> 224 Fall, 2009 Description: Proc IEEE CS Symp on Reliable Distributed Systems (SRDS 86) Jan 1986 pp 113-118 Proc. IEEE CS Symp. on Reliable Distributed Systems (SRDS \'86), Jan. 1986, pp. 113-118. (Invited Paper) ... Date Added: 2009-06-24 14:02:24 |
| attachment.pdf Path: Cal Poly Pomona >> DCI >> 20090204 Fall, 2009 Description: ... Date Added: 2009-06-24 14:06:41 |
| 418syllabus_chen.doc Path: Bethel VA >> CHE >> 418 Fall, 2009 Description: ChE 418 Materials Laboratory Call Number 01451, Section A01 Time and Place: 1:10 - 6:00 p.m. Thursdays, Stocker 028 Instructor: Dr. Russell Chen (Stocker 185, 3-1497, chenw@ohio.edu) Web site: http:/132.235.17.4/ChE418WJC/ (You can start from ChE web... Date Added: 2009-06-24 14:07:49 |
| chapter9part42pages.pdf Path: Illinois Springfield >> CHE >> 141 Fall, 2008 Description: Molecular Geometry and Bonding Theories Chapter 9, Part 4 November 30th, 2004 Bond Order Defined as: Bond order = (# of bonding electrons - # of antibonding electrons) For a single bond: bond order = 1. For a double bond: bond order = 2. For a ... Date Added: 2009-06-24 14:08:10 |
| electronicstructurepart33pages.pdf Path: Illinois Springfield >> CHE >> 141 Fall, 2008 Description: Electronic Structure of Atoms and the Periodic table Chapter 6 & 7, Part 3 October 26th, 2004 Homework session Wednesday 3:00 5:00 Electron Spin Quantum # ms Each electron is assigned a spinning motion along an imaginary axis. The electrons prese... Date Added: 2009-06-24 14:08:15 |
| 121_schedule.pdf Path: Glendale CC >> PHOTO >> 121 Fall, 2009 Description: CLASS SC HEDU LE - PHOTO 121 Tuesday even ings 6-10:30 R E V IS E D 3 - 1 7 - 0 9 2 -1 7 INTRODU CTION Lab environmen t & rules, Mac OS X b asics Intro to Pho toshop workspace Basic selection tools, move tool EX ERCISE 1 basic selections and laye... Date Added: 2009-06-24 14:15:36 |
| function_generator_quick_instructions.pdf Path: Ohio State >> ECE >> 209 Fall, 2008 Description: For HIGH IMPEDANCE (HIGH Z) (i.e., 50 ) loads: BEFORE setting output amplitude and oset, complete the following steps. 1. Press Shift and then Enter in order to bring up the MENU . The display should show A: MOD MENU . Pressing < and > moves from ... Date Added: 2009-06-24 14:16:27 |
| fs2000e3k.pdf Path: Maryville MO >> STAT >> 150 Fall, 2009 Description: Statistics 150: Introduction to Statistics Exam 3 - Chapter 8, 9.1, 9.2 November 17, 2000 Name: _ Section 1 Directions: This section contains five computational problems worth a total of 85 points. For each problem, you must present all your work, ... Date Added: 2009-06-24 14:30:41 |
| joe.txt Path: Penn State >> PSU >> 007 Fall, 2009 Description: Degree Audit | Help This is the degree audit report you requested to view. You may print this report or return to the selection screen in order to view another audit report. PREPARED: 10/30/07 - 23:41 987654321 JUN... Date Added: 2009-06-24 14:35:32 |
| booleanidentities.pdf Path: University of Illinois, Urbana Champaign >> ECE >> 290 Spring, 2008 Description: Boolean Identities In a few instances, the AND operation is represented by a dot () for clarity. x+0 x+1 x+x x+x () x x+y x + (y + z ) x(y + z ) (x + y ) x + xy x + xy xy + yz + xz = = = = = = = = = = = = x 1 x 1 x y+x (x + y ) + z xy + xz xy x x... Date Added: 2009-06-24 14:36:01 |
| languages.doc Path: Mississippi State >> CSE >> 3813 Fall, 2009 Description: CS 3813 Introduction to Formal Languages and Automata Languages Characters: symbols, usually a, b, c, or 0 and 1 Alphabet: A finite, non-empty set of characters, usually indicated by = {a, b} The Greek sigma symbol, , represents the set of symbols... Date Added: 2009-06-24 14:36:07 |
| SampleTest3.pdf Path: Oakland University >> MTH >> 254 Winter, 2008 Description: Math 254 Sample Test 2 - Winter 2006 This is a sample test, not a comprehensive review. You are responsible for all materials covered since the previous exam. GOOD LUCK. (Parts of this sample test stolen from various tests available on the internet) ... Date Added: 2009-06-24 14:38:29 |
| SOL03.pdf Path: Lake County >> ECE >> 313 Fall, 2009 Description: ECE 413 Solutions to Problem Set #3 Spring 2007 1. Illustration of the law of the unconscious statistician (LOTUS) with a ramp pmf (a) The function is nonnegative. We thus just have to check that the total mass is one, or equivalently, that 1+2+ ... Date Added: 2009-06-24 14:41:02 |
| attachment-0001.pdf Path: Oregon State >> ENGR >> 20080513 Fall, 2009 Description: CS Freshman Mentoring Jobs for 2008-09 Undergraduate Freshman Mentor / Teaching Assistant Wage: $8.50 / hr. Overview: The freshman mentor positions are designed to encourage new CS students to be the best they can be. The motivation behind this is to... Date Added: 2009-06-24 14:51:22 |
| NACEArticleonInternships.doc Path: Oregon State >> BD >> 20051123 Fall, 2009 Description: Internships seen as key to the future of new college graduate hiring BETHLEHEM, PAFor new college graduates looking to enter the work force, participating in an internship is likely to be even more important in the future than it is now, according to... Date Added: 2009-06-24 14:52:44 |
| Experiment2.pdf Path: Lake County >> ECE >> 385 Fall, 2009 Description: ECE385 DIGITAL SYSTEMS LABORATORY Experiment 2 Latches and Flip-Flops Janak H. Patel Department of Electrical and Computer Engineering University of Illinois at Urbana-Champaign Today\'s Topics Permissible range of temperature and VCC TTL Speed and... Date Added: 2009-06-24 14:57:03 |
| Section 7_2 Path: N.C. State >> MA >> 241 Spring, 2009 Description: WebAssign Section 7.2 (Homework) About this Assignment Question Points 1 2 3 45 3 0.5 0.5 3 4 Total 11/11 Description Direction Fields and Euler\'s Method The due date for this assignment is past. Your work can be viewed below, but no changes can be... Date Added: 2009-06-24 14:57:07 |
| Midterm2samplequestions.pdf Path: National Taiwan University >> G >> 645 Fall, 2009 Description: Sample Test Questions: Exam #2 Sample Multiple Choice Questions: Table 1. C1 1 2 3 4 5 C2 2 1 0 1 0 0 2 1 0 1 0 0 3 0 1 0 1 1 3 0 1 0 1 1 4 1 0 1 0 0 4 1 0 1 0 0 5 0 0 1 0 0 5 0 0 1 0 0 1 0 1 0 1 0 2 1 0 1 0 0 3 0 1 0 1 1 4 1 0 1 0 0 5 0 0 1 0 0 C1 ... Date Added: 2009-06-24 14:59:34 |
| ch12_ce.ppt Path: Penn State >> IST >> 220 Fall, 2008 Description: Guide to Networking Essentials Fifth Edition Chapter 12 Network Administration and Support Objectives Manage networked accounts Monitor network performance Protect your servers from data loss Guide to Networking Essentials, Fifth Edition 2 Man... Date Added: 2009-06-24 15:02:23 |
| astr1020_lecture11.ppt Path: Bowling Green >> ASTR >> 1020 Fall, 2009 Description: ASTR 1020 Stellar and Galactic Astronomy Instructor: Dr. Russel White Reading: Chapter Sections 17.2-17.4 HW #4 due next Thursday 2/19 at 9:30 am - online at www.masteringastronomy.com Exam solutions are available here: - http:/www.chara.gsu.edu/... Date Added: 2009-06-24 15:19:47 |
| grade-phase2b.txt Path: Bucknell >> CSCI >> 204 Fall, 2008 Description: Grade Guideline for phase 2 NAME of the student: _ - Phase 2 grade should be scaled to 90 points Looking for - uses 2d array 30 - uses objects appropriately 20 - methods to (want at least 2) 10 - take user input ... Date Added: 2009-06-24 15:21:02 |
| Homework_6.pdf Path: Lake County >> ECE >> 476 Fall, 2009 Description: ECE-47 Fall 2008 76: HOME H EWOR #6 RK and extbook Problems 2.38, 6.8, 6.23 and 6.28 of Power System Analysis a Design te 2.38) e wn e he Given the impedance diagram of a simple system as show in Figure 1, draw th admittance diagram for the system a ... Date Added: 2009-06-24 15:21:10 |
| note4.pdf Path: Lake County >> ECE >> 498 Fall, 2009 Description: ECE498SL Note 4 Page 1 5 May 2009 ECE498SL Note 4 Page 2 5 May 2009 Synchronization Concepts Although weve gone over these ideas already in class, I thought that it might be useful to make a focused case study of a few synchronization issues that... Date Added: 2009-06-24 15:24:12 |
| exam.pdf Path: SUNY Stony Brook >> MAT >> 360 Fall, 2008 Description: MAT360 Name: Midterm Exam March 26, 2009 ID: Question: Points: Score: 1 10 2 10 3 10 4 10 5 10 6 0 Total 50 There are 6 problems in this exam. Make sure that you have them all. Do all of your work in this exam booklet, and cross out any wo... Date Added: 2009-06-24 15:24:33 |
| Syllabus122_Summer08.pdf Path: Glendale Community College >> MAT >> 120 Fall, 2008 Description: MAT 122 Intermediate Algebra Syllabus Summer 2008 I NSTRUCTOR : Jenifer Bohart Office : CM 413 P hone : 480 - 423 - 6278 E mail : Jenifer.B ohart@sccmail.maricopa.edu Website : h ttp:/www.scottsdalecc.edu/bohart CLASS TIME and LOCATION: Title MAT1... Date Added: 2009-06-24 15:25:55 |
| sampleexam1.pdf Path: NSCC >> CHE >> 101 Fall, 2009 Description: Chemistry 101 Sample exam 1 (chapters 1, 2 and 4) Closed book, open notes, handouts, homework; no collaboration, 50 minutes. 50 points possible. 1. (1 point) How many significant figures in 0.002050? 2. (1 point) Express 14,200.5 meters in scientific... Date Added: 2009-06-24 15:26:32 |
| lab2.pdf Path: NSCC >> GEL >> 101 Fall, 2009 Description: Geology 101 Name(s): Lab 2: The rock cycle, minerals and igneous rocks Rocks are divided into three major categories on the basis of their origin: Igneous rocks (from the Latin word, ignis = fire) are composed of minerals which crystallized from mo... Date Added: 2009-06-24 15:26:51 |
| 123quiz4.pdf Path: SUNY Stony Brook >> MAT >> 123 Summer, 2008 Description: Quiz IV - MAT 123 Date 08/08/07 - Duration 6 minutes SUNYSB Id No. : Name : Problem 1 Using Pythagoras theorem show that sin2 t + cos2 t = 1. Problem 2 Find the amplitude and frequency of d = 3 cos(t). 1 ... Date Added: 2009-06-24 15:29:48 |
| breadboard.pdf Path: Oakton >> ELT >> 101 Fall, 2009 Description: The diagram shows how the breadboard holes are connected: The top and bottom rows are linked horizontally all the way across as shown by the red and black lines on the diagram. The power supply is connected to these rows, + at the top and 0V (zero vo... Date Added: 2009-06-24 15:32:53 |
| 3.doc Path: UAB >> GROUP >> 663 Fall, 2009 Description: Lecture 3: Gene to Phenotype Chapter 5: p. 153 Chapter 6: pp. 185-202 Recommended Problems: Chapter 6: Problems 2, 4ab, 5ab, 6ab, 49 abc(omit F1 part)e, 50abcd, 66. Lecture 7: Beedle and Tatum, 1940s, Nobel Prize -irradiated Neurospora and looked for... Date Added: 2009-06-24 15:40:55 |
| Note_Taylor.pdf Path: CUNY Baruch >> MAT >> 158 Fall, 2009 Description: Proof of the Taylor formula with remainder April 15, 2008 Here is a short proof of the Taylor formula with remainder in Lagrange form: Theorem. Suppose f is n + 1 times differentiable in some interval I centered at a. Then, for every x I, n f (n+1) ... Date Added: 2009-06-24 15:42:25 |
| EOC_Solution_14_42.pdf Path: Cal Poly >> PHYS >> 132 Fall, 2009 Description: 14.42. Model: The block on a spring is in simple harmonic motion. Solve: (a) The position of the block is given by x (t ) = A cos(t + 0 ) . Because x (t ) = A at t = 0 s, we have 0 = 0 rad , and the position equation becomes x(t ) = A cos t . At t... Date Added: 2009-06-24 15:57:28 |
| EOC_Solution_17_67.pdf Path: Cal Poly >> PHYS >> 132 Fall, 2009 Description: 17.67. Model: The air is assumed to be an ideal diatomic gas that is subjected to an adiabatic process. Solve: The air admitted into the cylinder at T0 = 30C = 303 K and p0 = 1 atm = 1.013 105 Pa has a volume V0 = 600 106 m3 and contains pV n = 0 ... Date Added: 2009-06-24 15:57:39 |
| YJL084C.t2k.dssp-ehl2-logo.pdf Path: UCSC >> YJL >> 084 Fall, 2009 Description: YJL084C.t2k DSSP-EHL2 2 1 CC 1 C C E E E E E E H E E E E E E H H H H H X X X X X X X X X X X X X X X X X X X 10 20 30 40 T 2 1 CC X X E S E S E C H H X C EC ECCECCCCC E E E X X X X X X X X X X EEEEE 60 C C CCCCCCCEEECCCCCCCCCCCCCCCC... Date Added: 2009-06-24 16:03:25 |
| YJL050W.t2k.stride-ebghtl-logo.pdf Path: UCSC >> YJL >> 050 Fall, 2009 Description: YJL050W.t2k EBGHTL 3 2 1 C C TTHH H H X X X 1 10 20 30 40 H 3 2 1 T H H T T H E T H HH C H H HHXXXXXXXXXXXHHCCCTCCXX HHXXCCCHHHHHHHHHHHCCTTTCTTCCXXHHH H H H H H C C H H C X X X X X X X X X X X X X X X X X X X X X X C C E X X X X X X X... Date Added: 2009-06-24 16:03:34 |
| YJL066C.t2k.dssp-ehl2-logo.pdf Path: UCSC >> YJL >> 066 Fall, 2009 Description: YJL066C.t2k DSSP-EHL2 2 1 CC 1 E E E E E X X X X X 10 20 30 40 T 2 1 CCCCCC E E E E E X X X C H H G H T G T T 51 60 70 80 90 E 2 1 C C C C H H H H X X X X X X T H T H T H T E C CCC X X X C C C X X C C X X H C C C C ... Date Added: 2009-06-24 16:03:56 |
| YJL013C.t2k.dssp-ebghstl-logo.pdf Path: UCSC >> YJL >> 013 Fall, 2009 Description: YJL013C.t2k EBGHSTL 3 2 1 C X C X HH C E X E E C C X X X X X X X E E T E E H H S G G T G X X CS TSSSS EE TXTGGTBHXXX XX X X X X XXX T S CCCTCCCCC SSSS T C 10 20 30 40 E 3 2 1 HHHH T C C X X T S H T H T T C C C C T X X X X X X X ... Date Added: 2009-06-24 16:04:13 |
| whats your strategy.doc Path: Western Michigan >> SPED >> 534 Fall, 2009 Description: Strategy: Appropriate Grade Level: Procedures/Steps: Comments and/or tips: Source: Marcell, B. (2005). Whats your strategy? Teaching pre-Kindergarten, 35, 52-53. ... Date Added: 2009-06-24 16:05:14 |
| ps2.pdf Path: SUNY Stony Brook >> MAT >> 615 Fall, 2008 Description: MAT 615: Complex Curves and Surfaces Spring 2009 Problem Set 2 Due on Tuesday, 03/03, at 12:40pm Please write up concise solutions to 3 problems; about half a page for each problem should do. Problem 1 (5 pts) Let S be a compact connected surface of... Date Added: 2009-06-24 16:07:07 |
| T0411.t04.CB_burial_14_7-logo.pdf Path: UCSC >> T >> 0411 Fall, 2009 Description: T0411.t04 CB_burial_14_7 3 2 1 1 10 20 30 40 A 3 2 1 ABE DAEA BDABDB EBDBDF BD A BE FG FEB A 51 60 70 80 90 DBAD 3 2 1 EB ED EDEB DA D B ABDB DEBABADAB D FG F 101 110 120 EDEFE GFDEFDBD EBDF EF BE 130 GKRGGE... Date Added: 2009-06-24 16:16:03 |
| T0411.t06.alpha-logo.pdf Path: UCSC >> T >> 0411 Fall, 2009 Description: T0411.t06 alpha 3 2 1 1 10 20 30 40 H 3 2 1 BSBH SEBAB H SEISE AB IH 51 60 70 80 90 EHE 3 2 1 B SE B IHSEHSIB H BSB EB HSBE AHB 101 110 120 SH BTEHE A HSBH 130 GKRGGEAQKVASSHGYSNTSLYPGSMNDWVSHGGDKLDL BSDB EH 100 ... Date Added: 2009-06-24 16:16:42 |
| 06011902.pdf Path: Wisconsin >> SH >> 060119 Fall, 2009 Description: ... Date Added: 2009-06-24 16:18:19 |
| sh060119_tilt05.ps Path: Wisconsin >> SH >> 060119 Fall, 2009 Description: %!PS-Adobe-3.0 %Creator: MATLAB, The Mathworks, Inc. %Title: sh060119_tilt05.ps %CreationDate: 01/21/2006 23:00:00 %DocumentNeededFonts: Helvetica %DocumentProcessColors: Cyan Magenta Yellow Black %LanguageLevel: 2 %Pages: (atend) %BoundingBox: (aten... Date Added: 2009-06-24 16:18:24 |
| Client acceptance.ppt Path: Charleston Law >> BU >> 447 Fall, 2009 Description: Client Acceptance: Factors to Consider s Audit considerations Professional considerations Business considerations s s Audit Considerations s Inherent risks s Control risks Professional Considerations s Expertise of CPA firm Independence Requ... Date Added: 2009-06-24 16:19:45 |
| Ob08.ppt Path: Charleston Law >> BU >> 604 Fall, 2009 Description: CHAPTER 8 8-1 Understanding Work Teams 1999 Prentice-Hall Canada Inc., Scarborough, ON CHAPTER 8 8-2 Chapter Outline s Teams versus Groups: Whats the Difference? s Why Have Teams Become So Popular? s Employee Involvement: The Precursor to T... Date Added: 2009-06-24 16:19:50 |
| T0489.t04.near-backbone-11-logo.pdf Path: UCSC >> T >> 0489 Fall, 2009 Description: T0489.t04 near-backbone-11 3 2 1 1 10 20 30 40 AG 3 2 1 DGAGDGD A GA GD G BGAG DEKBA GF DJ GI IG D 51 60 70 80 90 GDJDG 3 2 1 A IDKEA GEIEJI GJKIGJ G BGAGKD KEGJIJIHD IG 101 110 120 130 140 BA 3 2 1 GD AGAIG D... Date Added: 2009-06-24 16:22:01 |
| sbeao10.txt Path: UNC >> DOCS >> 2035 Fall, 2009 Description: The Project Gutenberg Etext of Stories by English Authors, Orient You may also want to see: Stories by English Authors in Africa, Scribners Ed[sbeaa*.*]1980 Copyright laws are changing all over the world, be sure to check the copyright laws for your... Date Added: 2009-06-24 16:28:16 |
| Grade Book Spr.xls Path: N. Georgia >> CWNAYL >> 7050 Fall, 2009 Description: Mr. Naylor\'s 4th Period Language Arts Class Student Book Report Vocab Quiz Poem Essay Total Average First Name Jenny Leah Brittany Oliver Maria Ema Chelsea Cho Devon Justin Carlos Harry Juan Last Name Carlson Chambers Cook Flint Gomez Granger Jacks... Date Added: 2009-06-24 16:39:25 |
| week8presentation2.ppt Path: Middlebury >> AC >> 023 Fall, 2009 Description: Civil Rights and Social Change Today\'s primary focus will be the emergence of the African-American civil rights movement and its implications for American culture, particularly political culture. We will survey significant events of the civil rights ... Date Added: 2009-06-24 16:41:25 |
| question MTTS.doc Path: Salisbury >> EDUC >> 07461 Fall, 2009 Description: Darnell Lewis- Russell Data Analysis 1. Describe how well your class met the three school goals for student performance, which are that: Each student will achieve a score of 7 out of 10 on each assessment of a targeted objective from the Voluntary S... Date Added: 2009-06-24 16:53:52 |
| 161HW6.pdf Path: Concordia Chicago >> MATH >> 161 Fall, 2008 Description: Math 161 Section 33 Fall 2007 Problem Set 6 Due Monday November 5th 1. Read Chapter 8 (And Appendix), Begin reading Chapter 9 2. Chapter 7 problems: 12 3. Chapter 8 problems: 1i, ii, iv, viii, 2ab, 3ab, 4a, 6ab, 12, 17ab 1 ... Date Added: 2009-06-24 16:54:17 |
| 621MIDs04.pdf Path: SUNY Albany >> AECO >> 621 Fall, 2009 Description: State University of New York at Albany Department of Economics ECO621 Econometrics II March 18, 2004 T. Kinal Midsemester Examination (30) 1. De ne or explain each of the following: a. power function; b. power of a test; c. size of a test; d. unbias... Date Added: 2009-06-24 17:02:26 |
| MicrosatelliteQuizF04.pdf Path: UCSC >> BIO >> 187 Fall, 2009 Description: Microsatellite Quiz Bio 187L, Fall 2004 1. Using the final output file from Seans lecture, assign putative fathers to as many pups as possible. Explain how sure you are of each assignment. 2. Look at pup 116, for whom a mother (Female 119) is assign... Date Added: 2009-06-24 17:06:11 |
| YPL118W.t2k.alpha-logo.pdf Path: UCSC >> YPL >> 118 Fall, 2009 Description: YPL118W.t2k ALPHA 3 2 1 HI H XXXXXXXX H B C H H E H B I HH S H T I B I S X X X H B B S E E E XXXXXXX XXXXX A H E B S H E E H S C D H C A X C B C D B S H E E E A S I X I S E H E A X B AEEE E ACE E S XXXXXXXXXX XXX E B B E H E B H ... Date Added: 2009-06-24 17:09:17 |
| IntMap98.ps Path: Glasgow Caledonian University >> COMP >> 150 Fall, 2009 Description: %!PS-Adobe-2.0 %Creator: dvips(k) 5.78 Copyright 1998 Radical Eye Software (www.radicaleye.com) %Title: ml98maps.dvi %Pages: 10 %PageOrder: Ascend %BoundingBox: 0 0 612 792 %EndComments %DVIPSCommandLine: dvips -t letter -f ml98maps %DVIPSParameters:... Date Added: 2009-06-24 17:17:05 |
| slac-pub-4087.pdf Path: Stanford >> PUBS >> 4000 Fall, 2009 Description: INVARIANT SURFACES AND TRACKING R. L. BY THE HAMILTON-JACOBI W ARNOCK S LAC - PUB - 4087 September 1986 (4 METHODt L awrence Berkeley Laboratory, U niversity o f C alifornia, R . D. R UTH B erkeley, CA 947,!?0 S tanford L inear A ccelerat... Date Added: 2009-06-24 17:21:40 |
| 07070704.pdf Path: Wisconsin >> TC >> 070707 Fall, 2009 Description: ... Date Added: 2009-06-24 17:22:39 |
| 6387.txt Path: UNC >> DOCS >> 6387 Fall, 2009 Description: Project Gutenberg\'s D. Octavius Caesar Augustus, (Augustus) by C. Suetonius Tranquillus This eBook is for the use of anyone anywhere at no cost and with almost no restrictions whatsoever. You may copy it, give it away or re-use it under the terms o... Date Added: 2009-06-24 17:26:49 |
| bbp_school_specific_questionaire.pdf Path: University of Illinois, Urbana Champaign >> CI >> 420 Fall, 2008 Description: University of Illinois at Urbana -Champaign (UIUC) Council on Teacher Education (CTE) Bloodborne Pathogens School/Agency-Specific Questionnaire The completion of the following questionnaire is a requirement for all student teachers/interns. Since Exp... Date Added: 2009-06-24 17:27:53 |
| YAL003W.t2k.stride-ebghtl-logo.pdf Path: UCSC >> YAL >> 003 Fall, 2009 Description: YAL003W.t2k EBGHTL 3 2 1 CC X C TTTTCTTT X X E E E E E E T G T G G B B X X X X X X X X 1 10 20 30 40 T 3 2 1 H H T H HHHHH X X C C T T T T C C T C C C T T C T C T T T T T C C C T C T C T C H H C C G T T H H T T C T T C T C H G C G G T ... Date Added: 2009-06-24 17:31:05 |
|
|
Get Started With Course Hero Today!
Get study guides, join study groups, and more!
Sign up in seconds with your Facebook account!
Course Hero is a Facebook Application Partner.
Click below to sign-up for FREE.
Our Social Learning Network was built to provide students and key learning partners like professors a platform to share, meet and collaborate while accelerating their comprehension of course-related theories and concepts. We are committed to providing you immediate access to a growing wealth of study materials and an unparalleled academic network of students, professors and other key partners. Why do you care? Because you want the best grade possible and at times need a 24/7 resource that’s responsive to your needs. |
|
What People Are Saying About Course Hero
|
|||
|
|||
|
Explore the benefits of joining Course Hero's social learning network.
|
|||
![]() |
Get millions of study materials now!Need lecture notes for a missed class or want insightful explanation of the theories and concepts you learn in class? Look no further, Course Hero’s Study Materials empowers you to find a broad and deep set of materials that can help you right now!
Click below to sign-up for FREE.
|
||
![]() |
Get over 200,000 textbook solutions now!Having difficulty with your homework and need documents that are relevant for your Textbook? Don't be frustrated. Course Hero's Textbook Help presents you study materials from many college courses.
Click below to sign-up for FREE.
|
||
![]() |
Meet over 300,000 students and your fellow classmates now!Want to meet your current classmates or those that took the class last year? Don’t worry or have anxiety. Course Hero’s Study Groups gives you the seamless opportunity to develop both anonymous or direct relationships with those classmates whom you want to meet and get help from right now!
Click below to sign-up for FREE.
|
||


