Course Solutions And Notes - CS252-MockExamFormOnly 26

Displaying 21501-22000 of 22424 documents:
next page of documents

L13WhileLoops.ppt
Path: UMBC >> PUB >> 104 Fall, 2009
Description: The while Looping Structure Topics The while Loop Program Versatility Sentinel Values and Priming Reads Checking User Input Using a while Loop Reading Section 3.7 Review: Repetition Structure A repetition structure allows the programmer...
Date Added: 2009-06-25 22:14:38

Vedran_Halilovic.doc
Path: W. Alabama >> ME >> 100 Fall, 2009
Description: Sliding Vane Pump Manufacturing Components: Externals (head, casing, bracket) - Cast iron, ductile iron, steel, and stainless steel. Vane, Pushrods - Viton, Ryton, PPS, carbon, Teflon Liner & End Plates - Cast iron, ductile iron, steel, carb...
Date Added: 2009-06-25 22:26:01

CST252_T2.doc
Path: East Los Angeles College >> CST >> 252 Fall, 2009
Description: CST252: Network Software Design Lab Session 2 Support from the Java System Week of 11 Feb 2002 The error messages generated by javac are useful. They give important clues as to what is wrong with your code. Ask your tutor to explain any messages...
Date Added: 2009-06-25 22:27:02

T0395.t06.CB_burial_14_7-logo.pdf
Path: UCSC >> T >> 0395 Fall, 2009
Description: T0395.t06 CB_burial_14_7 3 2 1 MRLGDAAELCYNLTSSYLQIAAESDSIIAQTQRAINTTKSILINETFPKWSPLNGEISFSYNGGKDCQVLLLLYLSCLWEYYIVKLSQSQFDGKFHRFPL 1 10 20 30 40 50 60 70 80 90 A 3 2 1 D BDE ADA B DBA DB DBA DA B DE BEDB A BDFG FG F E EFDBDBA BE D TKLPTVFID...
Date Added: 2009-06-25 22:28:22

MLA_ref.doc
Path: Minnesota >> TC >> 1013 Fall, 2009
Description: MLA Citation Guide Book Kanet, Roger E., and Alexander V. Kozhemiakin, eds. The Foreign Policy of the Russian Federation. New York: St. Martin\'s, 1997. Website Minnesota Planning. \"The 1998 Legislature Amended The Review and Comment Process.\" May 19...
Date Added: 2009-06-25 22:35:54

lecture12-Gauss Law and Div.pdf
Path: U. Houston >> ECE >> 2317 Fall, 2008
Description: ECE 2317: Applied Electricity and Magnetism Fall 2008 Prof. Jeffery T. Williams Dept. of Electrical & Computer Engineering University of Houston. Divergence and differential form of Gauss Law Notes prepared by the EM group, University of Houston. D...
Date Added: 2009-06-25 22:42:26

pKa.values.pdf
Path: Colorado State >> C >> 545 Fall, 2009
Description: 1 pKa Values INDEX Inorganic Pho sphates Carbo xylic a cids Phe nols Alco hols a nd o xyge n acids Amino Acids Peptide s Nitro ge n Compounds Aliphatic amines Cya noamines Anilines Nucleo sides Special Table Heterocycles Acridine Be nzoquinoline Hyda...
Date Added: 2009-06-25 22:43:40

mystery.pdf
Path: Penn State >> PSYCH >> 103 Fall, 2009
Description: Mystery Client Psychology Computer Lab PsychSim Name Section Date Mystery Client This module is designed to give you some practice in classifying and diagnosing psychological disorders. You should read the textbook chapter(s) that discusses psycho...
Date Added: 2009-06-25 22:46:44

Nomenclature Exercise.doc
Path: IPFW >> CHEM >> 104 Fall, 2009
Description: Revised: 98-09-15 1 Date: _ Name:_ CHEMICAL NOMENCLATURE AND FORMULAS Objectives A. To quiz your familiarity with the names, symbols, and some properties of the chemical elements (b) To learn Trivial names of certain substances (c) To learn the p...
Date Added: 2009-06-25 22:47:01

Feely_et_al_2008.pdf
Path: UCSB >> ESM >> 254 Fall, 2009
Description: Evidence for Upwelling of Corrosive \"Acidified\" Water onto the Continental Shelf Richard A. Feely, et al. Science 320, 1490 (2008); DOI: 10.1126/science.1155676 The following resources related to this article are available online at www.sciencemag.or...
Date Added: 2009-06-25 22:57:41

Equip.pdf
Path: Laurentian >> CHEM >> 3410 Fall, 2009
Description: Chem3410 Glassware and Equipment List Equipmentlist 5 In Week 1 of the laboratory course you will be assigned a locker of glassware and laboratory equipment. It is your responsibility to see that all elements of your kit are present and that i...
Date Added: 2009-06-25 23:01:22

lilgp.1.0.1.ps
Path: MO St. Louis >> CS >> 6340 Fall, 2009
Description: %!PS-Adobe-2.0 %Creator: dvipsk 5.55a Copyright 1986, 1994 Radical Eye Software %Title: lilgp.dvi %Pages: 62 %PageOrder: Ascend %BoundingBox: 0 0 612 792 %EndComments %DVIPSCommandLine: /opt/texmf/bin/dvips.exe -f lilgp.dvi %DVIPSParameters: dpi=300,...
Date Added: 2009-06-25 23:01:39

19810323.TXT
Path: Penn State >> BUB >> 1981 Fall, 2009
Description: Sheet1 STATE COLLEGE, PENNSYLVANIA DAILY WEATHER SUMMARY - Latest Complete Day [1200 UT - 1200 UT] -03/23/81 High Temperature Low Temperature Mean Temperature Rain or Liquid Equivalent Snow and/or Ice Pellets Snow Depth : : : 45 Rank (1=Warmest, ...
Date Added: 2009-06-25 23:01:50

Matt_Hunt.ppt
Path: W. Alabama >> ME >> 100 Fall, 2009
Description: Steam Boilers and There Application By: Matt Hunt Date: November 2, 2005 Objective: to inform on the basic functions of a steam boiler and some of there applications. Steam Boiler A steam boiler may be defined as a closed vessel partially filled wi...
Date Added: 2009-06-25 23:06:21

review.ps
Path: UMass (Amherst) >> ECE >> 697 Fall, 2009
Description: %!PS-Adobe-2.0 %Creator: dvips, version 5.396 (C) 1986-90 Radical Eye Software %Title: published.dvi %Pages: 18 1 %BoundingBox: 0 0 612 792 %EndComments %BeginProcSet: tex.pro /TeXDict 200 dict def TeXDict begin /N /def load def /B{bind def}N /S /exc...
Date Added: 2009-06-25 23:07:33

books.txt
Path: SUNY Albany >> CASE >> 538 Fall, 2009
Description: When Character was King Peggy Noonan Nonfiction Hardcover $14.95 Democracy in America Alexis de Tocqueville Nonfiction Hardcover $22.50 Samuel Clemens Tom Sawyer Fiction Paperback $4.95 Tom Clancy The Bear and the Dragon Fiction Paperback $7.95 S...
Date Added: 2009-06-25 23:08:15

output1.txt
Path: Purdue >> CS >> 180 Fall, 2008
Description: LightBike Tester Main Menu 1) Create a new Driver 2) Test if Drivers are enemies 3) Test the parallelism of two Drivers 4) Turn a Driver 5) Change a Driver speed 6) Teleport a Driver home 7) Drive all Drivers 8) Show Driver stats 9) Create...
Date Added: 2009-06-25 23:09:38

Lecture 3.doc
Path: GCSU >> MATH >> 5600 Fall, 2008
Description: 11 b) The number of ways that n objects can be grouped into r classes with ni in the ith r n n! class, i=1,r and ni = n is n n .n = n !n !.n ! i =1 1 2 r 1 2 r The numbers are called multinomial coefficients. They occur in the expansion n n1...
Date Added: 2009-06-25 23:09:46

songhw.pdf
Path: St. John Fisher >> KEEP >> 06267 Fall, 2009
Description: Name: _ Date:_ Directions: You now have heard about a variety of songs that are about the flag. It is now your turn to make up your own song about the flag. It can be any form you like, even in a form of the Pledge of Allegiance. Think of a title for...
Date Added: 2009-06-25 23:23:37

Teleportation.ppt
Path: Texas >> JC >> 422 Fall, 2009
Description: Heisenberg Uncertainty Principle Entanglement requires at least 3 photons to achieve quantum teleportation Photon A: The photon to be teleported Photon B: The transporting photon Photon C: The photon that is entangled with B Einstein referr...
Date Added: 2009-06-25 23:26:51

log_note.ps
Path: Kentucky >> MA >> 113 Fall, 2008
Description: %!PS-Adobe-2.0 %Creator: dvips(k) 5.94b Copyright 2004 Radical Eye Software %Title: log_note.dvi %CreationDate: Mon Nov 19 07:21:46 2007 %Pages: 4 %PageOrder: Ascend %BoundingBox: 0 0 595 842 %DocumentFonts: CMBX10 CMMI10 CMR10 CMEX10 CMMI8 CMR8 CMSY...
Date Added: 2009-06-25 23:30:44

GMPres.ppt
Path: Ill. Chicago >> ACTG >> 516 Fall, 2008
Description: vti_encoding:SR|utf8-nl vti_timelastmodified:TR|04 Dec 2006 23:40:00 -0000 vti_extenderversion:SR|6.0.2.6551 vti_author:SR|CBA\ am vti_modifiedby:SR|CBA\ am vti_timecreated:TR|04 Dec 2006 23:40:00 -0000 vti_cacheddtm:TX|04 Dec 2006 23:40:00 -0000 vti...
Date Added: 2009-06-25 23:31:51

sp99final.pdf
Path: Wisconsin >> STAT >> 572 Spring, 2007
Description: Stat/For/Hort 572 Clayton May 14, 1999 Final Exam Name: For graders use: Question 1 2 3 4 Total Possible Points 25 25 25 25 100 Score 1. (a) An experiment was conducted to study the eect of dierent combinations of two dierent chemicals in a trap ...
Date Added: 2009-06-25 23:44:24

resources.pdf
Path: CSU Northridge >> CS >> 585 Fall, 2009
Description: Resources.p65 1 resources 1 2 resources 2 Resources X applications maintain resource databases. X\'s resource mechanism enables customization of clients and widgets. 1. in the application, 2. on the command line, 3. in a users resource file, or 4. ...
Date Added: 2009-06-25 23:46:01

jens15.pdf
Path: Washington >> PHYS >> 122 Fall, 2008
Description: : Circuits Analysis Power Physics 122A: Lecture 15, Pg 1 Midterm Exam Subject matter: Gauss law Potential energy Equipotentials Capacitance All the rules are the same as for the last exam. Please do not forget: Calculator Bubble sheet + sof...
Date Added: 2009-06-25 23:47:20

Prob17Chap5.pdf
Path: North Texas >> CTM >> 0055 Fall, 2009
Description: Problem 17 Chapter 5, Royden Conrad T. Miller December 5, 2007 Then Problem 1. F Proof. Choose > 0. There is an > 0 such that if f(yi ; yiH ) : i = 1; 2; :; N g is any nite P collection of non-overlapping intervals with N jyi yiH j < then i=1...
Date Added: 2009-06-25 23:49:00

label_parts.rtf
Path: San Diego State >> ART >> 448 Spring, 2008
Description: Project Name or Title Student Name Project # Date Class # Class Name Class Section and/or Time Instructor Name San Diego State University ...
Date Added: 2009-06-25 23:49:48

P101MT2A.pdf
Path: Sveriges lantbruksuniversitet >> JUNK >> 1011828 Fall, 2009
Description: ...
Date Added: 2009-06-25 23:52:23

ABA Flowering FLC.pdf
Path: Maryland >> PLSC >> 400 Fall, 2008
Description: The Plant Journal (2004) 40, 112119 doi: 10.1111/j.1365-313X.2004.02194.x 1 Lesions in the mRNA cap-binding gene ABA HYPERSENSITIVE 1 suppress FRIGIDA-mediated delayed owering in Arabidopsis Isabel C. Bezerra, Scott D. Michaels, Fritz M. Schomburg ...
Date Added: 2009-06-25 23:56:03

Outline19.pdf
Path: S.F. State >> MATH >> 800 Fall, 2009
Description: MATH 800 FOUNDATIONS OF MATHEMATICS OUTLINE 19 1. JT SMITH SPRING 2008 In class, the Axiom of Choice (AC) unit a. I discussed the proofs that the AC implies Bernayss form and that Bernayss form implies the AC. b. To prove the latter (substantial pr...
Date Added: 2009-06-25 23:57:44

HW4 Solution.pdf
Path: UConn >> ME >> 260 Fall, 2009
Description: ~ Lf.~/ (11:=:1J . ~ - ; 7 \"V~o lteaJ\'\"-. ? q ~ (o):o X - - Y:C;hk;C-f U:>5b fA:J ~\"C3.lb.kL +- - C -L z o C ; 5 X - o C A s n,.2 I +.5/\'~ 6b)~4LSi!1j;L - 5 [J? ._k:9 h L ~c; - eo5.lo; ( - ;05 ( h * ft~ ...
Date Added: 2009-06-26 00:15:53

Day12.pdf
Path: University of Montana >> MATH >> 241 Fall, 2008
Description: Day 12: September 29, 2003 If the relationship appears to be linear, then one good measure of how related the two variables are is the correlation 1 n zxi zyi i=1 rxy = n1 A more intuitive formula for the correlation is rxy = 1 1 n 1 sx sy n (xi ...
Date Added: 2009-06-26 00:18:47

plot_t1f03.pdf
Path: University of Toronto >> STA >> 302 Fall, 2009
Description: logD = 10 -6.9727 +1.6129 logL N 24 Rsq 0.6861 AdjRsq 0.6718 RMSE 0.6541 9 8 7 6 5 4 6.75 7.00 7.25 7.50 7.75 8.00 logL 8.25 8.50 8.75 9.00 9.25 ...
Date Added: 2009-06-26 00:22:22

mt1jul96sol.pdf
Path: University of Toronto >> STA >> 257 Fall, 2009
Description: ...
Date Added: 2009-06-26 00:22:29

ex24.pdf
Path: Minnesota >> CSCI >> 5271 Fall, 2008
Description: CSci 5271: Introduction to Computer Security Exercise 24 due: December 2, 2008 Ground Rules. You may choose to complete this problem with a partner or by yourself. If you work with a partner, turn in one copy with both of your names on it. You may ch...
Date Added: 2009-06-26 00:23:15

PAE2429.t04.n_notor2-logo.pdf
Path: UCSC >> D >> 2429 Fall, 2009
Description: PAE2429.t04 n_notor2 3 2 1 84 90 100 N S N H IN 110 DTGLAEYRERRKEEAWRRYYEEYGYQYQQY ...
Date Added: 2009-06-26 00:26:15

PAE2429.t06.o_notor2-logo.pdf
Path: UCSC >> D >> 2429 Fall, 2009
Description: PAE2429.t06 o_notor2 2 1 84 90 100 N H N 110 DT G LAEYR ERRKEEAWRRYYEEYGYQY Q QY ...
Date Added: 2009-06-26 00:26:17

d3839.pdf
Path: East Los Angeles College >> E >> 301 Fall, 2009
Description: CHAPTER 5 MAKING CONNECTIONS WITH NEW TECHNOLOGIES 211 A common stereotype represents computer users as isolated from society, spending long hours engrossed in surng, chatting, gaming or hacking in the solitude of their own room. But no computer u...
Date Added: 2009-06-26 00:28:20

summary.pdf
Path: VCU >> PHYS >> 691 Fall, 2008
Description: 1 1.1 1.1.1 Basic Dierential Geometry Tensorial Derivatives Starting from Derivatives of Basis Vectors Dv e = e Dv w = v (w ) + w (v ) = Dv \' = v Dv Q = v eQ Q e \' +Q e ; (v ) (v ) e v \' e e +Q ! +Q ! ! Q Dv Q = v Q Q 1.1.2 ; e =e Q +Q Dieren...
Date Added: 2009-06-26 00:29:21

inv inflation and income taxes clip.doc
Path: High Point >> BUA >> 234 Fall, 2009
Description: Investments, Inflation, and Income Taxes A real return is your return after adjusting for taxes or inflation: real return = before-tax return (before tax rate * tax rate) inflation rate You average 10% before-tax annually investing in stocks; howev...
Date Added: 2009-06-26 00:33:31

Studytermsfinal.pdf
Path: New Mexico >> ENG >> 351 Fall, 2009
Description: Dr. Obermeier Final Study Sheet Engl. 351 1. Brief identification of 10 key terms1-2 sentences (see following list) (25%) 2. Analysis of 8 passages from CT starting with Clerk\'s Tale4-5 sentences (40%) 3. An essay question tracing certain concepts ...
Date Added: 2009-06-26 00:33:57

15-Economic Change.ppt
Path: Penn State >> GEOG >> 120 Spring, 2008
Description: The Economy of Cities Outline Economic Transformation Global Economy Background Mass Production and its crisis Understanding the New Economy Implications for Urban Structure Economic Transformation Between 1950 and 1990, dramatic change in economi...
Date Added: 2009-06-26 00:34:28

Butterfly-Links.txt
Path: Santa Clara >> COEN >> 020 Fall, 2009
Description: Atmel AVR Butterfly - Links Atmel AVR Studio 4 (registration required) http:/www.atmel.com/dyn/products/tools_card.asp?tool_id=2725 Butterfly Primer http:/www.dwelch.com/avr/ C Cross Compiler http:/www.chip45.com/PortableWinAVR - Thomas Braunl,...
Date Added: 2009-06-26 00:37:43

Chapter 25 Internet Routing.ppt
Path: CSU LA >> CS >> 245 Fall, 2009
Description: Chapter 25 Internet Routing Static Routing manually configured routes that do not change Used by hosts whose routing table contains one static route describing the network to with the host is attached a default route directs all other traffic t...
Date Added: 2009-06-26 01:06:48

hw6solns.pdf
Path: Cal Poly Pomona >> MAT >> 216 Fall, 2009
Description: Section 2.6 3. y = -y 2 cos x, h = .1, y(0) = 1. We have x0 = 0, x1 = .1, x2 = .2. y1 : k1 = f (0, 1) = -(1)2 cos 0 = -1 (.1)(-1) k2 = f 0 + .05, 1 + = -(.95)2 cos(.05) = -.901372 2 (.1) (-.902499) = -.9107543 k3 = f 0 + .05, 1 + 2 k4 = f (0 + .1, 1 ...
Date Added: 2009-06-26 01:40:56

GeneralConceptsandTerms.pdf
Path: Lake County >> LIS >> 315 Spring, 2009
Description: Grad School of Lib & Info Sci., Univ. of Illinois http:/www.lis.uiuc.edu/ General Concepts and Terms LIS 315 * Spring 2004 Introduction to Networked Systems http:/www.isrl.uiuc.edu/mwolske/lis315/spring04 Martin Wolske mwolske@uiuc.edu 1/26 ? i ...
Date Added: 2009-06-26 01:49:01

Cuphea.pdf
Path: Lake County >> CPSC >> 112 Fall, 2009
Description: ...
Date Added: 2009-06-26 01:57:25

logo_gonzuri.pdf
Path: San Diego State >> ART >> 496 Fall, 2008
Description: ...
Date Added: 2009-06-26 02:08:38

lecture123-brochure-academic.pdf
Path: Seton Hall >> LECTURE >> 123 Fall, 2009
Description: http:/www.lecture123.com The Academic Interactive-Communicator Record, Playback, Collaborate: It\'s That Simple Effective Web Based Information Exchange: Anytime, Anyplace! Lecture123 provides a Just-In-Time Communicator to simplify delivery of learn...
Date Added: 2009-06-26 02:48:59

Exam3F07.pdf
Path: Montana >> WEB >> 105 Fall, 2009
Description: Math 105 Exam 3 Nov 15, 2007 Chapters 2.5 3.5 Name _Instructor name or section # _ 1 20 2 8 3 5 4 3 5 6 6 6 7 8 8 6 9 6 10 6 11 6 12 12 13 8 total 100 Given: Standard form for a quadratic: y = a(x h)2 + k, x= QF: ax2 + bx + c = 0, then b b 2 ...
Date Added: 2009-06-26 03:01:11

psat_ps4_barplots_wrap_base18b_July.pdf
Path: UC Riverside >> CERT >> 308 Fall, 2009
Description: PSAT MAP 1800 1584 1368 1152 936 720 504 288 72 -144 18 12 14 9 4 13 6 2 1 11 3 15 7 15 17 16 16 16 5 10 8 15 -360 -576 -792 -1008 -1224 -1440 -1656 -1872 -2088 -2736 -2304 -1872 -1440 -1008 -576 -144 288 720 1152 1584 2016 2448 Traced Sour...
Date Added: 2009-06-26 03:41:06

rice.ps
Path: UC Davis >> CS >> 120 Fall, 2008
Description: %!PS-Adobe-2.0 %Creator: dvipsk 5.55a Copyright 1986, 1994 Radical Eye Software %Title: rice.dvi %Pages: 1 %PageOrder: Ascend %BoundingBox: 0 0 612 792 %EndComments %DVIPSCommandLine: dvips -o rice.ps rice.dvi %DVIPSParameters: dpi=600, compressed, c...
Date Added: 2009-06-26 03:48:43

hw4.pdf
Path: Duke >> X >> 140 Fall, 2009
Description: CPS 140 Homework 4 Due: Tuesday, Feb. 11 37 points Spring 2003 On homework, you may discuss with other students in the course about how to solve a problem, but the write-up should be your own. You must include the names of any students you consult...
Date Added: 2009-06-26 04:17:29

quiz2.pdf
Path: Bergen CC >> EE >> 244 Fall, 2009
Description: University of California at Berkeley Department of Electrical Engineering and Computer Sciences EE244: Computer Aided Design for Integrated Circuits Take Home Quiz #2 Due Date/Place: 5:00 pm, 11/13 (Friday), 550D Cory Hall Important: Please Type Your...
Date Added: 2009-06-26 05:42:29

EE222Lecture23.pdf
Path: Bergen CC >> EE >> 222 Spring, 2009
Description: ...
Date Added: 2009-06-26 05:44:19

lec36b&w-01.pdf
Path: Bergen CC >> EE >> 100 Fall, 2009
Description: Coil in Magnetic Field T = 2hwN IB cos B B 2h w Rotating Magnetic Field B(t) = BA (t) + BB (t) + BC (t) j!t ^ = B0 xe p 1 3 j!t+2=3 +B0 (- 2 x + p y)e ^ ^ 2 1 3 j!t2=3 +B0 (- 2 x - 2 y)e ^ ^ j!t 3 = B0 e (^ + j y) x ^ 2 3 B0 2 Re B(t) = x cos(...
Date Added: 2009-06-26 05:44:57

Study Guide for text - Linear Algebra And Its Applications - David C Lay - 3rd ed.0108
Path: Penn State >> MATH >> 220 Fall, 2008
Description: ...
Date Added: 2009-06-28 09:44:38

19
Path: Texas >> PHY >> 303L Fall, 2008
Description: Kapoor (mk9499) oldhomework 19 Turner (60230) This print-out should have 11 questions. Multiple-choice questions may continue on the next column or page find all choices before answering. 001 10.0 points A cross section of a long solenoid that ca...
Date Added: 2009-06-28 22:18:20

TTI Data - Atlanta
Path: Georgia Tech >> CEE >> 3000 Spring, 2009
Description: Performance Measure Summary There are several inventory and performance measures listed in the pages of this Urban Area Report for the years from 1982 to 2005. There is no single performance measure that experts agree says it all. The best comparison...
Date Added: 2009-06-29 18:56:33

HW2 2009 Solution
Path: Georgia Tech >> CEE >> 4310 Spring, 2009
Description: CEE 4310 WATER QUALITY ENGINEERING SPRING 2009 Problem 3 Solution CEE 4310 WATER QUALITY ENGINEERING SPRING 2009 Problem 1 Solution For a PF system, VPF = - S Q ln e k S0 For a CM system, VCM S Q 0 - 1 Se = k Taking the ratio of the above...
Date Added: 2009-06-29 19:04:23

Quiz-1_Summer-06
Path: Georgia Tech >> PST >> 3127 Spring, 2009
Description: PST3127 Summer 2006 Your Name: _ Quiz 1 1. Name an agent of enlightenment from The Matrix (or describe the character). 2. What is Plato\'s metaphor (or image) of human society? 3. According to Plato, the newly enlightened philosopher will excel in a...
Date Added: 2009-06-29 19:13:57

ch32
Path: UWO >> ECON >> 1020 Spring, 2009
Description: Trading With The World Patterns and Trends in International Trade Our imports are the goods and services that we buy from people in other countries. Our exports are the goods and services that we sell to people in other countries. The value of e...
Date Added: 2009-06-30 15:29:09

105PS2
Path: Berkeley >> PHYSICS >> 105 Spring, 2009
Description: UNIVERSITY OF CALIFORNIA AT BERKELEY DEPARTMENT OF PHYSICS PHYSICS 105 SPRING SEMESTER 2009 LEROY T. KERTH Problem Set 2 Due February 9, 2009 1. Find the values of needed to make the following transformation orthogonal. #1 0 0 ! ( % ( %0 !...
Date Added: 2009-07-01 04:40:20

07-Grammars-Parsing
Path: University of Illinois, Urbana Champaign >> CS >> CS421 Summer, 2009
Description: CS 421 Lecture 7: Grammars and parsing Announcements MP2 review Lecture outline Context-free grammars Top-down, a.k.a. recursive descent, parsing 6/14/2009 1 Announcements TA office hours I2CS: Tue, Thu 4-5pm CDT On-campus: Wed 4-5pm CDT MP2 solu...
Date Added: 2009-07-01 05:27:12

grammar 2
Path: UF >> CHI >> 3411 Spring, 2009
Description: A B C / h (too far) rather; a bit too* to give it a try h * p * p only h * p A ones, B ones, C ones h * p * p worth it/ not worth it ...
Date Added: 2009-07-01 19:24:37

chapter 15 - 12
Path: NYU >> PSYCH >> V89.0001 Spring, 2009
Description: ...
Date Added: 2009-07-02 18:34:08

ABCs_iteration
Path: Georgia Tech >> CS >> CS 1371 Fall, 2008
Description: function [A A_method B B_method C] = ABCs_iteration(x) % PROBLEM 5. The ABCs of Iteration % % This is a multi-part problem. Do each of the parts below. % % DO NOT CHANGE THE FUNCTION HEADER (the first line of code) % 1) for loops. Below are two fo...
Date Added: 2009-07-06 07:25:21

CHAPTER 1 OUTLINE
Path: Agnes Scott >> MGMT >> 303 Spring, 2008
Description: CHAPTER 1 OUTLINE I. A. MANAGING IN THE NEW ERA The Internet 1. 2. The Internet changes the way management thinks and acts. In the future, one of the most important jobs in your company will be that of chief Web officers. a. The chief Web officer w...
Date Added: 2009-07-06 17:27:19

problem set 2
Path: UC Riverside >> ECON >> 102b Summer, 2008
Description: Econ 102B, Summer Session II, 2008 Problem Set 2 (Due Wednesday, August 13th) 1. Consider an economy with one producer and one consumer. There are two goods: food (F) and labor (L). The production function is given by Fp=3Lp, and the consumer\'s margi...
Date Added: 2009-07-06 20:16:18

Ch 04 - My PPT [F07]
Path: 東京大学 >> MGT >> BAM313 Spring, 2009
Description: Internal Analysis Chapter 04 Prentice Hall, Inc. 2006 5-1 Resource-Based Approach to Organizational Analysis Why within a given industry, some companies do better then the others? Internal strategic factors -Critical strengths and weaknesses tha...
Date Added: 2009-07-06 20:46:26

Chap33
Path: 東京大学 >> BUS >> BAM303 Summer, 2009
Description: Chapter 33 International Finance 2006 Thomson/South-Western 1 Balance of Payments A country\'s balance of payments summarizes all economic transactions that occur during a given period between residents (people, firms, and governments) of that co...
Date Added: 2009-07-06 21:12:06

Sep28EGIV
Path: Brown >> ECON >> 1210 Fall, 2005
Description: Economic Growth: Fundamentals Monday; October 3, 2005 Announcements No Homework due on Thursday No Conferences this Thursday, unless. Homework will be posted on Wednesday Solutions will be posted right away Office Hours: 3pm to 5pm Robinson Coffee ...
Date Added: 2009-07-06 23:15:12

Soln18037
Path: LSU >> CE >> 2460 Spring, 2009
Description: COSMOS: Complete Online Solutions Manual Organization System Chapter 18, Solution 37. (a) H 0 = I x x - I xy y - I xz z i + - I xy x + I y y - I yz z j + - I xz x - I yz y + I z z k = xi + y j + zk 2 2 H 0 = I x x - I xy y x - I xz z x - I x...
Date Added: 2009-07-07 12:10:52

Soln18021
Path: LSU >> CE >> 2460 Spring, 2009
Description: COSMOS: Complete Online Solutions Manual Organization System Chapter 18, Solution 21. = mass per unit length = 1.2 kg/m r = 225 mm = 0.225 m, l = 300 mm = 0.3 m. Moments and products of inertia: Formulas m Upper ring 2 r Ix 1 1 m r2 + r2 + l2 ...
Date Added: 2009-07-07 12:10:53

Soln18030
Path: LSU >> CE >> 2460 Spring, 2009
Description: COSMOS: Complete Online Solutions Manual Organization System Chapter 18, Solution 30. Point of impact: Initial linear momentum of the meteorite, ( kg m/s ) : Its moment about the origin, ( kg m 2 /s ) : rA = ( 2.7 m ) i + ( 0.225 m ) k mv 0 = ...
Date Added: 2009-07-07 12:10:53

project_for_intr.doc
Path: ASU >> MAT >> 272 Fall, 2009
Description: EXERCISES 1. What is the derivative of x x 2. What value of x>0 maximizes f ( x ) = x x . 3. What point on y = - x 2 is closest to what point on y = 5 - 2 x ? At the nearest points, the graphs have the same slope. 4. An ant is walking (to the right) ...
Date Added: 2009-07-08 09:37:06

ENG 214 essay assignment One
Path: Clemson >> ENGL >> 101 Spring, 2009
Description: ENG 214 ESSAY ASSIGNMENT NUMBER ONE General Guidelines: 1. Essays must address the question substantially and in detail. Simply rehashing the plot at length is NOT discussing the question, though you will want at point to summarize aspects of the no...
Date Added: 2009-07-08 16:43:28

Formula_Sheet_2
Path: Cornell >> ECE >> 4300 Fall, 2008
Description: ...
Date Added: 2009-07-09 00:44:36

2_4
Path: WVU >> MAE EE IEN >> mae ee ien Spring, 2009
Description: ...
Date Added: 2009-07-10 13:25:04

5_54
Path: WVU >> MAE EE IEN >> mae ee ien Spring, 2009
Description: ...
Date Added: 2009-07-10 13:26:07

05.08-04_Pulleys_and_Blocks
Path: Texas >> PHY 302K >> 92160 Spring, 2009
Description: ~} o ) |\'r w r|{a$o w yzR v #8 v 2QRR(g xwvusrcq$o A ao 9 ) to p A m k) # nl1 t ! @ 5 7 j b@cS uiUVxw D\" ! geS 5 T T7 S u hf d \"t @ 5 7 s bcS 5 T@ \" 7 U7 S 5 T @ 5 7 s bcS 8 t \"t 5 T@ 9 # t @ 5 7 s b@ S 8 t ! \" 5 9# T T 5 \" @ b@ S 8 t 9...
Date Added: 2009-07-11 01:42:32

ShraddhaOutline
Path: Dominican >> CIS >> MA324 Spring, 2009
Description: Outline Template for Persuasive Presentation I. Introduction A. Shraddha Thakkar B. Talk about the invention and progress brief C. Persuade the audience who are reluctant to use of the internet I. fast and effective communication II. ease of u...
Date Added: 2009-07-12 21:08:48

Sec 14.3-sm.dvi copy
Path: UIllinois >> MATH >> 210 Spring, 2009
Description: 636 C H A P T E R 15 D I F F E R E N T I AT I O N I N S E V E R A L VA R I A B L E S (ET CHAPTER 14) 2 0 -2 -1 x -2 0 1 2 -2 -1 0 y 1 2 z The graph supports our result in part (a). xy : For g(x, y) = 2 x + y2 if a + b 2. In particular the limit...
Date Added: 2009-07-15 11:54:50

Sec 14.3-sm.dvi copy
Path: UIllinois >> MATH >> 210 Spring, 2009
Description: 636 C H A P T E R 15 D I F F E R E N T I AT I O N I N S E V E R A L VA R I A B L E S (ET CHAPTER 14) 2 0 -2 -1 x -2 0 1 2 -2 -1 0 y 1 2 z The graph supports our result in part (a). xy : For g(x, y) = 2 x + y2 if a + b 2. In particular the limit...
Date Added: 2009-07-15 12:09:00

Quiz 09 Posted Answers
Path: USC >> BISC >> 220 Spring, 2009
Description: Quiz 09 Covers lectures 26, 27, 28: Mar 23 (start of Gas Exchange) through Mar 27 (Cellular Defenses) Posted: Friday, March 27, 1 pm Deadline: Wednesday, April 1, 6 am 1. Which one of the following will increase the partial pressure of oxygen in the ...
Date Added: 2009-07-15 20:15:57

chapter6
Path: UC Davis >> WLD41C >> 020 Fall, 2008
Description: Chapter 6 Chemical Nomenclature Presentation Slides to Accompany Cracolice/Peters Introductory Chemistry: An Active Learning Approach, Third Edition Copyright 2007 Brooks/Cole, a part of the Thomson Section 6.1 Introduction to Nomenclature Pres...
Date Added: 2009-07-21 23:56:37

Ch_322a_6.017
Path: USC >> CHEM >> 322AL Summer, 2009
Description: These two mechanisms of nucleophilic substitution are always potentially available as modes of reaction for a substrate. For some RX compounds, only one mechanism dominates, but for others the two mechanisms are competitive. Competing SN1 and SN2 Re...
Date Added: 2009-07-22 20:30:05

Goldstein+ES+10+Spring+2008+Guest+Lecture+-+Tropospheric+Ozone
Path: Berkeley >> ES >> 10 Fall, 2008
Description: The World of Air Pollution: A CALifornia Perspective Professor Allen Goldstein Chair, Department of Environmental Science, Policy and Management y g University of California, Berkeley Tropospheric Air Pollution -US Regions With Maximum Pollution (C...
Date Added: 2009-07-22 21:36:03

Dead+Zones
Path: Berkeley >> ES >> 10 Fall, 2008
Description: The Dead Zone: Hypoxia in the Gulf of Mexico What is the dead zone? Condition that occurs in coastal waters where: Little or no oxygen is present Little or no marine life can survive The term for low oxygen is hypoxia. Hypoxia=<2 mg/l dissolved ...
Date Added: 2009-07-22 21:43:54

lecture 1 2009
Path: Berkeley >> ESPM >> 114 Spring, 2009
Description: Sperm Whale (Physeter macrocephalus) Right Whale (Eubalaena glacialis) Africa\'s World of Forced Labor, in a 6-Year-Old\'s Eyes (NYT, Nov 2006) ESPM 114 Individuals (habitat selection and use, behavior) Populations (growth, monitoring, control) C...
Date Added: 2009-07-22 22:59:28

Ch 16 Endocrine System
Path: UMSL >> BIOL >> 1141 Summer, 2009
Description: Ch. 16: The Endocrine System The Nervous System and the Endocrine System together act to direct the maintenance of homeostasis in other words, to control internal conditions. Control by the Nervous System is rapid, localized (via nerve impulse trans...
Date Added: 2009-07-23 15:25:11

PotentialEnergy
Path: Cosumnes River College >> PHY >> 092342 Spring, 2009
Description: Potential Energy Conservative and Dissipative Forces Before moving on to the second type of energy, let us look at conservative and dissipative forces. Recall that we defined the work to be W = F dx x1 x2 What would happen if we then traversed a...
Date Added: 2009-07-24 21:30:31

Nutritional_Supplements___Hot_Topic
Path: LSU >> 3534 >> 3535 Spring, 2009
Description: Nutritional Supplements Douglas S. Kalman, MS, RD, CCRC, FA This paper was presented as part of the NSCA Hot Topic Series. All information contained herein is copyright of the NSCA. www.nsca-lift.org Hot Topics: Nutritional Supplements Dietary Su p...
Date Added: 2009-07-26 22:45:30

w4_Meeting_Mintues
Path: DeVry Cincinnati >> BIS >> 261 Fall, 2008
Description: Joined on November 19, 2008 at 8:50 PM Joined on November 19, 2008 at 10:21 PM Me: Kicked me out Damon Amerson: Ryan said he would do the invitation memo and i can record the minutes of the JAD Me: I already started them Damon Amerson: ah ok Ryan Dev...
Date Added: 2009-07-27 15:01:28

395.Nectow.v.Cambridge
Path: Rutgers >> 220 >> 395 Spring, 2009
Description: Saul M. Nectow v. City of Cambridge Supreme Judicial Court of Massachusetts 260 Mass. 441; 157 N.E. 618 January 17, 1927, Argued July 1, 1927, Decided PRIOR HISTORY: Bill in equity, filed in the Supreme Judicial Court for the county of Suffolk on Dec...
Date Added: 2009-07-27 15:15:17

chp5
Path: NYU Poly >> PHYSICS >> 101 Spring, 2009
Description: CHAPTER 5 FORCE AND MOTION ActivPhysics can help with these problems: All activities in Section 2, Forces and Motion Section 5-4: Newton\'s Second Law Problem 1. A subway train has a mass of 1.5x106 kg. What force is required to accelerate the train a...
Date Added: 2009-07-27 22:35:08

chp5
Path: Adelphi >> PHY >> 557 Spring, 2009
Description: CHAPTER 5 FORCE AND MOTION ActivPhysics can help with these problems: All activities in Section 2, Forces and Motion Section 5-4: Newton\'s Second Law Problem 1. A subway train has a mass of 1.5x106 kg. What force is required to accelerate the train a...
Date Added: 2009-07-27 23:12:49

midterm-03-f
Path: Waterloo >> MATH >> math137 Spring, 2007
Description: ...
Date Added: 2009-07-28 22:09:33

Cell Signaling during Cold, Drought, and Salt Stress.
Path: A.T. Still University >> 231 >> 224-12 Spring, 2006
Description: The Plant Cell, S165S183, Supplement 2002, www.plantcell.org 2002 American Society of Plant Biologists Cell Signaling during Cold, Drought, and Salt Stress Liming Xiong, Karen S. Schumaker, and Jian-Kang Zhu1 Department of Plant Sciences, Universit...
Date Added: 2009-08-01 02:42:30

QuizQuestion
Path: Dominican >> AC555 >> AC555 Spring, 2009
Description: 3 A firm has the following balance sheet: Forecast Cash $ 10 Accounts payable Accounts receivable 10 Notes payable Inventory 10 Long-term debt Fixed assets 72,72.4,90 Common stock Retained earnings Total assets $120 Total liabilities and equity $ 1...
Date Added: 2009-08-01 14:47:17

02010_ch10
Path: Penn State >> IST >> 210 Summer, 2009
Description: Database Systems: Design, Implementation, and Management Eighth Edition Chapter 10 Transaction Management and Concurrency Control Objectives In this chapter, you will learn: About database transactions and their properties What concurrency contr...
Date Added: 2009-08-02 11:39:18

chap006
Path: Rutgers >> ACCT >> Intermedia Spring, 2009
Description: Chapter 6 Time Value of Money Concepts AACSB assurance of learning standards in accounting and business education require documentation of outcomes assessment. Although schools, departments, and faculty may approach assessment and its documentation...
Date Added: 2009-08-04 20:02:06

PS5_solution
Path: Berkeley >> ECON >> 140 Summer, 2009
Description: 1 Problem Set 5 Solutions by Edson Severnini 1. Using the GRETL prepackaged data set Ramathan data 7.14, Homicide across States, complete the following. Variables are those as defined by the GRETL descriptive label. a. Estimate and report OLS param...
Date Added: 2009-08-06 12:04:31

PS5_solution
Path: Berkeley >> ECON >> 140 Spring, 2008
Description: 1 Problem Set 5 Solutions by Edson Severnini 1. Using the GRETL prepackaged data set Ramathan data 7.14, Homicide across States, complete the following. Variables are those as defined by the GRETL descriptive label. a. Estimate and report OLS param...
Date Added: 2009-08-06 12:07:04

BU204_Krugman_Chapter 02
Path: Kaplan University >> BU204 >> BU204 Summer, 2009
Description: chapter 2 > Economic Models: Trade-offs and Trade TUNNEL VISION I that N 1901 WILBUR AND ORVILLE WRIGHT hoping it will fly. More generally, models play a crucial role in almost all scientific research-economics very much included. In fact, yo...
Date Added: 2009-08-06 22:10:40

chem lecture 4
Path: UCSD >> CHEM >> 6A Spring, 2009
Description: From the assigned reading, which topic did you find the most challenging to digest? A. B. C. D. E. Blackbody radiation Photoelectric effect Atomic line spectra Wavefunctions and orbitals None; I didn\'t do the reading Chemistry 6A 1 Key Concepts & ...
Date Added: 2009-08-07 18:20:13

2002 CBS Casebook_6
Path: Acton School of Business >> CBS >> casebook Spring, 2009
Description: PD PD F- XC h a n g e Vi e w F- XC h a n g e Vi e w er er ! O W N y bu to k lic C m C lic k to bu y N .c O W w .d o c u -tr a c k ! w o .d o c u -tr a c k .c Implementation/Information Technology This takes the str...
Date Added: 2009-08-08 16:08:41

2002 CBS Casebook_20
Path: Acton School of Business >> CBS >> casebook Spring, 2009
Description: PD PD F- XC h a n g e Vi e w F- XC h a n g e Vi e w er er ! O W N y bu to k lic C m C lic k to bu y N .c O W w .d o c u -tr a c k ! w o .d o c u -tr a c k .c him if he had any leadership experience. The man thought...
Date Added: 2009-08-08 16:09:56

Bio2 Lecture 18
Path: Rutgers >> BIO >> 102 Spring, 2009
Description: Bio2 Lecture 18 3/29/05 Review for Exam II April 3 (Sunday) 2-4 pm Hickman 138 First 30 min: Dr. Katz Middle 30 min: Excretion Lecture Last 60 min: mock exam 20 questions Bring bio questions Test up until this lecture Immune Response (Complex and Sop...
Date Added: 2009-08-10 16:00:16

right.txt
Path: CSU Channel Islands >> MATH >> 226 Fall, 2009
Description: 4.339370324625246E-004 1.580644916958672E-002 1.899277842927157E-002 -1.837167407108128E-004 -2.980401548794735E-002 -6.990951010286215E-003 -2.081490897589564E-002 3.517909760463509E-002 4.627884785603918E-002 2.935647063622220E-002 3.4801...
Date Added: 2009-08-10 19:49:33

nikhil93overview.pdf
Path: Glasgow Caledonian University >> CS >> 257 Fall, 2009
Description: a `Y QS Q V TS I R Q P I E G FE C # @ 8 64 2 U\"HH9AH7AD oI\"AgSc otvgpSA)Ulpl!opqSeSAQp)qv&toS 8p)!IlpnAmqS )tet 0eA)Tc)cTceUc8pceAo vcpUcTi...
Date Added: 2009-08-10 19:50:38

set First Amendment Cases-student.doc
Path: Penn State >> JLG >> 484 Fall, 2009
Description: First Amendment Cases - Expression FIRST AMENDMENT Congress shall make no law respecting an establishment of religion, or prohibiting the free exercise thereof; or abridging the freedom of speech, or of the press; or the right of the people peaceably...
Date Added: 2009-08-10 19:51:09

topic08.pdf
Path: SMU - Cox School of Business >> EMIS >> 8361 Fall, 2009
Description: Helgason EMIS 8361 Spring 2006[Topic 08] 1 Helgason EMIS 8361 Spring 2006[Topic 08] 2 Standard Particulars Notation Loan Processes The conventional loan is based on economic equivalence. The details of the loan agreement are called the loan par...
Date Added: 2009-08-10 19:53:04

brmot.ps
Path: Duke >> STA >> 294 Fall, 2008
Description: %!PS-Adobe-2.0 %Creator: dvips(k) 5.92b Copyright 2002 Radical Eye Software %Title: brmot.dvi %Pages: 25 %PageOrder: Ascend %BoundingBox: 0 0 612 792 %DocumentFonts: CMBX10 CMR10 CMSL10 CMMI10 CMMI7 CMSY10 CMR7 CMSS10 %+ CMEX10 CMSY7 CMR5 CMTI10 CMMI...
Date Added: 2009-08-10 19:53:43

hw3.pdf
Path: Berkeley >> ASTRO >> 202 Fall, 2009
Description: Homework #3 1. Polytropes a) The mass M of a star is given by R M= 0 4r2 (r)dr Use the Lane-Emden equation for polytropes to rewrite this in terms of the central density as c = an = 3M 4R3 an where an , the ratio of the central density to the me...
Date Added: 2009-08-10 19:53:50

Lehr and Simecek-Beatty (2004) Comparison of hypothetical LNG.pdf
Path: Maryville MO >> OCE >> 495 Fall, 2009
Description: Journal of Hazardous Materials 107 (2004) 39 Comparison of hypothetical LNG and fuel oil fires on water William Lehr , Debra Simecek-Beatty National Oceanic and Atmospheric Administration, Office of Response and Restoration, 7600 Sand Point Way NE, ...
Date Added: 2009-08-10 19:54:04

Mercury Marine problem.ppt
Path: Mich Tech >> MSE >> 3110 Fall, 2009
Description: Mercury Marine Problem Basically what we are doing here is we are gluing a rubber seal on a painted aluminum part. It is sometimes difficult to keep the seal in place during the curing process, so our solution was to glue the seal on the part and th...
Date Added: 2009-08-10 19:54:10

YNL317W.t2k.dssp-ehl2-logo.pdf
Path: UCSC >> YNL >> 317 Fall, 2009
Description: YNL317W.t2k DSSP-EHL2 2 1 CC 1 C C C C H C C C C C C C C C C C C H H H C H H H H H H H H X X X X X X X X X X X X X X X X X X X X X X 10 20 30 40 H 2 1 H T S E EEEEECCCCC CCCCCE X X X X X X E E H X X X X CC CEECCCCCCCC E X X X X X X X X ...
Date Added: 2009-08-10 19:54:56

ece406spr09_19_2up.pdf
Path: N.C. State >> ECE >> 406 Fall, 2008
Description: ECE 406 Design of Complex Digital Systems Lecture 19: Cache Operation Xun Liu W. Rhett Davis NC State University Spring 2009 ...
Date Added: 2009-08-10 19:56:09

HeatEngine.doc
Path: Alabama >> PH >> 101 Fall, 2008
Description: A heat engine and the first law of thermodynamics Names_ We\'ll make up a heat engine that consists of 4 steps, 2 at constant volume (isochoric) and 2 at constant pressure (isobaric). One mole of a monatomic ideal gas will undergo this cycle. This isn...
Date Added: 2009-08-10 19:56:53

Exp_Crystallization.pdf
Path: Rio Hondo College >> CHEM >> 230 Fall, 2008
Description: Experiment No. and Title:#3 Crystallization Required Reading: Techniques 8-11 in Pavia (p. 645-698) skip the following sections: 8.7, 8.8, 9.6 Important Notes: In part A of the experiment we will use benzoin instead of sulfanilamide. Instead of using...
Date Added: 2009-08-10 19:59:03

rapoff.pdf
Path: University of Illinois, Urbana Champaign >> AE >> 598 Fall, 2008
Description: ARTICLE IN PRESS Journal of Biomechanics 36 (2003) 15111521 Understanding stress concentration about a nutrient foramen . Nils Gotzena, Alan R. Crossb, Peter G. Ifjuc, Andrew J. Rapoffc,* a Biomechanics Section, Technical University Hamburg-Harburg...
Date Added: 2009-08-10 20:00:15

SumsOfIntegers.pdf
Path: UNC Asheville >> MATH >> 280 Fall, 2009
Description: MATH 280, Section 1 Foundations of Mathematics Spring 2009 What\'s going on? What fact(s) do the computations below suggest to you? You might want to think about what different kinds of integers there are. 1+2=3 1+4=5 1+6=7 6+1=7 4+3=7 24 + 13 = 37 7...
Date Added: 2009-08-10 20:00:45

Amanda_Assignment4.doc
Path: Penn State >> IST >> 421 Fall, 2008
Description: Amanda Mack Assignment 4 Lend/Borrow Item 10/02/07 : Student Log in Textbook Password Verification Display Search Textbox Display Availability Download Button Open Document Log Out Button 1. Visits Textbook Website 2. Enters...
Date Added: 2009-08-10 20:00:49

Meadowlark_Retarders_principles.pdf
Path: Arizona >> OPTI >> 471 Fall, 2009
Description: Polarizers PRINCIPLES OF RETARDERS R etarders are used in applications where control or analysis of polarization states is required. Our retarder products include innovative polymer and liquid crystal materials. Crystalline materials such as qua...
Date Added: 2009-08-10 20:00:53

assignment3.pdf
Path: Penn State >> KJV >> 123 Fall, 2009
Description: ...
Date Added: 2009-08-10 20:01:56

The Baltic Sea Notes.doc
Path: East Los Angeles College >> BIOL >> 367 Fall, 2009
Description: vti_encoding:SR|utf8-nl vti_author:SR|rickl vti_timecreated:TR|19 Mar 2003 09:56:33 -0000 vti_timelastmodified:TR|13 Apr 2005 09:20:50 -0000 vti_title:SR|The Baltic Sea vti_assignedto:SR| vti_approvallevel:SR| vti_extenderversion:SR|6.0.2.5516 vti_ba...
Date Added: 2009-08-10 20:03:45

101MSJc9.pdf
Path: LA Tech >> CHEM >> 101 Fall, 2009
Description: CHEM 101 CLASS NOTES & PROBLEMS Prof. Upali Siriwardane, Chemistry Program, Louisiana Tech University, Ruston, LA 71272. CHAPTER 9 Chapter 9. Molecular Structures. 9.1 Using Molecular Models 9.2 Predicting Molecular Shapes: VSEPR 9.3 Orbitals Consist...
Date Added: 2009-08-10 20:03:50

cs1_2.pdf
Path: Hofstra >> CSC >> 015 Fall, 2009
Description: Chapter 2, Part I Object-Oriented Programming Elements of High-Level Languages Java Topics High level progra m m ing languages, OOP Elements of Java: data, data types, expressions, type conversions w Classes and objects (System, String) w w w w w ...
Date Added: 2009-08-10 20:07:32

(18) Part 1- Plasmid BY431 S2008.pdf
Path: UAB >> BY >> 431 Fall, 2009
Description: 1 Plasmid Vectors (E. coli) 5\' 3\' Promoter Probe Plasmid Vector Example: pCB267 (7.7 kbp); Amp resistance gene (-lactamase); phoA (Alkaline phosphatase) and lacZ\' (-peptide for the -galactosidase enzyme); colE1 origin or replication; copy number 2...
Date Added: 2009-08-10 20:09:09

page27.doc
Path: UT Chattanooga >> ENCH >> 435 Fall, 2009
Description: 5. Note that the power peaks at around 0.4 V to 0.45 V. Discuss at what potential it is best to operate the fuel cell at in terms of fuel efficiency and economics (system cost versus operating cost). Does it make sense to operate beyond the peak powe...
Date Added: 2009-08-10 20:11:23

Distillation Assignment Rot. 1a.doc
Path: UT Chattanooga >> ENCH >> 435 Fall, 2009
Description: vti_encoding:SR|utf8-nl vti_timelastmodified:TR|10 Oct 2005 20:33:09 -0000 vti_extenderversion:SR|5.0.2.6417 vti_author:SR|JIMHENRY\\jim vti_modifiedby:SR|JIMHENRY\\jim vti_timecreated:TR|10 Oct 2005 20:33:09 -0000 vti_cacheddtm:TX|10 Oct 2005 20:33:09...
Date Added: 2009-08-10 20:11:46

david.txt
Path: UT Chattanooga >> ENCH >> 435 Fall, 2009
Description: vti_encoding:SR|utf8-nl vti_timelastmodified:TR|16 Sep 2002 14:30:37 -0000 vti_extenderversion:SR|4.0.2.7802 vti_cacheddtm:TX|16 Sep 2002 14:30:37 -0000 vti_filesize:IR|2091 ...
Date Added: 2009-08-10 20:11:50

Please Be Patient.pdf
Path: Wisc Stevens Point >> AOSEG >> 540 Fall, 2009
Description: Please Be Patient, Under Construction ...
Date Added: 2009-08-10 20:12:37

99groups.pdf
Path: Clemson >> LIT >> 209 Fall, 2009
Description: U E.K.Sparks Fall 1999 2:30 3:45 MW Martin 104 Engl 209 Groups for Fall 1999 Assignment: Everyone must participate in two groups during the semester. Each group is responsible for reading the class listserv on their topic, excerpting the best of wha...
Date Added: 2009-08-10 20:13:20

WS9.2.pdf
Path: SWCCD >> MATH >> 251 Fall, 2009
Description: MATH 251/GRACEY 1. Find the first 5 terms of the sequence of partial sums. a. 9.2 1 1 1 1 1 + + + + +L 2 4 8 16 b. ( -1) n! n =1 n +1 2 2. Graph the first 10 terms of the sequence of partial sums given by 3 n =0 n by hand and then che...
Date Added: 2009-08-10 20:13:59

Chapter 4 solutions part 2.pdf
Path: Western Michigan >> HOMEPAGES >> 113 Fall, 2009
Description: ...
Date Added: 2009-08-10 20:14:05

LCP_LCA_F06a_T02_V2.01.pdf
Path: USC >> CSCI >> 577 Fall, 2009
Description: Life Cycle Plan (LCP) Version 2.01 Life Cycle Plan (LCP) California Science Center Event RSVP System Team 02 Ravneet Sahni Anupama Premjani Chitra Gulabrani Chien-Ju Hung Wen-Hsin Hsieh Ya-Chen Lee Project Manager Operational Concept Engineer Lif...
Date Added: 2009-08-10 20:16:40

homework14.pdf
Path: New Mexico >> PHYS >> 406 Fall, 2009
Description: Phys 406 Electricity and Magnetism II Fall 2008 Due Monday, December 15 (at 5:00 pm) Homework Assignment #14 (20 points) 14.1 (10 points) Griffiths 12.46 14.2 (10 points) Challenge problem. 1 ...
Date Added: 2009-08-10 20:18:10

hw10sol.ps
Path: Duke >> STA >> 104 Summer, 2008
Description: %!PS-Adobe-2.0 %Creator: dvips(k) 5.86 Copyright 1999 Radical Eye Software %Title: hw10sol.dvi %Pages: 6 %PageOrder: Ascend %BoundingBox: 0 0 612 792 %DocumentFonts: Helvetica %EndComments %DVIPSWebPage: (www.radicaleye.com) %DVIPSCommandLine: dvips ...
Date Added: 2009-08-10 20:18:14

mid1.pdf
Path: Washington >> CS >> 451 Fall, 2009
Description: CSE 451 Midterm 1 Name: _ 1. [2 points] Imagine that a new CPU were built that contained multiple, complete sets of registers each set contains a PC plus all the other registers available to user programs. The new CPU also contains a single new re...
Date Added: 2009-08-10 20:18:58

22-gsecurity.pdf
Path: Washington >> CS >> 451 Fall, 2009
Description: Outline CSE 451: Operating Systems Spring 2005 Module 22 Security \"Classic\" security topics goal: safe sharing general principles Trusted Computing Base (TCB) Contemporary security problems worms spyware 6/1/2005 2005 Gribble, Lazowska, Le...
Date Added: 2009-08-10 20:19:17

section4.ppt
Path: Washington >> CS >> 451 Fall, 2009
Description: Reminders Homework 3 due next Monday Project 2 parts 1,2,3 due next Wednesday Synchronization Office hour at 3:30, not 4:30 today Today: Threads, synchronization Project 2 continued (parts 2,3) Synchronization 1 Project 2 Part 1 Q...
Date Added: 2009-08-10 20:19:48

MC.doc
Path: UVA >> FACULTY >> 053 Fall, 2009
Description: Melissa Chambers (Berry) November 23, 2005 CMS\'s 75 Percent Rule: Financial Analysis of Proposed Changes Healthcare coverage and associated costs are a topic of concern among healthcare providers, politicians, and the general public. Of greatest conc...
Date Added: 2009-08-10 20:22:12

hw4_soln.pdf
Path: Michigan >> PERSONAL >> 217 Fall, 2009
Description: Math 217 Homework Fall 2007 5J~ Problem set #4 due Monday, Oct. 8th in class Sect. 3.1 3.2 3.3 2.6 1 Page Warm-up problems 1,9-10,15-16,21,29-30 7,15-18,25,27,35,39 1,7,11,18,27,31 1-3 Problems to hand in 1190 1199 209 156 4 - ~\\} j, dd ~ -/ ...
Date Added: 2009-08-10 20:22:23

501Quiz_7_Version_A_key.pdf
Path: SUNY Stony Brook >> HBY >> 350 Fall, 2008
Description: HBY501 Physiology Quiz #7, November 14, 2008 On the Scantron answer sheet, completely blacken the bubble (using a number 2 pencil) in the \"test form\" field indicating that this is test form A. Then, indicate your responses by filling in the bubble ...
Date Added: 2009-08-10 20:22:50

Alcohols.pdf
Path: Western Michigan >> CHEM >> 375 Fall, 2009
Description: JJ Kiddle Drop -e ending off of parent alkane name and add -ol. Alcohol Nomenclature Practice Problems CHEM 3750 Please provide an IUPAC name for each of the following structures. Also, indicate whether the alcohol is primary, secondary, or tertia...
Date Added: 2009-08-10 20:23:07

04-CommunicationsTechniques.pdf
Path: UC Davis >> ECS >> 152 Fall, 2009
Description: ECS 152A 4. Communications Techniques Asynchronous and Synchronous Transmission Timing problems require a mechanism to synchronize the transmitter and receiver Two solutions -Asynchronous -Synchronous Asynchronous Data transmitted on character a...
Date Added: 2009-08-10 20:23:25

WQ2006.doc
Path: Washington >> COMPLIT >> 300 Fall, 2009
Description: <?xml version=\"1.0\" encoding=\"UTF-8\"?> <Error><Code>NoSuchKey</Code><Message>The specified key does not exist.</Message><Key>263e9792930b396ac1c620fd1602c8e74012827b.doc</Key><RequestId>C A156ACE4E4BDB25</RequestId><HostId>0dW372YKKhQwpvjbKVyJ2CMEaM3...
Date Added: 2009-08-10 20:23:31

08_storage.ppt
Path: Kentucky >> CS >> 505 Fall, 2008
Description: Instructor: Jinze Liu Fall 2008 Jinze Liu @ University of Kentucky 06/22/09 2 Jinze Liu @ University of Kentucky 06/22/09 3 It\'s all about disks! That\'s why we always draw databases as And why the single most important metric in database pr...
Date Added: 2009-08-10 20:25:22

3103_Trucks2007.pdf
Path: Georgia Tech >> ISYE >> 3103 Fall, 2008
Description: Motor F i ht T M t Freight Transportation t ti U.S. Mode Shares, 1993 Modal Profile Percent Hauled Based on Value Modal Profile Percent Hauled Based on Volume . Truck 72.60% Rail 4.00% Water 3.90% Intermodal 10.40% Air Freight 2.40% Pipeline 2.80...
Date Added: 2009-08-10 20:25:35

Chap3_Sec4.pdf
Path: Fayetteville State University >> MAC >> 2311 Fall, 2009
Description: CHAIN RULE It seems plausible if we interpret derivatives as rates of change. Regard: du/dx as the rate of change of u with respect to x dy/du as the rate of change of y with respect to u dy/dx as the rate of change of y with respect to x If u change...
Date Added: 2009-08-10 20:25:38

unit1c6.ppt
Path: Colgate >> GEOG >> 210 Fall, 2009
Description: Transnational Corporations and States Costs and benefits to: host economies home economies the bargaining relationship between TNCs and states TNC impacts on host economies Alternative perspectives empirical findings Why? -sensitivity to pre...
Date Added: 2009-08-10 20:25:45

Ex41999SOL.pdf
Path: Acton School of Business >> CHEM >> 211 Fall, 2009
Description: C hem . 211 D ec. 1, 1 999 N am e_ _ _ _ _ _ _ _ _ _ _ _ _ Ex am N o. 4 Pledge_ _ _ _ _ _ _ _ _ _ _ _ _ _ __ _ _ _ _ _ _ _ _ _ _ 1. (21 points) Sho w a m e tho d to acc om plish the follow in g m ulti-step transform ations using the given com po und...
Date Added: 2009-08-10 20:25:46

2025-L21.pdf
Path: Georgia Tech >> ECE >> 2025 Fall, 2008
Description: EE-2025 Spring-2000 Info: Web-CT, Lab, HW Calendar: Final Exam Period 5, Tues, 2-May Review on Monday nite, 1-May Lecture 21 Sampling and Reconstruction 10-April-00 Reading Assignment: Ch 13 of Notes. Prob Set #11 - due this week Lab #10 du...
Date Added: 2009-08-10 20:25:48

finalf04.pdf
Path: Portland >> CS >> 581 Spring, 2008
Description: CS 581: Theory of Computation Final exam James Hook December 6, 2004 This is a closed-book, closed-notes, in-class exam. Please do not consult any resources when preparing your answer. If you have questions ask the exam proctor. 1. [20 points] We hav...
Date Added: 2009-08-10 20:27:17

cis111OLSylS09.pdf
Path: Fullerton College >> CIS >> 111 Fall, 2009
Description: CIS 111 Online - CRN 23079 updated 1/11/09 (Please check on a regular basis for updates) Instructor: Nancy Woolridge Phone: (714) 992-7224 Office: 511-01 Email: nwoolridge@fullcoll.edu or MyITLab mail for the class Instructor Web Site: http:/staffwww...
Date Added: 2009-08-10 20:27:24

syll211.pdf
Path: Whatcom Community College >> CIS >> 211 Fall, 2009
Description: Grays Harbor College Syllabus CIS 211 Computer User Support for Helpdesks 5 Credits (3 Lecture/4 Lab Hrs) Winter Quarter 2009 General Course Information Instructor: Sandy Lloyd Office: Room 218 Office Hours: drop in Campus Phone: ...
Date Added: 2009-08-10 20:27:29

CreatingConsoleApplication.pdf
Path: Fullerton College >> CSCI >> 123 Fall, 2009
Description: Creating C+ Console Application in Visual Studio 2005 By: Brad Rippe Fullerton College 1/12/2007 This work is licensed under the Creative Commons Attribution 2.5 License. To view a copy of this license, visit http:/creativecommons.org/licenses/by/2....
Date Added: 2009-08-10 20:27:43

exam2F09.pdf
Path: CUNY Baruch >> CIS >> 228 Fall, 2009
Description: Exam II CIS 228: The Internet Prof. St. John Lehman College City University of New York 7 November 2007 NAME (Printed) NAME (Signed) E-mail Exam Rules Show all your work. Your grade will be based on the work shown. The exam is closed book and clos...
Date Added: 2009-08-10 20:28:02

requirements-overviewA.rtf
Path: DePaul >> PPT >> 394 Fall, 2009
Description: Requirements Overview What are requirements - the practical details. Some general ideas to guide creativity The requirements data At DPU requirements should be covered prior to CSC394/376. Most students do not have a good working grasp of requi...
Date Added: 2009-08-10 20:30:02

session22.pdf
Path: Alabama >> COM >> 500 Fall, 2008
Description: National Communication Association Welcome: View Paper Session Session Much of the information on this page is clickable. For example, clicking on a person\'s name will display all of that person\'s participations in the program. Author names preceded...
Date Added: 2009-08-10 20:30:14

AGENDA 11_14.doc
Path: Utah State >> ECE >> 5800 Fall, 2008
Description: 12:30 EN-307 AGENDA Electromagnetics ECE 5800 Friday, 14 November 2008 Renewable sources of electrical energy Sun power Fields and power of sunlight Turn in Friday the 14th Problems Problem 34- Waves in matter Problem 35- Lossy media In cl...
Date Added: 2009-08-10 20:31:16

HW2.pdf
Path: Arizona >> ECE >> 430 Fall, 2008
Description: ECE/OPTI 430/530 HW #2 Assigned: 2/6/09 Due: 2/20/09 1. Generate values for J2(x) and K2(x) using exact analytical formula and plot for values of x ranging from 0-10. Compare these values to those obtained with the approximate relations discussed in...
Date Added: 2009-08-10 20:31:24

day_4.pdf
Path: Portland >> CS >> 586 Fall, 2008
Description: Day 4 CS586 Fall 2004 Introduction to Database Management Systems Sid Kitchel Plan of the Day Questions Data Modeling The Entity-Relationship Model The Relational Model 10/17/04 C586 Day 4 2 Modeling What is modeling? Producing a control...
Date Added: 2009-08-10 20:32:25

Leaf.pdf
Path: Bellevue College >> BIOLOGY >> 213 Fall, 2009
Description: The Leaf Leaves are the main appendages of the stem, and in most vascular plants, the principal structure for photosynthesis. Leaves vary tremendously in form and internal structure. Some of the variation in leaf structure is related to habitat. Aqua...
Date Added: 2009-08-10 20:32:39

Leaf.pdf
Path: Whatcom Community College >> BIOLOGY >> 213 Fall, 2009
Description: The Leaf Leaves are the main appendages of the stem, and in most vascular plants, the principal structure for photosynthesis. Leaves vary tremendously in form and internal structure. Some of the variation in leaf structure is related to habitat. Aqua...
Date Added: 2009-08-10 20:32:45

astrobiology.pdf
Path: Washington >> ASTRO >> 150 Fall, 2009
Description: Question Answer Question 1: The SETI Institute has been continuing its search for message from outer space, its search for extraterrestrial intelligence. Trick question: all of the above are either underway or planned. Which of the following projects...
Date Added: 2009-08-10 20:33:50

intervapnd195.pdf
Path: Penn State >> VIEW >> 195 Fall, 2009
Description: Appendix 1: Interval File Recode Specifications (B) Pregnancy and Interval-Specific Recodes (Section B) VAR225: \"Pregnancy outcome\" (OUTCOME) (1988 NSFG=VAR994) This recode assigns a single outcome code to each pregnancy, even if the pregnancy had m...
Date Added: 2009-08-10 20:34:45

BIOL_4960_syl_S06.pdf
Path: CSU Stanislaus >> B >> 4960 Fall, 2009
Description: BIOL 4960: Biology Colloquium Dr. Terry D. Jones S 246 tdjones@science.csustan.edu Dr. Ken Schoenly S 143 kgschoenly@biology.csustan.edu Spring 2006 \"Nothing in biology makes sense except in the light of evolution.Seen in the light of evolution, bi...
Date Added: 2009-08-10 20:34:54

PracticeMidterm1.pdf
Path: SUNY Stony Brook >> MAT >> 200 Fall, 2008
Description: LANGUAGE, LOGIC AND PROOF. PRACTICE MIDTERM 1 Name: USB ID: (1)[20 points] Construct the truth table for the following proposition: P Q (P Q) Solution: P Q Q P Q Q (P Q) P Q (P Q) T T F T F F T F T F F F T F T F T F F F T T T T (2)[20 p...
Date Added: 2009-08-10 20:34:56

comp343-revision.pdf
Path: Allan Hancock College >> COMP >> 343 Fall, 2009
Description: COURSE REVISION COMP343 Cryptography and Information Security 1 / 20 Exam Tips Prioritize your tasks: Time is limited and goes FAST. Read the whole assignment and attempt questions you know the answers to FIRST. Earn marks: Computation mistakes are...
Date Added: 2009-08-10 20:35:03

exam2d_key.pdf
Path: Ill. Chicago >> CHEM >> 112 Fall, 2008
Description: Chemistry 112 2nd Hour Exam (D) KEY October 19, 2001 Dr. Cindy Harwood Each of the following multiple choice questions is worth 3 points. Please circle your answers. 1. What is the general valence-shell ground-state electron configuration of the ...
Date Added: 2009-08-10 20:35:09

hw2.pdf
Path: Utah >> ECE >> 5530 Fall, 2008
Description: UNIVERSITY OF UTAH DEPARTMENT OF ELECTRICAL & COMPUTER ENGINIEERING ECE 5530 ECE 6530 DIGITAL SIGNAL PROCESSING September 18, 2008 Due: 6:00 p.m., October 2, 2008 HOMEWORK #2 1. (a) Determine the z-transform and the associated region of convergence...
Date Added: 2009-08-10 20:35:24

hwsol4.pdf
Path: Utah >> MATH >> 1170 Fall, 2008
Description: Problem Set 4 MATH 1170, Fall 2007 Solutions Graded problems in bold. 1 1.7 : 3. 43.2-1 = 43.2 0.023 1 1.7 : 4. 43.2-0.5 + 43.20.5 = 43.2 + 43.2 0.15 + 6.57 = 6.72 1.7 : 5. 43.27.2/43.26.2 = 43.21 = 43.2 3 2 1.7 : 9. 22 22 = 28 24 = 212 = 4096 ...
Date Added: 2009-08-10 20:35:27

quiz8a.pdf
Path: IUPUI >> M >> 153 Fall, 2009
Description: W X ( \' X W Q W X V G p E p G $ p $E p G $ p r #E p G P p r E S X W Q P I G P F E H Y u R X I G P F #E H Y u Q W X V G % p E p G p $E p G p...
Date Added: 2009-08-10 20:37:52

a2-abstraction.pdf
Path: NSCC >> CSC >> 142 Fall, 2009
Description: Question Abstraction in Computer Programming ( or, Learning How to Drive ) Suppose you borrow your friend\'s car. How do you know that the various parts of their car do the same thing as they do on your car? (ignition, steering wheel, accelerator, et...
Date Added: 2009-08-10 20:37:59

CMN_03_17_S09b_T08.pdf
Path: USC >> CSCI >> 577 Fall, 2009
Description: Date Venue Start time Attendee: Project #8: AAA Petal Pushers Remote R&D Client Meeting Note #7 March 17, 2009 SAL 322 05:00 PM Name Chatupoln Taparugssanagorn Kantipa Lumyai Chatchai Sinthop Saranya Iranoppaiboon John Lindsey...
Date Added: 2009-08-10 20:38:15

2006 class 01.ppt
Path: Pace >> IS >> 112 Spring, 2008
Description: IS112 Computer Organization and Programming Professor Catherine Dwyer Fall 2006 IS112 Computer Organization 1 Agenda Introductions Syllabus Class Schedule Blackboard web site Technical knowledge and the IS professional Assignment for nex...
Date Added: 2009-08-10 20:38:36

Week8EngineeringAnalysis.pdf
Path: Georgia Tech >> ME >> 4182 Fall, 2008
Description: Adam Lord Aris Perez Brandon Stewart Christian Gattung Laura Stump Riley Perszyk Problem bicycle loading to a roof rack Selected Hinged Platform Design Mid-Term Presentation and Review Layout Drawings Lone Outdoorsmen General Load Diagram Hangin...
Date Added: 2009-08-10 20:38:38

solution3.pdf
Path: Washington >> PHYS >> 525 Fall, 2008
Description: Problem set 3 Problem 1 Use Kramers-Wannier duality, map the Ising model on a two-dimensional triangular lattice onto the Ising model on a hexagonal lattice. Problem 2 Prove formulas (4.76) and (4.77) in J. Kogut, Rev. Mod. Phys. 51, 677 (see link on...
Date Added: 2009-08-10 20:39:49

Air Securtiy_presentation1.ppt
Path: American >> NW >> 2728 Fall, 2009
Description: 1 Air Travel Security Personnel Management System Alexis Bawden | Zach Gelman | Lily Ladd| Krissa Lum Team Stats Alexis Bawden Kogod School of Business, American University 2009 Concentration: Finance Bowdoin College BA Gover...
Date Added: 2009-08-10 20:40:00

13clust.pdf
Path: University of Toronto >> CSC >> 411 Fall, 2009
Description: 1 0.5 -1 -0.5 0.5 1 -0.5 -1 ...
Date Added: 2009-08-10 20:40:25

instructions.pdf
Path: Arizona >> BIOC >> 462 Fall, 2008
Description: Proceedings of Biochem 462a Honors Instructions for Authors The Proceedings of Biochem 362a Honors publishes review papers of particular quality in the broadly dened area of biochemical structure and function. Papers submitted to the journal should r...
Date Added: 2009-08-10 20:41:06

McFADDEN - ABET Assessment.pdf
Path: Penn State >> JEM >> 358 Fall, 2009
Description: ABET Outcomes for AE 481W/482 a. An ability to apply knowledge of mathematics, science, and engineering b. An ability to analyze and interpret data c. An ability to design a system, component, or process to meet desired needs e. An ability to identif...
Date Added: 2009-08-10 20:42:41

hw10.pdf
Path: Kentucky >> MA >> 213 Fall, 2008
Description: f e yp s p w y pl p j y s sq yp s q iq yw p i q q uw hw r e p`St`tp`to`twStpstpS`tw!6`mfhF`U` wsmb f S ew u f u f mb`tq s bqq`tj`t|tw`fmh!t` r hw p p pl y s p p i iq yw p y s qjp p s i iq p i p y qjp p i h hw r e Skw`m...
Date Added: 2009-08-10 20:43:39

ptest2.pdf
Path: Kentucky >> MA >> 213 Fall, 2008
Description: R gS C75r6evbcdi Y X Y Y e } Ya x X Yx X Yi hXjqi Ya j X Yx Xu qf lu pi l ji Y j h X Y j SR kTsa s #eTp`Cvu6fp6ffb`v66vTrb`swXrhvCpcAvyTTR TqdTGR Y X Y Yi x a j X Y x X Yi hXj qi a j X Y ...
Date Added: 2009-08-10 20:43:42

reviewsheet3.pdf
Path: Kentucky >> MA >> 114 Fall, 2008
Description: ...
Date Added: 2009-08-10 20:43:48

ps1.ps
Path: Berkeley >> CS >> 150 Fall, 1996
Description: %!PS-Adobe-2.0 %Creator: dvipsk 5.58f Copyright 1986, 1994 Radical Eye Software %Title: ps1.dvi %Pages: 1 %PageOrder: Ascend %BoundingBox: 0 0 612 792 %EndComments %DVIPSCommandLine: dvips -o ps1.ps ps1.dvi %DVIPSParameters: dpi=300, comments removed...
Date Added: 2009-08-10 20:45:28

levinson.pdf
Path: Arizona >> INDV >> 101 Fall, 2008
Description: Opinion TRENDS in Cognitive Sciences Vol.8 No.3 March 2004 Can language restructure cognition? The case for space Asifa Majid1, Melissa Bowerman1, Sotaro Kita2, Daniel B.M. Haun1,3 and Stephen C. Levinson1 1 2 Max Planck Institute for Psycholingu...
Date Added: 2009-08-10 20:45:44

typesofdata.pdf
Path: Alaska Anch >> GEOS >> 294 Fall, 2009
Description: Mars Color Imager, wide angle camera, on its way to Mars Filter wavelengths: 260, 320 nm UV; 425 nm blue; 550 nm green; 600, 650, 725 nm red color camera CCD w/ filters ...
Date Added: 2009-08-10 20:45:48

MOM_Lect_05.pdf
Path: Washington >> ME >> 354 Fall, 2009
Description: Mechanics of Materials Lab Lecture 5 Stress Mechanical Behavior of Materials Sec. 6.1-6.5 Jiangyu Li University of Washington Jiangyu Li, University of Washington Prof. M. E. Tuttle University of Washington Force Vectors A force, F , is a vector...
Date Added: 2009-08-10 20:46:53

project.pdf
Path: Montana >> WEB >> 215 Fall, 2009
Description: CHBE 215 Elementary Principles I Fall 2008 Project Objectives: (1) Learn the details of a commercial chemical process, (2) apply CHBE 215 skills/tools to a commercial process, and (3) develop a basic computational simulation of a commercial proces...
Date Added: 2009-08-10 20:47:36

output.txt
Path: Old Dominion >> CS >> 555 Fall, 2008
Description: Output for Leaky-Leaky Case:- - Response 1 took:0.41666666666666663 Response 2 took:0.41666666666666663 Response 3 took:0.41666666666666663 Response 4 took:0.41666666666666663 Response 5 took:0.41666666666666663 Response 6 took:0.41666666666666663 ...
Date Added: 2009-08-10 20:47:41

readme.txt
Path: Old Dominion >> CS >> 555 Fall, 2008
Description: How to execute this program : - 1) javac leakytoken.java 2) java leakytoken 3) To choose application1 as leaky bucket press 1, for token bucket press 2, to exit press 3. 4) To choose application2 as leaky bucket press 1, for token bucket press 2, ...
Date Added: 2009-08-10 20:47:41

words.txt
Path: Wisconsin Milwaukee >> LIB >> 1506 Fall, 2009
Description: & 19378:26507:1612:1089 \' 22015:51429:537:336 . 23449:8934:102:79 22834:8934:102:79 22220:8934:76:79 11 25599:52063:895:435 1601 11263:16146:1561:515 185 35404:59076:1459:416 2605 42367:24110:1919:534 2644 14694:51508:1715:396 323 13414:42039:1868:57...
Date Added: 2009-08-10 20:48:21

Assig_05_2009S.doc
Path: UCLA >> LX >> 120 Fall, 2009
Description: LINGUISTICS 120A, SPRING 2009 Name: Section: Score: ASSIGNMENT 5 /3= I. (6 points) Types of morphemes. From a language OTHER THAN ENGLISH, give words that illustrate AT LEAST TWO of each of the following types of morphemes. You can use the same wor...
Date Added: 2009-08-10 20:49:23

310-Reading6-Function-Anthropom.pdf
Path: Ball State >> ARCH >> 263 Fall, 2008
Description: ...
Date Added: 2009-08-10 20:49:34

124_SU07_lecture4.ppt
Path: BYU >> ECE >> 124 Fall, 2008
Description: Schedule. Date 2 July 3 July 4 July 5 July 6 July 7 July 8 July 9 July Day Mon Tue Wed Thu Fri Sat Sun Mon 6 I/O 9 HW 2 (CH 3-7) 5 Programming 7 Simulator Lab 1 HOLIDAY Class No. 4 Title Von Neumann Model 5 HW ...
Date Added: 2009-08-10 20:49:36

AS300 Lsn 13a InfmtvAdvcyBrf.ppt
Path: Arkansas >> AS >> 300 Fall, 2009
Description: Informative/Advocacy Briefings Overview Feedback Grade sheets Talking Papers Overview Position Papers Administrative Procedures Assignments Question And Answer Session Feedback Verbal Critique Written Critique Briefing Measurement Gra...
Date Added: 2009-08-10 20:49:43

ECE5570F06_HW3p1soln.pdf
Path: Utah >> ECE >> 5570 Fall, 2008
Description: CONCEPTUAL TOOLS By: Neil E. Cotter ECE 5570 F06 HW 3 prob 1 sol\'n EX: Diagonalize the matrix, U, that rotates vectors by angle . In other words, express the following matrix as the product of matrices, SS1, where S has eigenvectors as its colum...
Date Added: 2009-08-10 20:49:57

ch11.ppt
Path: Penn State >> MRKT >> 585 Fall, 2009
Description: <?xml version=\"1.0\" encoding=\"UTF-8\"?> <Error><Code>NoSuchKey</Code><Message>The specified key does not exist.</Message><Key>26850091856e588c590bfea94060cf6c35acc927.ppt</Key><RequestId>F C0323D828A18767</RequestId><HostId>a0QbJKJ6STukJGPEzJQ7GE+8WPS...
Date Added: 2009-08-10 20:51:20

hw9sol.pdf
Path: Texas A&M >> M >> 308 Fall, 2009
Description: M308 Assignment 8 Solutions Section 9.4, Problem 18. We need to determine whether or not we can express the relation 2 1 t t c1 0 + c2 0 + c3 0 = 0, t2 t 1 with c1 , c2 , and c3 not all 0. The second compents give no equation, and the fir...
Date Added: 2009-08-10 20:52:28

PAE3251.t2k.n_sep-logo.pdf
Path: UCSC >> PAE >> 3251 Fall, 2009
Description: PAE3251.t2k n_sep 5 4 3 2 1 1 10 20 30 40 D 5 4 3 2 1 A H G I D H D H G D A H A H D A D G 51 60 70 80 90 D 5 4 3 2 1 A D A D A D A P D G D K A D 101 110 120 130 140 A 5 4 3 2 1 D H D H D H D G D H D H 151 ...
Date Added: 2009-08-10 20:52:34

history.txt
Path: San Diego State >> DESIGN >> 344 Fall, 2009
Description: var1=<font face=\"Verdana, Arial, Helvetica, sans-serif\" size=\"11\" color=\"#000000\">In the beginning anime actually started as a hobby. The first anime films were 1-5 minutes each and go back as far as the 1920s. Most of the series were exaggerated tal...
Date Added: 2009-08-10 20:52:46

chap8.pdf
Path: National Taiwan University >> MSE >> 205 Fall, 2009
Description: Chapter 8: Mechanical Failure ISSUES TO ADDRESS. 1. How do flaws in a material initiate failure? 2. How is fracture resistance quantified; how do different material classes compare? 3. How do we estimate the stress to fracture? 4. How do loading rate...
Date Added: 2009-08-10 20:54:10

MSE351_Lecture11Notes.pdf
Path: Washington >> MSE >> 351 Fall, 2008
Description: 4 a- -a;y f-= ?E-:-=eE a -L T = fY1. a-, F- - -18-EQr+ uE*kgrs azsseedq efut:eet, o lfisjo,{r \" qek- = .= -27t, T / th\"t\",l1ft -F=\'- _ t - ,& = \' _ | 4 _ ...
Date Added: 2009-08-10 20:54:23

HST498Spring2008.pdf
Path: ASU >> HST >> 498 Fall, 2009
Description: English Travelers, 1600-1800 (11987) Hst 498 Arizona State University Engineering Cntr G, G305 Retha M. Warnicke Office: Coor 4460 Office Hours:11:00-11:30 MWF Telephone: 480-727-6489 FAX: 480-965-0310 E-Mail: rwarnicke@asu.edu Web Site: www.publi...
Date Added: 2009-08-10 20:55:21

Peer Team Evaluation Sheet.doc
Path: UNL >> CSE >> 489 Fall, 2009
Description: Date of Evaluation: Peer Team Evaluation Sheet Team Number and Name:_ Team Member Being Evaluated:_ Team Member Evaluating:__ Contribution Beginning - 1 Developing - 2 Accomplished - 3 Exemplary - 4 Score Comments Research & Gather Information Unw...
Date Added: 2009-08-10 20:55:30

map.pdf
Path: Washington >> BIS >> 398 Fall, 2009
Description: ...
Date Added: 2009-08-10 20:55:39

homeworkX.txt
Path: UMBC >> CMSC >> 491 Fall, 2009
Description: Homework X. Due 5/22/07 To be completed by 9:00 p.m. A file called hw8 is expected to be found in your class username directory (/mnt/classlab1/cmsc491u/username). Also, there will be additional files that you edit or created will need to also be ...
Date Added: 2009-08-10 20:56:16

page31.pdf
Path: Utah Valley State >> FACTBOOK >> 0203 Fall, 2009
Description: *Faculty Excellence Award 2001-2002 Brian Birch Mark Bracken Judy Conder Steve Fordham Laura Hamblin David Heldenbrand Forest Williams Eddie Cadet Rob Carney Danny Horns Hazel J. McKenna Hugh Rode Paul J. Bybee Kathie Debenham David E. Manning Collee...
Date Added: 2009-08-10 20:56:28

chem101_notes2_16.pdf
Path: BYU >> CHEM >> 101 Winter, 2008
Description: ...
Date Added: 2009-08-10 20:56:42

602-Outline.doc
Path: Wisconsin >> AAE >> 375 Fall, 2009
Description: IS 602 / AAE 375: Globalization, poverty and development Course Outline Offered: Schedule: Location: Credits: Prerequisite: Instructors: Spring 2007 TR 9:30-10:45 am B231 Van Vleck 3 1-2 courses in economics or consent of instructor Professor Brad Ba...
Date Added: 2009-08-10 20:56:54

Mod2gjk.xls
Path: Uni. Westminster >> GJK >> 0517 Fall, 2009
Description: Money from Parents Rent Hourly Wage Rate Tuition Cell Phone Car Payment Parents Hours Work Income Debt Owed (parents) Income Rent Utilities Tuition Cell Phone Base Cell Overage Car Payment Food Misc. Entertainment Expenses Savings Debt 1100 350 6.68...
Date Added: 2009-08-10 20:58:00

5tale10.txt
Path: UNC >> DOCS >> 2684 Fall, 2009
Description: *The Project Gutenberg Etext of Five Tales, by John Galsworthy* #9 in our series by John Galsworthy Copyright laws are changing all over the world, be sure to check the copyright laws for your country before posting these files! Please take a look ...
Date Added: 2009-08-10 20:58:43

pcilat-proposal.pdf
Path: East Los Angeles College >> DJM >> 202 Fall, 2009
Description: Experiment: Show that PCI latency has suffered as the standard has evolved David Miller December 2007 Abstract I plan to show that where latency in other system components (such as RAM, network, etc) has improved in some proportion to bandwidth in th...
Date Added: 2009-08-10 20:59:25

final-fall99.pdf
Path: Arizona >> HWR >> 431 Fall, 2008
Description: University of Arizona Department of Hydrology and Water Resources Dr. Marek Zreda HWR431/531 - Hydrogeology Final exam - 10 December 1999 Open books and notes The test contains 10 problems on 3 pages. Read the entire test before you start. Problem 1....
Date Added: 2009-08-10 20:59:49

zisser-mundy.pdf
Path: W. Alabama >> CS >> 498 Fall, 2009
Description: IYvvxvGs HxvvrH(vH H#rsG3Axx vy y GHvrTUYvrHyrr vvzvrHs#H \" zHGITx GsG HAxhsGvY vrH H7xYvGv rGv vrHHr a7rUy U(TwvrHs#H GvTv )YvrHyrr vwvrHrUHGv Hvv...
Date Added: 2009-08-10 21:00:21

ere596urh-class04b.pdf
Path: ESF >> ERE >> 596 Fall, 2009
Description: SUNY ESF ERE596URH Spring Semester More Advanced Urban Models Dr. T. Endreny, P.H., P.E. Environmental Resources Forestry StormCAD Hydrology w Rainfall Intensity-Duration Frequency n Rec...
Date Added: 2009-08-10 21:00:54

Chapter 5.ppt
Path: Fayetteville State University >> AST >> 1002 Fall, 2009
Description: Mars Terrestrial planet Sun Earth and Moon Moon Earth Venus Mercury p. 96 de 1 Earth and Moon 1992 Galileo spacecraft de 2 Fig. 6-2, p.98 AST0601.jpg de 3 5.1 Earth and the Moon in Bulk de 4 Planet/ R in AU Moon Mercury Period Revolution ...
Date Added: 2009-08-10 21:01:00

hw2.pdf
Path: Georgia Tech >> CS >> 3500 Fall, 2009
Description: CS 3500: Introduction to the Theory of Computation Problem Set 2 Due May 30, 2003 Problem 1 [20 Points] Problem 1.23 on page 88 of Sipser. Problem 2 [30 Points] Exercise 2.4 parts (a) - (f) on page 120 of Sipser. Problem 3 [10 Points] Exercise 2.7 ...
Date Added: 2009-08-10 21:02:46

lcd2.pdf
Path: Dickinson State >> EE >> 376 Fall, 2009
Description: NDSU LCD Interfacing ver 2 ECE 376 LCD Display Interfacing: Background: A liquid crystal display (LCD) is an electronic device designed to display data. Liquid crystals are designed so that they polarize light - with the orientation being shifted ...
Date Added: 2009-08-10 21:03:47

hw2.ps
Path: Toledo >> PEOPLE >> 1648 Fall, 2009
Description: %!PS-Adobe-2.0 %Creator: dvipsk 5.58f Copyright 1986, 1994 Radical Eye Software %Title: hw2.dvi %Pages: 3 %PageOrder: Ascend %BoundingBox: 0 0 612 792 %DocumentPaperSizes: Letter %EndComments %DVIPSCommandLine: dvips -o hw2.ps hw2 %DVIPSParameters: d...
Date Added: 2009-08-10 21:04:21

T0409.t04.near-backbone-11-logo.pdf
Path: UCSC >> T >> 0409 Fall, 2009
Description: T0409.t04 near-backbone-11 3 2 1 1 10 20 30 40 G 3 2 1 H A D G G A G A B G A D I F G I G A B G A D K G J I K I E J B A D I D J G 51 60 70 80 90 A 3 2 1 D G D K D A D K D G K G G I D A G B A D K D A F I E K E G D A D G E I ...
Date Added: 2009-08-10 21:04:29

bis00z.txt
Path: University of Illinois, Urbana Champaign >> ATMOS >> 20090210 Fall, 2009
Description: UPPER AIR CALCULATIONS AND PLOTTING (Ver 5.48.1-LINUX-X11) Current filename: /mnt/noaaport/nwstg/convert/09021012_upa.wxp Date: 1200Z 10 FEB 09 Searching for KBIS. Searching the city database file for: KBIS . Date:1200Z 10 FEB 09 Station: KBIS...
Date Added: 2009-08-10 21:05:21

428lessonevals.pdf
Path: Penn State >> MATH >> 428 Fall, 2009
Description: MATH 428: Geometry for Teachers EVALUATION of GEOMETRY LESSON Instructor 1. Did the instructor clearly convey what topic the lesson was about? Points out of 10: Comments: 2. How would you rate the instructor in terms of preparedness? Write about the...
Date Added: 2009-08-10 21:05:48

session10.pdf
Path: UPenn >> BPUB >> 250 Spring, 2007
Description: Choosing Output in LR 1 Long Run Competitive Equilibrium 3 conditions All firms maximize profits No firm has incentive to enter or exit Price equates supply and demand 2 Long Run Supply Cannot horizontally add because in LR, don\'t know which...
Date Added: 2009-08-10 21:05:53

packet23.pdf
Path: UPenn >> BPUB >> 250 Spring, 2007
Description: Controlling Externalities What is the socially optimal level of emissions (abatement)? Suppose emissions can be monitored. How to control them? Standards penalize firms if they emit more than E* 1 Emissions Fees Impose fee of $x/unit When a...
Date Added: 2009-08-10 21:05:58

Syllabus220 U09.pdf
Path: SUNY Albany >> BA >> 577642 Fall, 2008
Description: *THIS SYLLABUS IS SUBJECT TO CHANGE!* AMAT 220: Linear Algebra Class #1648 Summer 2009 Instructor: Benjamin Atchison Office: ES 151A Email: ba577642 (@albany.edu) Phone: (518) 442-4644 Meeting Time/Place: M-F 8:30-10:50 in ES 140 Office Hours: M-F 4:...
Date Added: 2009-08-10 21:07:49

syllabus.ps
Path: New Mexico >> CS >> 471 Fall, 2008
Description: %!PS-Adobe-1.0 %Creator: gila:acpineda (Andrew C. Pineda) %Title: syllabus.txt %CreationDate: Thu Aug 28 14:30:03 1997 %DocumentFonts: Courier-Bold Courier /NLSvec [ 8#241 /exclamdown 8#242 /cent 8#243 /sterling 8#250 /currency 8#245 /yen 8#246 /brok...
Date Added: 2009-08-10 21:07:59

200968_f01k_091185.pdf
Path: Stanford >> STIZ >> 1043 Fall, 2009
Description: US District Court Civil Docket as of 06/08/2009 Retrieved from the court on Tuesday, June 09, 2009 U.S. District Court Northern District of Georgia (Atlanta) CIVIL DOCKET FOR CASE #: 1:09-cv-01185-JEC Belmont Holdings Corp. v. Suntrust Banks, Inc. ...
Date Added: 2009-08-10 21:08:37

Golden.pdf
Path: UMBC >> ECSVL >> 553 Fall, 2009
Description: Family Life in Economic Context Lonnie Golden, Penn State University, Spring 2002 Course Objectives: We all experience, at some point in our lives, being part of both a family and an economy. The purpose of this course is for students to gain a deepe...
Date Added: 2009-08-10 21:09:06

HW2.pdf
Path: Idaho >> ECE >> 410 Fall, 2008
Description: ECE 410 - Advanced Electronics Dr. Suat Ay Homework #2 Spring 2008 TEXTBOOK: Microelectronic Circuits, Sedra and Smith, Oxford University Press, 5th edition, 2004 1. (5 points) Textbook Problem 4.36. 2. (10 points) Textbook Problem 4.37. 3. (5 p...
Date Added: 2009-08-10 21:09:18

3280exam3key-06f.pdf
Path: Minnesota >> MATH >> 3280 Fall, 2009
Description: ;:, 1. (10 pts.) Given a first-order linear homegeneous system with initial condition Xl ~ dt Xl [ X2 ] = [ 1 -4 3 9] [ X2 ] , [ Xl (0) = 0 [ 1 ] . X2(0) ] You are given that the eigenvalues and eigenvectors for this system are A1...
Date Added: 2009-08-10 21:09:51

lab10.pdf
Path: Brookdale >> ENGI >> 251 Fall, 2008
Description: ELEC 241 Experiment 10 Multiplexers And Demultiplexers OBJECTIVE A multiplexer or data selector is a device that is capable of taking two or more data lines and converting them into a single data line for transmission to another point. A demultipl...
Date Added: 2009-08-10 21:09:56

EDUC220ALL.TXT
Path: Sveriges lantbruksuniversitet >> EDUC >> 20031 Fall, 2009
Description: Sheet1 PROFILE OF STUDENTS IN SFU COURSES COURSE: EDUC 220-3 ALL SECTIONS LOCATION: SFU OTH TITLE: EDUCATION PSYCHOLOGY SECTION TYPE: LEC SEMESTER: 2003-1 ENROL: 303 = PROGRAM OF STUDENT (Top 5 programs reported in each category Programs with < 3 stu...
Date Added: 2009-08-10 21:10:32

BROCHURE.pdf
Path: CSU Northridge >> AG >> 535279 Fall, 2009
Description: BENJAMIN BANNEKER WHY I MUST LEARN MATH! 1. Came from a family of slaves. 2. Was taught to read by his grandmother because there were no nearby schools for him. 3. His fascination for a watch led to his interest in Mathematics and Astronomy. Date o...
Date Added: 2009-08-10 21:11:25

DIE LORELEI2.doc
Path: Long Island U. >> HH >> 0608 Fall, 2009
Description: George B. Hartman 6/22/2009 DIE LORELEI The Rhine river ride was a highlight of our trip to Germany. The variety of castles and villages we sailed past was breathtaking. One wanted to stop at each town and take in the sights. We did get to stop at...
Date Added: 2009-08-10 21:13:53

thin-holo-eqns.pdf
Path: MIT >> MAS >> 450 Spring, 2009
Description: Transmission hologram equations All angles are measure with respect to the plate surface normal. R is radius of wavefront curvature, measured at the plate: R > 0 is a diverging source, R < 0 is a converging source, R = is a collimated source or plan...
Date Added: 2009-08-10 21:14:07

IAS_18.doc
Path: UNC Charlotte >> ACCT >> 6299 Fall, 2008
Description: with the transaction will flow to the enterprise; and(b) the amount of the revenue can be measured reliably.30. Revenue should be recognised on the following bases:(a) interest should be recognised on a time proportion basis that takes into acco...
Date Added: 2009-08-10 21:14:13

lab8-faraday.doc
Path: University of Louisville >> P >> 296 Summer, 2009
Description: NAME_ 1. What is the purpose of this lab? 2. State and explain Faraday\'s law. 3. Do magnetic fields form closed loops? Explain your answer. 4. What is magnetic induction? 5. If you have a coil and a bar magnet (as shown below) that have a velocit...
Date Added: 2009-08-10 21:14:23

fmschecklist.pdf
Path: Ohlone >> ECS >> 304 Fall, 2009
Description: On the line in front of the skill record the date you observed the child completing it, N/O if you did not observe the child attempting the skill, and leave blank if the child is unable to achieve the skill. Name : Child\'s Name (Alias): DOB: Checkli...
Date Added: 2009-08-10 21:15:02

F08proj1sec7tm1.xlsx
Path: Arizona >> MATH >> 115 Fall, 2009
Description: TEAM LOAN DATA: Assignment Section: Team: Borrower Years Experience in Business 10 7 1 Economy Education Level High School Loan Foreclosure Value $1,533,000 Condition Boom Name Full Value $2,600,000 Default Value $500,000 ...
Date Added: 2009-08-10 21:15:13

read_me.txt
Path: RIT >> PROJECT >> 3892 Fall, 2009
Description: NAUTILOID BATTLESHIP This model made by Steve \"Silverblade\" James www.silverblades-suitcase.com Model made with Rhino3d ( www.rhino3d.com ) Mindflayer nautiloid based on the Spelljammer setting for Dungeons and Dragons, (spelljammer and Dungeon...
Date Added: 2009-08-10 21:15:26

chap005.doc
Path: WVU >> ACCT >> 331 Fall, 2008
Description: Chapter 5 Cost Behavior: Analysis and Use Solutions to Questions 51 a. Variable cost: A variable cost remains constant on a per unit basis, but changes in total in direct relation to changes in volume. b. Fixed cost: A fixed cost remains constant i...
Date Added: 2009-08-10 21:15:35

fm17.pdf
Path: UWO >> STA >> 421 Fall, 2009
Description: Financial Modelling Instructor: Matt Davison Notes Taken by: Yingfeng Huang 1 CAPM We posit investors who measure risk in terms of variance(standard deviation) and return in terms of expected values. Consider an individual with the optimal market p...
Date Added: 2009-08-10 21:15:41

Lab1instructions.pdf
Path: Toledo >> GEPL >> 5110 Fall, 2008
Description: GEPL 4110/5110 Lab 1 Due February 18th There is a new folder at Z:\\Geography\\Classes\\GEPL4110_5110_2009\\Lab1. It contains data for use with these lab exercises. The purpose here is to gain experience putting layers into data frames and developing app...
Date Added: 2009-08-10 21:17:09

ele4202_intra_septembre_2005.pdf
Path: Cal Poly >> ELE >> 4202 Fall, 2009
Description: COLE POLYTECHNIQUE DE MONTRAL DPARTEMENT DE GNIE LECTRIQUE Section Automation et Systmes Cours ELE4202 Commande des procds industriels CONTRLE PRIODIQUE Date : 27 septembre 2005 Documentation : 2 feuilles 8.5 x 11 recto-verso Heure : 9h30 10h30 (1h...
Date Added: 2009-08-10 21:17:10

Lab3&4 Feedback.ppt
Path: Michigan >> PERSONAL >> 495 Fall, 2009
Description: Lab 3 grades dongmei sarah Mean 48.4 47.3 Median 48.0 48.0 Mode 45.0 49.0 Standard Deviation 3.4 2.8 Minimum 43.0 42.0 Maximum 54.0 52.0 correct 0.1 -0.3 schultz Lab 4 grade averages wws hp tb sg 16.7 21.0 15.8 20.1 mc 19.9 Lab 3 Feedback ...
Date Added: 2009-08-10 21:18:34

METAL TEXTURE TUTORIAL.pdf
Path: Air Force Academy >> MJG >> 344 Fall, 2009
Description: Metal Texture Step 1 Create a new Photoshop document Choose File> New. Make your canvas 2400 pixels x 1800 pixels at 300 pixels/inch. Press OK. Step 2 Set the background color Set the background color to 50% grey. You can select the background color...
Date Added: 2009-08-10 21:18:42

2ogffbz605j.pdf
Path: Richmond >> X >> 10066341 Fall, 2009
Description: 11 february 1 1093 collegians rebr 2 the collegian thursday Februtry I L 1993 ...
Date Added: 2009-08-10 21:19:02

Brenda Loew Bio.pdf
Path: Washington >> MHE >> 501 Winter, 2008
Description: Brenda Loew, M.Ac., L.Ac. Biosketch Brenda Loew, M.Ac., L.Ac. specializes in Japanese-style acupuncture (particularly Toyohari Meridian Therapy, Shonishin and Manaka Yin-Yang Channel Balancing Therapy). She travels to Japan annually since 1996 for c...
Date Added: 2009-08-10 21:20:36

mass1.xls
Path: Grand Valley State >> EGR >> 345 Fall, 2008
Description: 0 0 Elapsed Time -Peak to Peak 0 0.05 0.65 0 0.1 0 0.15 0 0.2 0 0.25 0 0.3 0 0.35 0 0.4 0 0.45 0 0.5 0 0.55 0 0.6 0 0.65 0 0.7 0 0.75 0 0.8 0 0.85 0 0.9 0 0.95 0 1 0 1.05 0 1.1 0 1.15 0 1.2 0 1.25 0 1.3 0 1.35 0 1.4 0 1.4...
Date Added: 2009-08-10 21:20:44

April21.ps
Path: Georgia Tech >> CS >> 1803 Fall, 2008
Description: %!PS-Adobe-3.0 %Title: (Untitled2) %Creator: (Microsoft Word: LaserWriter 8 8.2) %CreationDate: (10:38 AM Wednesday, April 23, 1997) %For: (Richard LeBlanc) %Pages: 5 %DocumentFonts: Courier-Bold Courier %DocumentNeededFonts: Courier-Bold Courier %Do...
Date Added: 2009-08-10 21:20:51

Final_1.doc
Path: FIU >> VJAYA >> 002 Fall, 2009
Description: Incorporating Assertion Concepts Improves HDL based Designs and Synthesis Vivek Jayaram, Jaime Montenegro, Research Associates, Subbarao Wunnava, Professor Electrical and Computer Engineering, Florida International University, Miami, FL ABSTRACT Whil...
Date Added: 2009-08-10 21:21:05

MSE 608 B.ppt
Path: CSU Northridge >> MSE >> 18470 Fall, 2009
Description: MSE 608 B Summer 2009 Tal Ovadia Tal.ovadia@csun.edu talovadia@hotmail.com Managing the Engineering Professional Introduction Class Structure Schedule Grading Class Member introduction Team selection Introduction Instructor Tal Ovadi...
Date Added: 2009-08-10 21:22:24

ESE570_MemCkts06.pdf
Path: UPenn >> ESE >> 570 Fall, 2008
Description: 1 ESE 570 SEMICONDUCTOR MEMORIES Kenneth R. Laker, University of Pennsylvania 2 Semiconductor Memories Read-only Memory (ROM) Read/Write (R/W) Memory or Random Access Memory (ROM) 1. Mask programmed 2. Programmable ROM (PROM) b. Fuse ROM a. Er...
Date Added: 2009-08-10 21:22:51

OSch5.pdf
Path: CUNY Baruch >> CMP >> 426 Fall, 2009
Description: Chapter 5 CPU Scheduling CPU Scheduling 1 Outline ! ! ! ! ! ! ! Basic Concepts. Scheduling Criteria. Scheduling Algorithms. Multiple-Processor Scheduling. Thread Scheduling. Operating Systems Examples. Algorithm Evaluation. 2 CPU Scheduling 1 ...
Date Added: 2009-08-10 21:23:20

ANS_02_MethaneAirEquilibrium.doc
Path: Berkeley >> ME >> 256 Fall, 2009
Description: ME256: Graduate Combustion UC Berkeley Mechanical Engineering Problem: Category: Title: 02 SOLUTION Cantera Methane / Air Equilibrium Using a process similar to that one done in Problem 1, we can find the final equilibrium compositions and temperatu...
Date Added: 2009-08-10 21:23:21

CAN_02_MethaneAirEquilibrium_SOLUTION.doc
Path: Berkeley >> ME >> 256 Fall, 2009
Description: ME256: Graduate Combustion UC Berkeley Mechanical Engineering Problem: Category: Title: 02 SOLUTION Cantera Methane / Air Equilibrium Using a process similar to that one done in Problem 1, we can find the final equilibrium compositions and temperatu...
Date Added: 2009-08-10 21:23:23

Eng_4061_Week_4.pdf?PHPSESSID=9e491b55d08a90a5ecc8ff5cf1d52ddd
Path: Allan Hancock College >> ENGG >> 4061 Fall, 2009
Description: <?xml version=\"1.0\" encoding=\"UTF-8\"?> <Error><Code>NoSuchKey</Code><Message>The specified key does not exist.</Message><Key>262a77e987bedf59a6eaace192f4f6e7c61c7b58.pdf %3FPHPSESSID</Key><RequestId>1F68EEABD0091501</RequestId><HostId>0y0j2RMoafRYGuW...
Date Added: 2009-08-10 21:24:47

lecture 3.doc
Path: CSU San Marcos >> ID >> 340 Fall, 2009
Description: TWO things today, 1. Racial formations 2. Begin the group thing RACIAL FORMATIONS CAN WE examine RACE from the standpoint of Ethnicity, Class, States? Is it useful? Racial Formations is a theoretical framework that tries to capture, in its analysi...
Date Added: 2009-08-10 21:25:09

Pop-HW4.pdf
Path: Acton School of Business >> ESCI >> 101 Fall, 2009
Description: ...
Date Added: 2009-08-10 21:25:27

L3.ppt
Path: McNeese >> STAT >> 628 Fall, 2009
Description: STAT 628 Lecture 3 Numerical Summary Measuring Center: Mean Median Mode Measuring variation (Spread) The Standard Deviation IQR = Q3 Q1 Range = Max Min 1. Depends on only two values 2. Obviously, influenced by extreme values Standard Deviat...
Date Added: 2009-08-10 21:26:09

IntroClouds.ppt
Path: Alabama >> CS >> 457 Spring, 2008
Description: Cloud Computing The next big thing Also called: But what is it? Cloud Computing Ondemand computing, software as a service, Pay as you go Ondemand resources or services over Webbased applications (thin client) Scale and reliability of a dat...
Date Added: 2009-08-10 21:26:20

19901107.txt
Path: Minnesota >> CC >> 1990 Fall, 2009
Description: Title: Hourly weather readings Project: E080 Data: Weather Notes: This data is from the first Cedar Creek Campbell weather station. See \"weather1.txt\" for a complete description ...
Date Added: 2009-08-10 21:26:33

93_2sol.pdf
Path: Texas A&M >> STAT >> 604 Fall, 2008
Description: STAT 604 Exam 2 Solution 1. We need to show jse(X) n-1 n Fall, 1993 Dr. Newton s (X(i) - X. )2 = , n i=1 n where X(i) is the mean of the data with the ith X left out and X. is the average of the n X(i) \'s. It\'s easy to show that X. = ...
Date Added: 2009-08-10 21:27:17

Vocabulary Sheet.doc
Path: Pima CC >> JLIBBY >> 0319 Fall, 2009
Description: Vocabulary Sheet Animals Picture Word loris Meaning Large-eyed primates from Southeast Asia. lynx A powerful wild cat from Europe, Eurasia, and North America. Llamas are domesticated animals that are related to camels. The caiman is a meat-eating...
Date Added: 2009-08-10 21:29:18

overviewpowerpoint.pdf
Path: N. Illinois >> BIOS >> 591 Fall, 2008
Description: Bios 591 Spring 2006 Professor Sims 325D Montgomery or 453 Montgomery; 753-7817, tsims@niu.edu Chuck Leseberg (TA), 113 Montgomery, 7533206, cleseber@niu.edu Tues & Thurs 1:30 4:30 + extra time as needed. Attendance is required and graded Will...
Date Added: 2009-08-10 21:31:21

A Walk on a Grid I.doc
Path: Orange Coast College >> MATH >> 104 Fall, 2008
Description: A Walk on a Grid I On the grid shown below the black dot is \"home\". Walking from a dot to an adjacent dot, up or right is allowed but not down or left. How many ways are there to walk from \"home\" to each dot? Fill in the numbers on the dots themselv...
Date Added: 2009-08-10 21:31:23

5.pdf
Path: University of Illinois, Urbana Champaign >> CS >> 497 Fall, 2009
Description: Introduction to Smalltalk - Chapter 5 - Numbers Ivan Tomek 9/17/00 Chapter 5 - Numbers Overview VisualWorks library contains many classes representing numbers of various kinds, mainly because computers internally represent and process different kin...
Date Added: 2009-08-10 21:32:12

SampleReferencePage.pdf
Path: Salisbury >> EDUC >> 695 Fall, 2008
Description: This is exactly how your reference page will look REFERENCES Glesne, C. (1999). Becoming qualitative researchers: an introduction. New York: Longman. Haller, E.J. & Kleine, P.F. (2001). Using educational research: a school administrator\'s guide. New...
Date Added: 2009-08-10 21:32:33

E-861web.pdf
Path: Oklahoma State >> VERSION >> 3164 Fall, 2009
Description: E-861 Vitamin and Mineral Nutrition of Grazing Cattle Department of Animal Science Oklahoma Cooperative Extension Service Division of Agricultural Resources and Natural Resources Oklahoma State University E-861 Vitamin and Mineral Nutriti...
Date Added: 2009-08-10 21:32:35

Output.txt
Path: Allan Hancock College >> JESS >> 8456 Fall, 2009
Description: Caching Off Speed = 100 = _202_jess Starting = Run 0 start. Total memory=75497472 free memory=65368064 Jess, the Java Expert System Shell Copyright (C) 1997 E.J. Friedman Hill and the Sandia Corporation Jess Version 3.2 11/8/97 There are five house...
Date Added: 2009-08-10 21:32:51

Output.txt
Path: Allan Hancock College >> COMPRESS >> 8456 Fall, 2009
Description: Caching Off Speed = 100 = _201_compress Starting = Run 0 start. Total memory=125829120 free memory=115699712 Loop count = 5 3153920 931067 2856960 1132510 962560 688827 1280000 591635 1157120 368657 3153920 931067 2856960 1132510 962560 688827 128000...
Date Added: 2009-08-10 21:32:57

lecture20.pdf
Path: Ill. Chicago >> EECS >> 474 Fall, 2009
Description: Overloading New and Delete Operators Programmer is allowed to overload new and delete operators to implement class-specific memory management Example: Linked-list that keeps its own free list containing deallocated nodes - Delete would put nodes on...
Date Added: 2009-08-10 21:33:31

homework10-info.pdf
Path: Iowa State >> CPRE >> 211 Fall, 2009
Description: CprE 211 Spring 2006 Homework 10 Information Sheets Interrupt Controller 1 Interrupt Vector Identification by Exception Handler Interrupt Source 0 Level 0 1 Level 1 2 Level 2 3 Level 3 4 Level 4 5 Level 5 6 Level 6 7 Level 7 Priority 0 (highest) 1...
Date Added: 2009-08-10 21:33:37

compare_sus_runs.log.txt
Path: Utah >> ADICUZA >> 4000 Fall, 2009
Description: Testing adiCuZA4000s696K * Comparing /home/csafe/csafe-tester/Linux/SCIRun.101208/dbg/MPM-results/adiCuZA4000s696K/restart/adiCuZA4000s696K.uda with /home/csafe/csafe-tester/Linux/SCIRun.101208/dbg/goldStandard/MPM/adiCuZA4000s696K/adiCuZA4000s696K....
Date Added: 2009-08-10 21:34:18

lab_sch.pdf
Path: Virgin Islands >> ELEC >> 365 Fall, 2009
Description: ...
Date Added: 2009-08-10 21:34:25

richmondtext.pdf
Path: University of Iowa >> C >> 030149 Fall, 2009
Description: THE PUBLICATION S OF TH E SURT.EES SOCIET Y ESTABLISHED IN THE YEA R M .DCCC .XXXIV . VOL. XXVI . FOR THE YEAR M .DCCC .LIII . LONDON : J . B, NICHOLS AND SONS, PRINTERS, 25, PARLIAMENT STREET. WILLS AND INVENTORIE S FROM THE REGISTRY OF TH E ...
Date Added: 2009-08-10 21:35:53

macaw.ps
Path: Rochester >> ECE >> 237 Fall, 2009
Description: %!PS-Adobe-2.0 %Creator: dvips 5.521 Copyright 1986, 1993 Radical Eye Software %Title: macaw-cr.dvi %CreationDate: Mon May 30 15:31:58 1994 %Pages: 14 %PageOrder: Ascend %BoundingBox: 0 0 612 792 %EndComments %DVIPSCommandLine: dvips macaw-cr.dvi %DV...
Date Added: 2009-08-10 21:37:16

self_crituque.doc
Path: Utah >> U >> 0181384 Fall, 2009
Description: Brooke M. Bott Comm. 3510 Self-Critique When creating my website, I really tried to think of something that I feel defines me and I have connectedness to. I chose a mountain landscape, specifically a photo of Hidden Peak in the Wasatch Mountains, as ...
Date Added: 2009-08-10 21:37:19

112907_Leg_Mins_Att_N.pdf
Path: Allan Hancock College >> PAGE >> 138747 Fall, 2009
Description: ...
Date Added: 2009-08-10 21:37:46

Eng_4061_Week_4.pdf?PHPSESSID=9e491b55d08a90a5ecc8ff5cf1d52ddd
Path: Allan Hancock College >> ENGG >> 4061 Fall, 2009
Description: <?xml version=\"1.0\" encoding=\"UTF-8\"?> <Error><Code>NoSuchKey</Code><Message>The specified key does not exist.</Message><Key>262a77e987bedf59a6eaace192f4f6e7c61c7b58.pdf %3FPHPSESSID</Key><RequestId>1F68EEABD0091501</RequestId><HostId>0y0j2RMoafRYGuW...
Date Added: 2009-08-11 04:06:01

Utpal_CS551_Critique2_WebSrvSwArch.doc
Path: UMKC >> CS >> 551 Fall, 2009
Description: CS551 Paper Critique 2 (Fall 2004) Written by: Utpal Aradhye (uvayr5@umkc.edu) Reviewer: Utpal Aradhye, Graduate Student MS-CS, UMKC Course: CS551 (Fall-2004) Paper: Web Server Software Architectures by Daniel A Menasce Summary: This paper discusses ...
Date Added: 2009-08-11 04:24:50

TAB-F29.xls
Path: Cornell >> ERS >> 89022 Fall, 2009
Description: Table F-29-Grape juice: Supply and utilization, 1980/81 to date Supply Year 1/ Production Imports Total supply Exports - Million gallons, single-strength equivalent -1980/81 1981/82 1982/83 1983/84 1984/85 1985/86 1986/87 1987/88 1988/89 1989/90 1990...
Date Added: 2009-08-11 04:26:31

Decaluweintrahiver2002.pdf
Path: NSULA >> ECN >> 11498 Fall, 2009
Description: ...
Date Added: 2009-08-11 04:28:07

Hubertus Von Bremen1.pdf
Path: Cal Poly Pomona >> PHY >> 410 Winter, 2009
Description: 13th International Workshop on Dynamics & Control DaimlerChrysler Training Center, Wiesensteig, Germany May 22 26, 2005 Some Stability Results in a Model for Genetically Altered Mosquitoes Robert J. Sacker Department of Mathematics, University of S...
Date Added: 2009-08-11 04:28:13

325Problemset2-solution.pdf
Path: Sveriges lantbruksuniversitet >> ECON >> 325 Fall, 2009
Description: ECON 325, IO (Fall 2004) Christoph Luelfesmann, SFU Homework Assignment #2 1.) Please solve Problems 3 and 4, p.151 (ch. 3) in PRN. Short answers are ok. Answer: Problem 3: The reason for financial aid might indeed not be pure charity but a form of...
Date Added: 2009-08-11 04:28:34

Decision Making -student.ppt
Path: University of Dayton >> PSY >> 101 Fall, 2009
Description: A higher-order cognitive behavior Decision Making under Uncertainty: Heuristics in Judging Probabilities (Kahneman & Tversky) Usefulness versus biasing The representativeness heuristic: how similar is this event to previous events? Feminist or ba...
Date Added: 2009-08-11 04:31:02

flow.pdf
Path: East Los Angeles College >> COMS >> 21102 Fall, 2009
Description: Lecture notes for COMS 21102: Software engineering Fall 2006 semester Week 8: Flows, Cuts, Duality and linear programming Aram Harrow Dept. of Computer Science Merchant Venturers\' Building Room 3.28 aram@cs.bris.ac.uk (Dated: May 5, 2007) X. MAX-FL...
Date Added: 2009-08-11 04:31:58

085_whole_number_decimal_place_value_instruction.pdf
Path: Sinclair CC >> DEV >> 085 Fall, 2009
Description: Whole Number and Decimal Place Values We will begin our review of place values with a look at whole numbers. When writing large numbers it is common practice to separate them into groups of three using commas as the separator. When separating into gr...
Date Added: 2009-08-11 04:32:22

Ch02Ex03BinaryComm.pdf
Path: E. Kentucky >> COMMON >> 461 Fall, 2009
Description: ...
Date Added: 2009-08-11 04:32:50

words.txt
Path: Wisconsin Milwaukee >> LIB >> 797 Fall, 2009
Description: 14814:5018:3499:686 ^ 49059:407...
Date Added: 2009-08-11 04:33:14

evaluation.pdf
Path: Penn State >> ASA >> 5012 Spring, 2009
Description: ~ Team #1 Members Evaluation ~ Assignment: 1 = Poor 2 = Not bad Person #1 Participation Reliability Attendance Organization Respect Trust Attitude Open-mind Skills Totals Overall Total Average Comments: * Asad * 3 = Average Person #2 4 = Good Person ...
Date Added: 2009-08-11 04:33:46

Class2_fMRI_processing_hoeft.pdf
Path: Stanford >> PSYC >> 250 Fall, 2009
Description: fMRI Data Processing Fumiko Hoeft Outline Useful websites and material Recap from last week\'s class on NMR basics Different software packages fMRI Data Preprocessing Reconstruction Slice time correction Unwarp Realignment Normalization Sm...
Date Added: 2009-08-11 04:33:58

slides_for_lecture_2_2007.pdf
Path: UWI Mona >> WEB >> 100 Fall, 2009
Description: 60100 Lecture 2 The Computing Environment ARC1\"in IT Services , and \"Sol\"and ...
Date Added: 2009-08-11 04:37:22

po50302.pdf
Path: UMBC >> PO >> 503 Fall, 2009
Description: ...
Date Added: 2009-08-11 04:37:25

Test3_sol.pdf
Path: Fayetteville State University >> C >> 2311 Fall, 2009
Description: 1 2 3 4 5 6 7 8 ...
Date Added: 2009-08-11 04:37:45

lecCAVR.pdf
Path: Iowa State >> CPRE >> 288 Fall, 2009
Description: 9/30/2008 ATMEL SPECIFIC C CONSTRUCTS Embedded Programming exposes many machine level features to C. I/O ports connect to LCD, push buttons, bump sensors in iCreate. ATMEGA 128 ARCHITECTURE Peripheral function blocks (Timers, ADC, SPI etc.) SR...
Date Added: 2009-08-11 04:37:53

mpx00z.txt
Path: University of Illinois, Urbana Champaign >> ATMOS >> 20090223 Fall, 2009
Description: UPPER AIR CALCULATIONS AND PLOTTING (Ver 5.48.1-LINUX-X11) Current filename: /mnt/noaaport/nwstg/convert/09022312_upa.wxp Date: 1200Z 23 FEB 09 Searching for KMPX. Searching the city database file for: KMPX . Date:1200Z 23 FEB 09 Station: KMPX...
Date Added: 2009-08-11 04:37:58

answer2.txt
Path: MD University College >> CMIS >> 270 Fall, 2009
Description: Quiz 2 Answers 1. 93(b)(T)|94(t)1 and 2 2. 94(m)(T)|95(m)(F) 3. 96(t)(T)|97(m) 4. 98(t)(F)|99(m) 5. 100(t)|101(m) 6. 103(b)|104(m)|103(m)|106(m) 7. 108(b)(F)|any from sec4-5 8. 114(t)(F)|any from sec4-6 9. fig4-13(117b) 10. #4-3 11. #4-6 12. #4-7 1...
Date Added: 2009-08-11 04:38:23

lecture-static-04.pdf
Path: San Diego State >> MATH >> 693 Fall, 2009
Description: f f (x) = rj 1 2 m rj (x)2 , j=1 x Rn m n ...
Date Added: 2009-08-11 04:39:11

2003220_r01k_0001025.pdf
Path: Stanford >> SERO >> 1014 Fall, 2009
Description: US District Court Civil Docket as of 02/20/2003 Retrieved from the court on Friday, June 02, 2006 U.S. District Court Northern District of Georgia (Atlanta) CIVIL DOCKET FOR CASE #: 1:00-cv-01025-CAP In Re: Serologicals SEC Lit, et al v. , et al As...
Date Added: 2009-08-11 04:40:09

session12.pdf
Path: Allan Hancock College >> CS >> 4161 Fall, 2009
Description: COMP 4161 NICTA Advanced Course Advanced Topics in Software Verification Gerwin Klein Formal Methods {P} . . . {Q} 1 C ONTENT Intro Principles Lambda Calculus Higher Order Logic, natura...
Date Added: 2009-08-11 04:40:14

philosophy of education.doc
Path: Kennesaw >> LJR >> 7635 Fall, 2009
Description: Louise Robinson Philosophy of Education Paper October 23, 2003 Education 2201, Section 9 A philosophy of education is a statement of one\'s ideas, ideals, and beliefs regarding the classroom, the students, and the curriculum. There are four major phil...
Date Added: 2009-08-11 04:40:53

AC339.008.pdf
Path: Princeton >> AC >> 339 Fall, 2009
Description: ...
Date Added: 2009-08-11 04:41:10

OTM21_MN21AA_ORPRO.TXT
Path: UCLA >> CACHE >> 0001 Fall, 2009
Description: Sheet1 $GLL ORBIT PROFILE *ORPRO PSDT*OTM21.ORPRO/MN21AA *LEVEL PA2 *PREP W.JOHNSON X3-7725/L.CHENG X3-7766 *RUNID WAR *PROGRAM SEQGEN 97-002/09:51:20.000 *CREATION 97-053/06:41:47.819 *BEGIN 97-055/03:59:59.800 *CUTOFF 97-055/11:59:59.800 *TITLE E06...
Date Added: 2009-08-11 04:43:41

Lect1112_12.ppt
Path: Clayton >> BIOL >> 1112 Fall, 2009
Description: Lecture 12 February 19, 2002 Chapter 18 The Evolution of Animal Diversity Learning Objectives Define Chitin Class Aves Class Mammalia Extant vs. extinct Distinguish insect vs. non-insect arthropods The reptile-like characters of Archaeopteryx ...
Date Added: 2009-08-11 04:44:37

ipam07class.pdf
Path: Fayetteville State University >> IPAM >> 0507 Fall, 2009
Description: Automatic sulcal classification using geometric shape descriptors IPAM Workshop IV: Image Processing for Random Shapes: Applications to Brain Mapping, Geophysics and Astrophysics. May, 2007 Christian Laing, Juan B. Gutierrez, Deborah A. Smith, De Wi...
Date Added: 2009-08-11 04:45:46

lecture8.pdf
Path: Texas >> EE >> 381 Fall, 2008
Description: ...
Date Added: 2009-08-11 04:46:17

lec_9.ps
Path: Georgia Tech >> CS >> 3411 Fall, 2009
Description: %!PS-Adobe-2.0 %Creator: dvipsk 5.526a Copyright 1986, 1993 Radical Eye Software %Title: lec_9.dvi %Pages: 8 %PageOrder: Ascend %BoundingBox: 0 0 612 792 %EndComments %DVIPSCommandLine: dvips -f lec_9 %DVIPSParameters: dpi=300, comments removed %DVIP...
Date Added: 2009-08-11 04:48:53

resume.doc
Path: Penn State >> AOS >> 5052 Fall, 2009
Description: 512 Brumbaugh Hall University Park, PA 16802 Phone (267) 265-3236 E-mail aos5052@psu.edu Alexander Shtraks Objective Education [ 2002-2006 ] Lower Moreland High School Huntingdon Valley, PA High School Diploma 4.1 GPA [ 2006- Present ] Awards rece...
Date Added: 2009-08-11 04:49:32

Exercise_2.pdf
Path: Western Michigan >> HOMEPAGES >> 360 Fall, 2009
Description: BIS 360 Exercise #2 Conceptual Data Modeling I. Objective This assignment will familiarize you with conceptual data modeling by using one of the modern techniques-Entity-Relationship Diagramming (ERD)-in Oracle Designer. You are expected to apply all...
Date Added: 2009-08-11 04:49:37

equations.pdf
Path: Michigan State University >> CEM >> 383 Fall, 2008
Description: 3 Chemistry 383 Equation Sheet d= m V V= m d v = r/t a = v/t f = ma f = ma p = f/A dr v= dt m = r hd 2 dv d 2 r a= = dt dt 2 r 2 hdg p= = hdg r 2 9 t / F = / C + 32 5 n / mol = V2 P = 1 V1 P2 xi ni n T / K = / C + 273.15 5 / C = (t ...
Date Added: 2009-08-11 04:50:32

PS119.lec_03.09.29.2006.pdf
Path: Concordia Chicago >> ASTRO >> 119 Fall, 2009
Description: Phy Sci 119a Lecture 3 Orbits, Newton\'s Laws 09.29.06 Opening music; Franz Haydn (1732-1809): Symphony No. 94, the \"Surprise\". Date of first performance, 1791. The performance date is near the time of the Cavendish Experiment that established the val...
Date Added: 2009-08-11 04:50:57

final2.pdf
Path: Troy >> MTH >> 4422 Fall, 2009
Description: MTH 4422 Final Exam Study Guide Spring 2007 Pat Rossi Name Instructions. Answer the following questions thoroughly. 1. From \"Material to Study for the Midterm Exam,\" study the Trapezoidal Method for Integration. 2. From \"Material to Study for the Mi...
Date Added: 2009-08-11 04:51:13

chapter6.ppt
Path: Duke >> X >> 006 Fall, 2009
Description: Topics q q q q Decomposition Parameter passing Reading and writing from files Designing classes Reading Chapter 6 Assignment Biorhythms CD Reader q q A Computer Science Tapestry 6.1 Design Heuristics q Make each function or class you write ...
Date Added: 2009-08-11 04:52:11

gcnR_flux_ul.txt
Path: Berkeley >> ASTRO >> 00284856 Fall, 2009
Description: 0.15001 1 1 ...
Date Added: 2009-08-11 04:52:19

Ch5_worksheet-f07-key.pdf
Path: El Paso CC >> CH >> 100 Fall, 2009
Description: Ch100: Fundamentals for Chemistry Ch 5: Early Atomic Theory & Structure 1 Section 1 1. Complete the following: a) The first observer of protons: Eugene Goldstein b) First scientist to experimentally show the existence of electrons: J. J. Thomsen c...
Date Added: 2009-08-11 04:57:02

TPC_IOC_S07b_T01_V1.5.doc
Path: USC >> CSCI >> 577 Fall, 2009
Description: Test Plan and Cases (TPC) California Science Center Newsletter System Team 1 Jeremy Stoller Vincent Tsan Engineer Mustanshir Kanchwalla Abhilash Augustine Jaimin Vaidya Mitesh H Shah Client System Maintainer/Web Project Manager, OCD and FRD SSRD/...
Date Added: 2009-08-11 04:59:25

homework.txt
Path: MSCD >> CIS >> 3050 Fall, 2008
Description: CMS 3050 Fundamentals of Systems Analysis and Design H O M E W O R K 09-May 12:01 PM H O M E W O R K A S S I G N M E N T S Alias Sec Avg #0 #1 #2 #3 #4 #5 #6 #7 #8 #9 #10 #11 -- 0 001 53.5 ...
Date Added: 2009-08-11 05:00:22

MAE 3241 Hmk4 Solution.pdf
Path: Benjamin Franklin Institute of Technology >> MY >> 3241 Fall, 2009
Description: ...
Date Added: 2009-08-11 05:02:32

Mapping the ES305 Drive.doc
Path: Clarkson >> ES >> 305 Fall, 2009
Description: ES305 Instructions for Mapping the ES305 Course Drive Fall 2008 1. Doubleclick on My Computer 2. Select Tools|Map Network Drive 3. In the Folder box type: \\fs2\\JCarroll\\ES305 (note the two backslashes) then click on Finish 4. In User name type AD...
Date Added: 2009-08-11 05:03:26

T0471.t04.CB_burial_14_7-logo.pdf
Path: UCSC >> T >> 0471 Fall, 2009
Description: T0471.t04 CB_burial_14_7 3 2 1 1 10 20 30 40 A D A 3 2 1 F D E F E D E A B E G F E D F D E B A B E D F G F D E B 51 60 70 80 90 A B 3 2 1 E F E F E B D B D B E D B E D F G F E D A F D B D F D F E D E F D F G 101 11...
Date Added: 2009-08-11 05:03:35

manmade_lakes _web_version.doc
Path: East Los Angeles College >> BIOL >> 213 Fall, 2009
Description: vti_encoding:SR|utf8-nl vti_author:SR|rickl vti_modifiedby:SR|rickl vti_timecreated:TR|16 Dec 2003 15:43:01 -0000 vti_timelastmodified:TR|05 Jan 2004 14:39:01 -0000 vti_filesize:IR|36352 vti_title:SR|Man-made Lakes vti_assignedto:SR| vti_approvalleve...
Date Added: 2009-08-11 05:05:13

Student Handbook 141F2002.pdf
Path: Albion >> MATH >> 141 Fall, 2009
Description: Department of Mathematics and Computer Science Albion College Mathematics 141 Calculus of a Single Variable First Semester 2002-2003 Sections 1 & 2 Welcome Albion College\'s Department Mathematics and Computer Science has always stressed student-cen...
Date Added: 2009-08-11 05:07:24

0415_Roguev_Krogan_2008.pdf
Path: Harvard >> BIOPHYSICS >> 205 Fall, 2009
Description: RESEARCH ARTICLE Conservation and Rewiring of Functional Modules Revealed by an Epistasis Map in Fission Yeast Assen Roguev,1,2 Sourav Bandyopadhyay,3 Martin Zofall,4 Ke Zhang,4 Tamas Fischer,4 Sean R. Collins,1,2,5 Hongjing Qu,1,2 Michael Shales,1,2...
Date Added: 2009-08-11 05:10:18

Putting the pieces together.pdf
Path: N.E. Illinois >> TEC >> 5213 Fall, 2009
Description: Putting the Pieces Together An HPT Manual Thomas Mensah Gina Paladino Michael Shaver Bagus Suksmoro Sajan Tuladhar April 26, 2005 TEC 5213 1 Table of Contents Definition and Overview of HPT .3 Define Performance Consulting ..11 Glossary of Term...
Date Added: 2009-08-11 05:11:15

PS8.pdf
Path: Sanford-Brown Institute >> AM >> 169 Fall, 2009
Description: ...
Date Added: 2009-08-11 05:11:17

hw3answers.doc
Path: UCSB >> ECON >> 181 Spring, 2008
Description: Economics 181 Homework #3 Answers 1. Referring first to the AA/DD graphs, the drop in money demand shifts the AA curve out beyond its long run level in the short run. Thus the short run equilibrium is at point b, with increased output and exchange r...
Date Added: 2009-08-11 05:12:44

How Big Is a Box.pdf
Path: CSU Fullerton >> DMA >> 500 Fall, 2009
Description: How Big Is a Box? This is a question that has apparently baffled browser developers and even the World Wide Web Consortium (W3C). This issue is at the heart of some of the most frustrating aspects of CSS for beginner and expert alike. Let\'s go step b...
Date Added: 2009-08-11 05:12:48

598bsm_6sol.pdf
Path: University of Illinois, Urbana Champaign >> PHYS >> 598 Fall, 2008
Description: 598bsm Set 6 SOLUTIONS Problem 1. In the SU (5) grand unified theory, neither baryon number B, nor lepton number L are conserved. (Baryon number is 1/3 for quarks and -1/3 for anti- or conjugate quarks. Lepton number is 1 for electrons and neutrin...
Date Added: 2009-08-11 05:13:20

Bay BY1980 Answers.xls
Path: Fayetteville State University >> URP >> 5261 Fall, 2009
Description: BAY COUNTY BY 1980 LINEAR REGRESSION 250,000 Alachua County Linear Regression Projec Year Population Actual Data Projection 1980 97,740 99,079 1990 126,994 124,317 2000 148,217 149,556 2010 174,794 2020 200,033 2030 225,271 -4898144.5 2523.85 20...
Date Added: 2009-08-11 05:13:58

sup_2.pdf
Path: Toledo >> BIO >> 473 Fall, 2009
Description: THE JOURNAL OF BIOLOGICAL CHEMISTRY 1996 by The American Society for Biochemistry and Molecular Biology, Inc. Vol. 271, No. 30, Issue of July 26, pp. 18188 18193, 1996 Printed in U.S.A. Cell Internalization of the Third Helix of the Antennapedia H...
Date Added: 2009-08-11 05:16:00

Sinosecurities postscript.ppt
Path: UNLV >> MBA >> 730 Fall, 2008
Description: Sinosecurities.com Postscript Ken Peffers UNLV March 2004 What is the important management issue or problem in this case? Should OSIL have taken on the Sinosec contract? How could OSIL have managed the Phase 1 of the contract to avoid the problems...
Date Added: 2009-08-11 05:16:23

L2.Retrograde.xls
Path: University of Hawaii - Hilo >> SCI >> 122 Fall, 2009
Description: Table 1. Positions of Mars date R.A Dec. I\'ve plotted the data on sheet 2. date R.A Dec. h m deg min 12-Oct-74 8.08 21.82 8 5 21 49 Note that I converted the minutes to decimals. I made a formula in 22-Oct-74 8.43 20.90 8 26 20 54 each cell to do ...
Date Added: 2009-08-11 05:16:45

Pia_Esc_Profil.pdf
Path: Washington >> ESRM >> 468 Spring, 2008
Description: ...
Date Added: 2009-08-11 05:16:49

TN-239.pdf
Path: Washington >> ESRM >> 468 Spring, 2008
Description: ...
Date Added: 2009-08-11 05:16:52

XML Introduction.ppt
Path: FIU >> COP >> 5725 Fall, 2008
Description: XML Introduction By Hongming Yu Feb 6th, 2002 Index Markup Language: SGML, HTML, XML An XML example Why is XML important XML introduction XML applications XML support Markup Language A markup language must specify What mark...
Date Added: 2009-08-11 05:18:35

Lecture08.pdf
Path: Washington >> LECTURE >> 321 Winter, 2009
Description: Announcements Readings CSE 321 Discrete Structures Winter 2008 Lecture 8 Number Theory: Modular Arithmetic Today: 3.4 (5th Edition: 2.4) Monday and Wednesday: 3.5, 3.6, 3.7 (5th Edition: 2.5, 2.6) Highlights from Lecture 7 Set Theory and ti...
Date Added: 2009-08-11 05:19:28

functions2.pdf
Path: UCF >> COP >> 3502 Fall, 2009
Description: Void Functions A void function does not return a value to the calling algorithm. We don\'t need to include a return statement in a void function. After the last statement in the void function is executed, the control of execution is returned to the ca...
Date Added: 2009-08-11 05:21:54

Exam 1 08 solns.pdf
Path: Colorado >> CHEM >> 4011 Fall, 2008
Description: ...
Date Added: 2009-08-11 05:22:09

Generalizing_KG.pdf
Path: ASU >> I >> 256 Fall, 2009
Description: Generalizing the Klein-Gordon equation Kevin Gibson kevin.gibson@asu.edu The Klein-Gordon equation can be expressed as follows E0 2 1 2 - 2 t = c c 2 The purpose of this paper is twofold. First, show that the classical Schrdinger equation obtains...
Date Added: 2009-08-11 05:22:14

i-calculus.ps
Path: Washington >> CS >> 444 Fall, 2009
Description: %!PS-Adobe-3.0 %Title: Microsoft PowerPoint - i-calculus %Creator: Windows NT 4.0 %CreationDate: 17:19 10/30/1997 %Pages: (atend) %BoundingBox: 13 13 599 780 %LanguageLevel: 2 %DocumentNeededFonts: (atend) %DocumentSuppliedFonts: (atend) %EndComments...
Date Added: 2009-08-11 05:25:28

class1.ppt
Path: Washington >> CS >> 444 Fall, 2009
Description: Introduction to Database Systems CSE444 Instructor: Scott Vandenberg vandenbe@cs.washington.edu University of Washington Winter 2000 1 What Is a Database? A very large, integrated collection of data. Models realworld enterprise. Entities (e.g., s...
Date Added: 2009-08-11 05:25:44

Lab 3.doc
Path: CSU Bakersfield >> MATH >> 338 Fall, 2008
Description: LAB #3 - ANOVA R can calculate the probability or quantile of many distributions. For the most part we will be interested in the normal (norm), chisquare (chisq), t (t), and F (f). To compute a probability use the R commands pnorm, pchisq, pt, or pf...
Date Added: 2009-08-11 05:26:59

Handout 3 - CRD vs RCBD.doc
Path: CSU Bakersfield >> MATH >> 338 Fall, 2008
Description: Completely Randomized Design (CRD) Versus Randomized Complete Block Design (RCBD) CRD example Table 4.2. Page 104 of Hicks and Turner > yij <- c(17, 14, 13, 13, 14, 14, 13, 8, + 12, 12, 10, 9, 13, 11, 11, 9) > j <- c( 1, 1, 1, 1, 2, 2, 2, 2, + 3, 3,...
Date Added: 2009-08-11 05:27:01

quizzes_Quiz_6.pdf
Path: Washington >> CHEM >> 239 Fall, 2008
Description: Chem 239B Spring, 2009 Quiz#6 Prof. Sasaki _ 1. Draw the complete structures of the following compounds. a. Any aldotetrose b. -Methyl glycopyranoside of any aldohexose 2. a. Draw Fisher projection for all possible D-aldopentoses. b.Take any one of t...
Date Added: 2009-08-11 05:27:22

ppvrrp.pdf
Path: E. Kentucky >> EECS >> 801 Fall, 2009
Description: White Paper Virtual Router Redundancy Protocol (VRRP) The Virtual Router Redundancy Protocol (VRRP) transfers the responsibility of routing from one router to another if the original router goes down. This white paper discusses how the Virtual Route...
Date Added: 2009-08-11 05:30:03

L17-singlecycle.ppt
Path: Oregon >> CIS >> 314 Fall, 2008
Description: Finite State Machines A formal model used to design sequential circuits to perform tasks that only require a finite number of distinct states of the flip flops CIS 314 Fall 2004 A classic example: Stop light at an intersection Outputs: NSlite = 1 (...
Date Added: 2009-08-11 05:31:18

l01.ps
Path: Washington >> CS >> 461 Fall, 2009
Description: %!PS-Adobe-3.0 %Title: Microsoft PowerPoint - l01.ppt %Creator: PScript5.dll Version 5.2 %CreationDate: 9/27/2002 12:26:3 %BoundingBox: (atend) %Pages: (atend) %Orientation: Portrait %PageOrder: Special %DocumentNeededResources: (atend) %DocumentSupp...
Date Added: 2009-08-11 05:35:21

lect9.ppt
Path: Washington >> CS >> 461 Fall, 2009
Description: CSE 461: Distance Vector Routing Next Topic Focus How do we calculate routes for packets? Routing is a network layer function Routing Algorithms Distance Vector routing (RIP) Application Presentation Session Transport Network Data Link Physic...
Date Added: 2009-08-11 05:36:16

lecture20.ps
Path: Washington >> CS >> 461 Fall, 2009
Description: %!PS-Adobe-3.0 %BoundingBox: (atend) %Pages: (atend) %PageOrder: (atend) %DocumentFonts: (atend) %Creator: Frame 4.0 %DocumentData: Clean7Bit %EndComments %BeginProlog % % Frame ps_prolog 4.0, for use with Frame 4.0 products % This ps_prolog file is ...
Date Added: 2009-08-11 05:37:00

intro.ps
Path: Washington >> CS >> 401 Fall, 2009
Description: %!PS-Adobe-3.0 %BoundingBox: (atend) %Pages: (atend) %PageOrder: (atend) %DocumentFonts: (atend) %Creator: Frame 4.0 %DocumentData: Clean7Bit %EndComments %BeginProlog % % Frame ps_prolog 4.0, for use with Frame 4.0 products % This ps_prolog file is ...
Date Added: 2009-08-11 05:40:46

parse.ps
Path: Washington >> CS >> 401 Fall, 2009
Description: %!PS-Adobe-3.0 %BoundingBox: (atend) %Pages: (atend) %PageOrder: (atend) %DocumentFonts: (atend) %Creator: Frame 4.0 %DocumentData: Clean7Bit %EndComments %BeginProlog % % Frame ps_prolog 4.0, for use with Frame 4.0 products % This ps_prolog file is ...
Date Added: 2009-08-11 05:40:47

2mass_radec.txt
Path: Berkeley >> ASTRO >> 00213190 Fall, 2009
Description: #ra dec hmag dhmag 267.332476 -28.375654 16.553 13.741 267.359380 -28.379992 16.907 14.900 267.318131 -28.375170 15.377 13.299 267.364328 -28.380812 14.332 0.032 267.374882 -28.380352 15.778 13.508 267.348314 -28.382097 14.690 13.208 267.357256 -28.3...
Date Added: 2009-08-11 05:41:13

cse373-lecture01.pdf
Path: Washington >> CS >> 373 Fall, 2009
Description: Data Structures Yang Li (yangli@cs.washington.edu) TAs > Cam Thach Nguyen (ncthach@cs.washington.edu) > Si...
Date Added: 2009-08-11 05:42:32

lecture04.pdf
Path: Washington >> CS >> 373 Fall, 2009
Description: More on Lists CSE 373 Data Structures Lecture 4 Alternative Addition Use an auxiliary function >AddAux(p,q : node pointer, cb : integer) which returns the result of adding p and q and the carry/borrow cb. >Add(p,q) := AddAux(p,q,0) >Advantage: more ...
Date Added: 2009-08-11 05:42:49

contents.pdf
Path: Purdue >> STAT >> 503 Fall, 2008
Description: STAT 503 Contents Overview Aug. 21, 2006 1. Descriptive statistics Samples and populations Sample mean y and standard deviation s, Population mean and standard deviation Frequency distribution and histogram of data Quartile and median, Boxpl...
Date Added: 2009-08-11 05:46:30

T0433.t06.alpha-logo.pdf
Path: UCSC >> T >> 0433 Fall, 2009
Description: T0433.t06 alpha 3 2 1 1 10 20 30 40 E 3 2 1 H S H B S B E D E A B H 51 60 70 80 90 B S B E 3 2 1 H E B E S B I H S B H E A H 101 110 120 130 140 S 3 2 1 H S E A E S E H B H B H G S E A E 151 160 170 180 B S E ...
Date Added: 2009-08-11 05:47:36

ps01.pdf
Path: Rutgers >> UGRAD >> 342 Fall, 2009
Description: Physics 342: Problem Set #1 due February 5 You are encouraged to work in groups on these problems, but each student must write up the solutions individually. You must also list your collaborators on your solutions, and cite any external sources you u...
Date Added: 2009-08-11 05:48:31

lect1.pdf
Path: Rutgers >> GRAD >> 504 Fall, 2009
Description: Last Latexed: January 29, 2009 at 8:10 1 Physics 504, Lectures 1-2 Jan. 22 - 26, 2009 1 Lecture 1 Prof. Thomas covered Chapters 1-7 in Jackson, pretty completely, as I understand it. We will cover the remaining chapters, 8-16, but probably we will...
Date Added: 2009-08-11 05:48:50

atom1.pdf
Path: Rutgers >> GRAD >> 509 Fall, 2009
Description: KH Computational Physics- 2007 Multielectron atom in LDA Homework5: Bound states in the central potential I Compute energies of the bound states in central potential of the nucleus with charge Z . Verify that your algorithm can compute energies o...
Date Added: 2009-08-11 05:49:01

phys124s09-l12.pdf
Path: Rutgers >> UGRAD >> 124 Fall, 2009
Description: Physics 124 Spring 2009 Physics 124 Spring 2009 L12 17 Apr 2009 Physics 124, Spring 2009 Incomplete Draft Notes! Class web pages: http:/www.physics.rutgers.edu/ugrad/124 Go over HW before recitation, so you can ask specific questions: HW is usuall...
Date Added: 2009-08-11 05:49:29

muon-questions.pdf
Path: Rutgers >> UGRAD >> 389 Fall, 2009
Description: Proper lifetime of the muon Preparatory questions The muon is an elementary particle and one of the fundamental constituents of matter. Muons are very similar to electrons, apart from the fact that a muon has about 200 times more mass than an electro...
Date Added: 2009-08-11 05:49:37

Interview II.doc
Path: Penn State >> JBG >> 5017 Fall, 2009
Description: Inquiry Project: Organization 7 grade Teacher Interview Questions th 1. What are some of your expectations of incoming seventh graders regarding organization? - try to follow directions of teacher - \"I provide extreme structure\" - need t be show how...
Date Added: 2009-08-11 05:55:55

11.ps
Path: Allan Hancock College >> CS >> 3100 Fall, 2009
Description: #%-12345X@PJL JOB @PJL SET RESOLUTION = 600 @ @PJL ENTER LANGUAGE = POSTSCRIPT %!PS-Adobe-3.0 %Title: Microsoft Word - 11.doc %Creator: PSCRIPT.DRV Version 4.0 %CreationDate: 10/08/01 16:08:25 %BoundingBox: 14 13 581 829 %Pages: (atend) %PageOrder: S...
Date Added: 2009-08-11 05:58:51

10-plain-part2-bw.pdf
Path: Allan Hancock College >> CS >> 3100 Fall, 2009
Description: h~7|t w|wf \"u x $ u \"r r x ys x w v $r y p v $u t sU r q p `\"i a \"a \"V W Y U R $X U R R T U S I Q I $R $P $H R g hP a e P a d I U c f Y e c ...
Date Added: 2009-08-11 05:58:59

valid.txt
Path: Allan Hancock College >> CS >> 3100 Fall, 2009
Description: 0x00 halt - 0x01 nop - 0x02 bra A- S- R- 0x03 bgt A- S- R- 0x04 bge A- S- R- 0x05 blt A- S- R- 0x06 ble A- S- R- 0x07 beq A- S- R- 0x08 bne A- S- R- 0x09 beof A- S- R- 0x0A call A- S- R- 0x0B ret - 0x20 inew -r -c 0x21 iabs l-r L-r r-r i-r l-c L-c...
Date Added: 2009-08-11 05:59:14

CGraphAll.txt
Path: Eastern Washington University >> CSCD >> 320 Fall, 2008
Description: import java.io.*; /* * Exponential algorithms: extend Graph.java to allow the exponential algorithms that examine ALL paths @see The starting point is the method allPaths - based on Program 8-4 in Antonakos and Mansfield, \"Practical ...
Date Added: 2009-08-11 06:01:07

possibleExternalSurveys.ppt
Path: CSU San Marcos >> MKTG >> 442 Fall, 2009
Description: Possible External Surveys: \"First come, first served\" 1. Schmidts Boardhouse 2. Discount Campus Books 3. Barrels & Branches Skatesurf shop in Twin Oaks mall Discount retailer in Twin Oaks mall Positioning /branding of their nursery Marketing t...
Date Added: 2009-08-11 06:03:58

garagecom.pdf
Path: Stanford >> E >> 145 Fall, 2009
Description: ...
Date Added: 2009-08-11 06:08:54

YJR060W.t2k.dssp-ehl2-logo.pdf
Path: UCSC >> YJR >> 060 Fall, 2009
Description: YJR060W.t2k DSSP-EHL2 2 1 1 10 20 30 40 H 2 1 CCCCCCCCCCCCC X X H T C C C C C C C C C C C C C C H H H H H H H H H H H H H H H H H X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X CCCC C C CCCCCCCCCCCCC X X ...
Date Added: 2009-08-11 06:09:43

Hogan_2007_Ch4.pdf
Path: Illinois State >> SED >> 410 Fall, 2008
Description: ...
Date Added: 2009-08-11 06:11:34

lec7.pdf
Path: Washington >> CS >> 303 Fall, 2009
Description: \' $ CSE 303: Concepts and Tools for Software Development Dan Grossman Winter 2006 Lecture 7- Introduction to C: The C-Level of Abstraction & Dan Grossman CSE303 Winter 2006, Lecture 7 1 % \' $ Welcome to C Compared to Java, in rough order of i...
Date Added: 2009-08-11 06:17:35

homework5solns.doc
Path: VCU >> MATH >> 691 Fall, 2008
Description: CMSC/OPER 691-901 Fall 2003 Homework 5 Oilco Problem a. One minimum cost flow problem that will solve the given problem is i (c, u) j (420,5) 5 SD (100,5) (300,4) 4 LA (0,5) (110,4) 0 DA (1250,4) (1150,3) CH I -4 0 HO NY (1430,4) (1370,3) (0,...
Date Added: 2009-08-11 06:25:58

25769.txt
Path: UNC >> DOCS >> 25769 Fall, 2009
Description: The Project Gutenberg EBook of More Cargoes, by W. W. Jacobs This eBook is for the use of anyone anywhere at no cost and with almost no restrictions whatsoever. You may copy it, give it away or re-use it under the terms of the Project Gutenberg Lic...
Date Added: 2009-08-11 06:27:47

sample-final-cse326.pdf
Path: Washington >> CS >> 326 Fall, 2009
Description: Name: Email ID: Section: CSE 326, Data Structures Sample Final Exam Instructions: The exam is closed book, closed notes. Unless otherwise stated, N denotes the number of elements in the data structure under consideration. Answer each problem in the ...
Date Added: 2009-08-11 06:29:53

sol2.pdf
Path: Washington >> CS >> 326 Fall, 2009
Description: CSE326 Data Structures, Winter 2004 Dry assignment #2 - Solutions Problem 1. The first interpretation one could make from reading the text of the problem is that IDs are distributed to customers ahead of time and they don\'t necessarily reflect the o...
Date Added: 2009-08-11 06:30:11

dry3.pdf
Path: Washington >> CS >> 326 Fall, 2009
Description: CSE 326 Data Structures, Winter 2004 Dry assignment #3. Due date: 2/9/04 (submit at mid-term) 1. Given a binary tree, let li denote the number of leaves at depth i. For example, in the following tree l0=0, l1=1, l2=0, l3=2. h 1a. Prove that i= ...
Date Added: 2009-08-11 06:30:12

1999_10_07_Big_O_symbols.ppt
Path: Washington >> CS >> 326 Fall, 2009
Description: Order Notation Notation (informal) Dominance Examples Relation f(n) d g(n) Are In: n O(n) , n O(n2) Not in: n O(log(n), n2 O(n) Are In: n o(n2) Not in: n o(n), n o(log(n), n2 o(n) Are In: n (n) , n2 (n) Not in: log(n) (n), n (n2) Are In:...
Date Added: 2009-08-11 06:30:52

lecture13.ps
Path: Washington >> CS >> 326 Fall, 2009
Description: %!PS-Adobe-3.0 %BoundingBox: (atend) %Pages: (atend) %PageOrder: (atend) %DocumentFonts: (atend) %Creator: Frame 4.0 %DocumentData: Clean7Bit %EndComments %BeginProlog % % Frame ps_prolog 4.0, for use with Frame 4.0 products % This ps_prolog file is ...
Date Added: 2009-08-11 06:31:12

assignment3-clock.txt
Path: Washington >> CS >> 326 Fall, 2009
Description: Date: Mon, 23 Jan 1995 18:35:09 -0800 (PST) From: Paul Mikesell <mikesell@grizzly.cs.washington.edu> Subject: clock() To: Steve TANIMOTO <tanimoto@grizzly.cs.washington.edu> MIME-Version: 1.0 Content-Type: TEXT/PLAIN; charset=US-ASCII scottwb told...
Date Added: 2009-08-11 06:31:35

indexesandabstracts.doc
Path: Valdosta >> MLIS >> 7100 Fall, 2008
Description: Women Studies Abstracts Format Scope Relation to similar works Authority Treatment Arrangement Special Features Cost $300/year (institution rate) Print Published quarterly Previous issues Transaction Periodicals Consortium for National Information S...
Date Added: 2009-08-11 06:48:00

topic08.pdf
Path: SMU - Cox School of Business >> ENGR >> 8361 Fall, 2009
Description: Helgason EMIS 8361 Spring 2006[Topic 08] 1 Helgason EMIS 8361 Spring 2006[Topic 08] 2 Standard Particulars Notation Loan Processes The conventional loan is based on economic equivalence. The details of the loan agreement are called the loan par...
Date Added: 2009-08-11 06:55:09

YER111C.t2k.dssp-ebghstl-logo.pdf
Path: UCSC >> YER >> 111 Fall, 2009
Description: YER111C.t2k EBGHSTL 3 2 1 CC X 1 10 20 30 40 T 3 2 1 E H T H T E EE 51 CC TE CCET X X X X S S E X EHHHH H X X X X X G EE EE EE C H C H C E T E C S T C T T C C S T T H C H H C T E T C S C H H H H C T C S T C H X X X XGCX X X X ...
Date Added: 2009-08-11 07:06:20

YER117W.t2k.w0.5-logo.pdf
Path: UCSC >> YER >> 117 Fall, 2009
Description: YER117W.t2k w0.5 3 2 1 K M G X X X E I L V F A L G X X X X X X D L L V G G XXXXXX L L L L S XXXXXXXXXXXXXXXXX T Q G T S A L I L E D G T N C S S K V L T GA T V K A V I A DN T S I K V L CL I VV F L M A A I V I L V L X XXX...
Date Added: 2009-08-11 07:06:56

slides14.ppt
Path: Duke >> X >> 100 Fall, 2009
Description: A Rose by any other name.C or Java? q Why do we use Java in our courses (royal we?) Object oriented Large collection of libraries Safe for advanced programming and beginners Harder to shoot ourselves in the foot Why don\'t we use C+ (or C)? Stan...
Date Added: 2009-08-11 07:08:01

l27.ps
Path: Duke >> X >> 100 Fall, 2009
Description: %!PS-Adobe-3.0 %Title: (Microsoft PowerPoint - l27.ppt) %Version: 1 1 %CreationDate: 05:14:02 PM 12/05/2005 %For: (Administrator) %DocumentData: Clean7Bit %LanguageLevel: 2 %BoundingBox: 0 0 792 612 %HiResBoundingBox: 0.0 0.0 792.0 612.0 %Pages: 24 %...
Date Added: 2009-08-11 07:08:06

s30.ppt
Path: UNI >> CNS >> 051 Fall, 2009
Description: vti_encoding:SR|utf8-nl vti_author:SR|BEN-SCHAFER\\schafer vti_modifiedby:SR|BEN-SCHAFER\\schafer vti_timelastmodified:TR|11 May 2009 15:43:18 -0000 vti_timecreated:TR|16 Apr 2007 16:41:12 -0000 vti_title:SR|Slide 1 vti_assignedto:SR| vti_approvallevel...
Date Added: 2009-08-11 07:09:18

ch4b.ps
Path: Washington >> CSE >> 473 Fall, 2008
Description: %!PS-Adobe-2.0 %Creator: dvipsk 5.58f Copyright 1986, 1994 Radical Eye Software %Title: chapter04b.dvi %Pages: 5 0 %PageOrder: Ascend %Orientation: Landscape %BoundingBox: 0 0 612 792 %EndComments %BeginProcSet: PStoPS 1 15 userdict begin [/showpage/...
Date Added: 2009-08-11 07:16:20

Exam1_Solutions_2007.pdf
Path: Lake County >> ECE >> 476 Fall, 2009
Description: ...
Date Added: 2009-08-11 07:22:14

HW10.pdf
Path: Lake County >> ECE >> 313 Fall, 2009
Description: University of Illinois Spring 2005 ECE 413: Solutions to Problem Set 10 1. (a) It is easy to see that {Y > T } = ({X1 > T } {X2 > T } {X3 > T }) ({X1 > T } {X2 > T } {X3 T }) ({X1 > T } {X2 T } {X3 > T }) ({X1 T } {X2 > T } {X3 > T })...
Date Added: 2009-08-11 07:23:53

HD44780.pdf
Path: Colorado >> ASEN >> 4519 Fall, 2008
Description: HD44780U (LCD-II) (Dot Matrix Liquid Crystal Display Controller/Driver) ADE-207-272(Z) \'99.9 Rev. 0.0 Description The HD44780U dot-matrix liquid crystal display controller and driver LSI displays alphanumerics, Japanese kana characters, and symbols....
Date Added: 2009-08-11 07:25:03

Concepts for October 11.pdf
Path: National Taiwan University >> SOC >> 862 Fall, 2009
Description: Concepts for October 11 Hannan and Freeman Adaptation Selection Structural Inertia Population Analysis Blueprint Population Boundaries Niche Theory Generalist Specialist Excess Capacity Hannan and Freeman (inertia) Reliability Accountabili...
Date Added: 2009-08-11 07:25:56

asg1.pdf
Path: National Taiwan University >> SOC >> 487 Fall, 2009
Description: Sociology 487 Types of Sociological Inquiry Winter 2007 Professor Bob Kaufman Assignment 1: Choosing a Research Topic and Developing Propositions This assignment is intended to help you learn how to choose and develop a research topic. Therefore, t...
Date Added: 2009-08-11 07:26:12

YBR131C-A.t2k.alpha-logo.pdf
Path: UCSC >> YBR >> 131 Fall, 2009
Description: YBR131C-A.t2k ALPHA 2 1 E E XX H H X X X X X X X H H H H H HH E H XXXXHXXXXX X H I S H H I E HHB C I A T H H S X X X X X H H H H X H X X X X H H H 1 10 E H S I H S B H 20 MT LRH YFFLQDYK RNVENLPFYKNQAT L Q ...
Date Added: 2009-08-11 07:29:59

quiz5ans.pdf
Path: N. Illinois >> SEC >> 230 Fall, 2009
Description: Math 230 Section 2 Quiz #5 Solutions 3dy 1 + 9y 2 1. Evalutate . Use the substitution 3y = tan . Then 3dy = sec2 d and 1 + 9y 2 = sec2 . You get 3dy 1 + 9y 2 = sec2 d = sec sec d = ln | sec + tan | + C = ln | 1 + 9y 2 + 3y| + C. 2. Evaluate...
Date Added: 2009-08-11 07:36:30

e2pracans.pdf
Path: N. Illinois >> SEC >> 230 Fall, 2009
Description: Solutions to Practice Problems for Exam #2 1. Evaluate the following integrals. x1 a) dx (x 2)2 + 4 First use the substitution u = x 2 to make it look nicer (note that du = dx and x = u + 2, so x 1 = u + 1): x1 dx = (x 2)2 + 4 u+1 du. u2 + 4 So...
Date Added: 2009-08-11 07:36:31

230syl3.pdf
Path: N. Illinois >> SEC >> 230 Fall, 2009
Description: Homework assignments for Math 230 section 2 Dates Section Assignment Mar. 20 Mar. 21 8.7 8.7 1, 2, 9, 10, 11, 12 Zeno essay (due 3/24) 18, 22, 34, 47, 54, 63, 73, 76 Mar. Mar. Mar. Mar. 24 26 27 28 intro to series more about series more about s...
Date Added: 2009-08-11 07:36:32

email.ps
Path: Bethel VA >> CS >> 444 Fall, 2009
Description: %!PS-Adobe-2.0 %Creator: dvips(k) 5.95a Copyright 2005 Radical Eye Software %Title: email.dvi %Pages: 2 %PageOrder: Ascend %BoundingBox: 0 0 612 792 %DocumentFonts: CMBX12 CMBXTI10 CMR10 CMBX10 CMTT10 CMSY10 %DocumentPaperSizes: Letter %EndComments %...
Date Added: 2009-08-11 07:47:39

ECE291_L1.ppt
Path: Lake County >> ECE >> 390 Fall, 2009
Description: ECE291 Computer Engineering II Lecture 1 University of Illinois at Urbana- Champaign Your Instructor Josh Potts jpotts@uiuc.edu (217) 244-8032 Office Address 242 Everitt Lab Office Hours By Appointment January 16, 2001 ECE291 Your TAs Chris Jon...
Date Added: 2009-08-11 07:51:15

Su06Ch19_Solutions.pdf
Path: Southern Illinois University, Carbondale >> ACCT >> 322 Fall, 2008
Description: CHAPTER 19 Accounting for Income Taxes EXERCISE 19-6 (10-15 minutes) (a) (b) (c) (d) (e) (2) (1) (3) (1) (2) (f) (g) (h) (i) (j) (2) (3) (3) (3)* (1) *When the cost method is used for financial reporting purposes, the dividends are recognized in the...
Date Added: 2009-08-11 08:04:34

article 1.pdf
Path: University of Illinois, Urbana Champaign >> CHEM >> 590 Fall, 2008
Description: Published on Web 01/04/2003 Generation of a Bacterium with a 21 Amino Acid Genetic Code Ryan A. Mehl, J. Christopher Anderson, Stephen W. Santoro, Lei Wang, Andrew B. Martin, David S. King, David M. Horn, and Peter G. Schultz*, Contribution from the...
Date Added: 2009-08-11 08:11:15

jdb_1408.pdf
Path: UNC Charlotte >> CE >> 1202 Fall, 2009
Description: UNC Charlotte: Summary of Support Services for Students Question/Area of Concern I am having difficulty in a class. I do not know how I am doing in a class or have not gotten a grade. I need to establish or revise a plan of study. I need to enro...
Date Added: 2009-08-11 08:12:51

hw7.ps
Path: Washington >> CSE >> 321 Fall, 2008
Description: %!PS-Adobe-2.0 %Creator: dvips(k) 5.78 Copyright 1998 Radical Eye Software (www.radicaleye.com) %Title: hw.dvi %Pages: 1 %PageOrder: Ascend %BoundingBox: 0 0 612 792 %DocumentFonts: CMR10 CMBX12 CMBX10 CMMI10 CMSY10 %EndComments %DVIPSCommandLine: dv...
Date Added: 2009-08-11 08:20:16

Lecture08.pdf
Path: Washington >> CSE >> 321 Fall, 2008
Description: Announcements Readings CSE 321 Discrete Structures Winter 2008 Lecture 8 Number Theory: Modular Arithmetic Today: 3.4 (5th Edition: 2.4) Monday and Wednesday: 3.5, 3.6, 3.7 (5th Edition: 2.5, 2.6) Highlights from Lecture 7 Set Theory and ti...
Date Added: 2009-08-11 08:20:20

unix_tutorial.pdf
Path: CSB-SJU >> UT >> 370 Fall, 2009
Description: Unix Tutorial Due January 26/27 Those who do not understand Unix are condemned to reinvent it, poorly. Henry Spencer, University of Toronto Unix: Some say the learning curve is steep, but you only have to climb it once. Karl Lehenbauer 1 Introduc...
Date Added: 2009-08-11 08:36:31

hw3_answers.doc
Path: UCSB >> ECON >> 181 Spring, 2008
Description: Economics 181 Homework #3 Answers 1. Referring first to the AA/DD graphs, the drop in money demand shifts the AA curve out beyond its long run level in the short run. Thus the short run equilibrium is at point b, with increased output and exchange r...
Date Added: 2009-08-11 08:42:15

51403.pdf
Path: Graceland >> ONLINE >> 6633 Fall, 2009
Description: B. A. Degree - Elementary Education In addition to the general education requirements majors in Elementary Education must complete the Education requirements and one approved concentration. The following courses should be taken from North Central Mis...
Date Added: 2009-08-11 08:44:17

51403.pdf
Path: Graceland >> ONLINE >> 4619 Fall, 2009
Description: B. A. Degree - Elementary Education In addition to the general education requirements majors in Elementary Education must complete the Education requirements and one approved concentration. The following courses should be taken from North Central Mis...
Date Added: 2009-08-11 08:44:24

51403.pdf
Path: Graceland >> ONLINE >> 4668 Fall, 2009
Description: B. A. Degree - Elementary Education In addition to the general education requirements majors in Elementary Education must complete the Education requirements and one approved concentration. The following courses should be taken from North Central Mis...
Date Added: 2009-08-11 08:44:33

51403.pdf
Path: Graceland >> ONLINE >> 4672 Fall, 2009
Description: B. A. Degree - Elementary Education In addition to the general education requirements majors in Elementary Education must complete the Education requirements and one approved concentration. The following courses should be taken from North Central Mis...
Date Added: 2009-08-11 08:44:35

ISECON.2004.Janicki.pdf
Path: BYU Hawaii >> IS >> 2413 Fall, 2009
Description: Janicki Fri, Nov 5, 3:30 - 3:55, Ballroom B A Guide for Establishing an Advisory Board for an Information Systems Department: Benefits and Lessons Learned Thomas N. Janicki Information Systems Department University of North Carolina at Wilmington W...
Date Added: 2009-08-11 08:46:42

hw5sol.pdf
Path: UCSD >> CSE >> 140 Winter, 1998
Description: Homework 5 - Solutions 6.13 1) Draw the truth table for output (Q+) in terms of input J and K. 2) Since we are using a D flip-flop, use the excitation table to find the value of D for each input combination. 3) Find the logic equation for D in terms ...
Date Added: 2009-08-11 08:48:11

bridi15txt3.rtf
Path: Université du Québec à Montréal >> R >> 22714 Fall, 2009
Description: LOPUCKI, Lynn M.; \"The Case for Cooperative Territoriality in International Bankruptcy\" Michigan Law Review, Vol. 98, P. 2216, 2000 Paper ID: UCLA, School of Law Research Paper No. 01-4 Available from the SSRN Electronic Paper Collection: ABSTRACT: T...
Date Added: 2009-08-11 08:48:50

P2.ppt
Path: BYU >> ME >> 340 Fall, 2009
Description: Thermophysical Properties Calculator Jon Isaacson ME 4402 13 April 2005 Example: Problem 8.4 What if the liquids were at 327K instead of 300K? Engine Oil 330 K - 320 K 330 K - 327 K = 865.8kg / m3 - 871.8kg / m3 865.8kg / m3 - oil Mercury 350 K ...
Date Added: 2009-08-11 08:55:05

golub.pdf
Path: CSU LA >> BUS >> 515 Fall, 2009
Description: Has Globalization Created a Borderless World? Janet Ceglowski Does Trade with Low-Wage Countries Hurt American Workers? T Stephen Golub* ing of the causes and effects of wage disparities. The following quotation, from the concluding article in th...
Date Added: 2009-08-11 09:04:25

exam2s05.pdf
Path: Oklahoma State >> FP >> 6253 Fall, 2009
Description: ...
Date Added: 2009-08-11 09:05:35

ex0323.txt
Path: Hudson VCC >> STAT >> 141 Fall, 2009
Description: \'Change\' \'East/West\' 13.8 \'W\' 22.8 \'W\' 5.5 \'E\' 23.5 \'E\' 8.6 \'E\' 3.4 \'E\' 4.7 \'E\' 6.9 \'E\' 8.9 \'E\' 26.4 \'E\' 21.4 \'E\' 14.4 \'E\' 5.5 \'E\' 9.7 \'E\' 21.1 \'W\' 16.7 \'E\' 9.3 \'E\' 9.6 \'E\' 10.8 \'E\' 40 \'W\' 12.4 \'E\' 5.9 \'E\' 10.1 \'E\' 30.6 \'W\' 9.7 \'E\' 15.1 \'E\' 9.7 \'W\' 2...
Date Added: 2009-08-11 09:13:06

ch13.ppt
Path: UNF >> COP >> 4640 Fall, 2008
Description: Chapter 13 MS-DOS Operating System Understanding Operating Systems, Fourth Edition Objectives You should be able to describe: The historical significance of MS-DOS How MS-DOS provided a foundation for early Microsoft Windows releases The basics ...
Date Added: 2009-08-11 09:16:13

attachment.doc
Path: UVA >> CS >> 20080715 Fall, 2009
Description: s_spreader s_spreader height interface Spreader width HotSpot 4.1 Temperature.c void populate_package_R(.) /* lateral R\'s of spreader and sink */ p->r_sp1_x = getr(K_CU, (s_spreader-width)/4.0, (s_spreader+3*height)/4.0 * t_spreader); void popula...
Date Added: 2009-08-11 09:21:21

catinfo.txt
Path: Washington University in St. Louis >> MEXMRS >> 0528 Fall, 2009
Description: PDS_VERSION_ID = PDS3 RECORD_TYPE = STREAM OBJECT = TEXT PUBLICATION_DATE = 2007-09-05 NOTE ...
Date Added: 2009-08-11 09:41:36

ps15-ans.pdf
Path: Marshall >> CH >> 340 Fall, 2009
Description: ECN340 - Global Macro Issues Allen J. W ilkins November 6, 2006 Name PS-Ch15 E .R . system s past and present Note: To earn credit, answers to all questions must be accompanied by supporting information or logical argument that demonstrates the con...
Date Added: 2009-08-11 09:42:14

catinfo.txt
Path: Washington University in St. Louis >> MEXMRS >> 0579 Fall, 2009
Description: PDS_VERSION_ID = PDS3 RECORD_TYPE = STREAM OBJECT = TEXT PUBLICATION_DATE = 2007-09-05 NOTE ...
Date Added: 2009-08-11 09:43:20

wk9q4.txt
Path: Allan Hancock College >> WEEK >> 2291 Fall, 2009
Description: Tree Canopy Circumf Height Distance 1 1112 530 5 22 2 910 320 6 19 3 1196 730 6 28 4 520 150 5 14 5 1580 740 ...
Date Added: 2009-08-11 09:48:07

wk9q2.txt
Path: Allan Hancock College >> WEEK >> 2291 Fall, 2009
Description: Colony Area Population W._Unst 207.7 311 Hermanes 1570.0 3872 N.E._Uns 1588.0 2650 W._Yell 125.7 134 Buravoe 353.4 485 Fetlar 931.0 372 Out_Sker 1616.0 2850 Noss ...
Date Added: 2009-08-11 09:48:07

Week4.ppt
Path: East Los Angeles College >> TERM >> 2525 Fall, 2009
Description: More about ORACLE OBJECT TYPES Object types were first introduced into the Oracle8 RDBMS (the \"object-relational\" model) Oracle uses object types in many of its new features (e.g., Oracle AQ, the XML datatype) Few development shops work with objec...
Date Added: 2009-08-11 09:48:40

341-Fall02-p4-sample_output.txt
Path: UMBC >> CMSC >> 341 Fall, 2001
Description: For this input: I 10 I 20 I 30 I 40 PM IK 10 100 DK 40 40 PM DM PM PT You might get the following output: The minimum element is 10 The minimum element is 0 The minimum element in 20 Milliseconds used so far - 0...
Date Added: 2009-08-11 09:50:23

outline.pdf
Path: Duke >> STA >> 121 Fall, 2008
Description: What have we done so far? Graphical Analysis Plot data, summary statistics, etc. Does the relationship between y and x look linear? Simple linear regression Assuming that the relationship between y and x is linear Conducted simple linear regres...
Date Added: 2009-08-11 09:53:18

GIG.doc
Path: Penn State >> SMW >> 326 Fall, 2009
Description: FTCAP Interest Surveys Groups Investigating God (GIG) June 12, 2006 Carolyn Serene cjs5193@psu.edu June 13, 2006 No interest June 14, 2006 Greg Braden mudd55@connecttime.net June 15, 2006 Torin Stover Torin316@nb.net June 19, 2006 No interest June 20...
Date Added: 2009-08-11 10:07:54

checklist.docx
Path: George Mason >> ISE >> 632 Fall, 2009
Description: Please add your comments about any i tem. Include any additional criteria you feel should be addressed. The following ratings refer to Shneiderman\'s five \"Measurable human factors goals\", or criteria. First, determine the importance. Rank the criteri...
Date Added: 2009-08-11 10:18:05

randomized.analysis.ps
Path: Duke >> X >> 237 Spring, 2009
Description: %!PS-Adobe-3.0%Title: (Microsoft Word - randomized.analysis.doc)%Creator: (Microsoft Word: PSPrinter 8.3.1)%CreationDate: (2:44 PM Monday, January 14, 2002) %For: (reif)%Pages: 40%DocumentFonts: Times-Roman Times-Bold Times-BoldItalic Times-Italic He...
Date Added: 2009-08-11 10:25:30

specs_8.pdf
Path: Penn State >> EMCH >> 213 Fall, 2009
Description: Introduction to Standards and Specifications for Design in Mechanics or Strength of Materials Georginna Lucas and Lisa Hatcher Purpose The purpose of this introduction to specifications for design is (1) to make users aware of various standards whic...
Date Added: 2009-08-11 10:26:29

change.doc
Path: Texas A&M >> GROUP >> 645 Fall, 2009
Description: Social studies programs should include experiences that provide for the study of the ways human beings view themselves in and over time. Human beings seek to understand their historical roots and to locate themselves in time. Such understanding in...
Date Added: 2009-08-11 10:33:47

core.txt
Path: UCF >> COMS >> 641 Fall, 2009
Description: Com S 641 meeting -*- Outline -*- * core imperative language (Schmidt 1.1) - CORE OF A PROGRAMMING LANGUAGE def: the *core* of a programming language Examples: - . is the values and operations that establish its fundamental capab...
Date Added: 2009-08-11 10:53:53

PracticeExam3.pdf
Path: Dartmouth >> PROBS >> 0405 Winter, 2009
Description: Chem 5 Winter, 2005 Practice Exam 3 (the actual third exam last year) 1. (7 + 7 points) Benzene, C6H6, is a volatile liquid at room temperature, meaning it has an appreciable vapor pressure. Listed below are thermodynamic data on both the liquid an...
Date Added: 2009-08-11 10:59:30

Perlis syllabus 06.pdf
Path: LSU >> APPL >> 003 Fall, 2008
Description: Course Syllabus Math 1100: The Nature of Mathematics Louisiana State University-Baton Rouge Time and Location: Mon. & Wed., 8:10-9:30, Campbell Auditorium A service-learning course, Fall 2006 Instructor: Robert Perlis Lockett Hall 212 Tel: (225) 578-...
Date Added: 2009-08-11 11:01:37

Poster.pdf
Path: Binghamton >> MATH >> 386 Fall, 2009
Description: Proposal Addition of a poster session to the course syllabus. The class consensus is that a project in combinatorics is a good thingTM . The motion is to add a poster session to the course syllabus. Working alone or in a group of two, you will resear...
Date Added: 2009-08-11 11:03:26

tuckereval20001.pdf
Path: Wisc Stevens Point >> CHENS >> 916 Fall, 2009
Description: ...
Date Added: 2009-08-11 11:07:15

hirschevaltwo.pdf
Path: Wisc Stevens Point >> CHENS >> 916 Fall, 2009
Description: ...
Date Added: 2009-08-11 11:07:16

Iampoem.pdf
Path: Wisc Stevens Point >> CHENS >> 916 Fall, 2009
Description: I Am. Directions: 1. Using the template below, create a poem about yourself. It is important that the poem includes detail and appropriate word choice. 2. A final copy of your poem should be displayed somewhere on your selfportrait. 3. Use details fr...
Date Added: 2009-08-11 11:07:24

slides.ps
Path: Allan Hancock College >> COMP >> 284 Fall, 2009
Description: %!PS-Adobe-2.0 %Creator: dvips(k) 5.95a Copyright 2005 Radical Eye Software %Title: slides.dvi %Pages: 64 %PageOrder: Ascend %Orientation: Landscape %BoundingBox: 0 0 595 842 %DocumentFonts: CMBX12 CMR12 CMR5 CMR10 CMBX10 CMTI10 CMTT10 CMSY10 %+ CMSY...
Date Added: 2009-08-11 11:08:07

link to GrowthRatesWkst.pdf
Path: N.E. Illinois >> MAT >> 2345 Fall, 2009
Description: MAT 2345 Worksheet 3 Name: Comparison of Function Growth Rates 1. Order the following functions by their growth rates, from slowest growing to fastest growing: n 2 n n n n n2 37 n log n n2 log n 8 9 10 n log2 n n3 11 n log(log n) n log...
Date Added: 2009-08-11 11:18:23

Study_Guide_Exam_4.doc.pdf
Path: Washington >> P >> 101 Fall, 2009
Description: SECTION 4 STUDY GUIDE You are responsible for all lectures, as well as: Chapter 14, all Chapter 15, all Chapter 10 (353-361 only) Chapter 13, all DSM IV (know the five axes) General diagnostic symptoms of each disorder Eating disorders (bulimia, anor...
Date Added: 2009-08-11 11:20:09

17260.txt
Path: University of Illinois, Urbana Champaign >> CS >> 17260 Fall, 2009
Description: The Project Gutenberg EBook of Tempest and Sunshine by Mary J. Holmes This eBook is for the use of anyone anywhere at no cost and with almost no restrictions whatsoever. You may copy it, give it away or re-use it under the terms of the Project Gut...
Date Added: 2009-08-11 11:35:17

StudyQuestions_Temkin.doc
Path: Allegheny >> SPIDER >> 315 Fall, 2009
Description: Study Questions for Temkin, The Falling Sickness, Chapter II. 1. What is the difference between a disease, a disorder and a syndrome? How are these distinctions relevant to epilepsy? 2. What were the three primary sects in existence during the time o...
Date Added: 2009-08-11 11:37:08

l20.ppt
Path: Duke >> X >> 100 Fall, 2009
Description: Binary Trees Linked lists: efficient insertion/deletion, inefficient search ArrayList: search can be efficient, insertion/deletion not Binary trees: efficient insertion, deletion, and search trees used in many contexts, not just for searching, e....
Date Added: 2009-08-11 11:50:57

l34.pdf
Path: Duke >> X >> 100 Fall, 2009
Description: On the Limits of Computing Reasons for Failure 1. 2. 3. Runs too long o Real time requirements o Predicting yesterday\'s weather Non-computable ! Don\'t know the algorithm Time Space Complexity, N Tractable and Intractable CompSci 100E 34.1...
Date Added: 2009-08-11 11:51:04

4l07.pdf
Path: Duke >> X >> 100 Fall, 2009
Description: Analyzing Algorithms Analyzing Algorithms Remember SortByFreqs APT Problem: Start with array of words (Strings) Find frequency of each word Return array of words ordered from most frequent to least (In case of a tie, return in alphabetical o...
Date Added: 2009-08-11 11:51:15

slidese09.ppt
Path: Duke >> X >> 100 Fall, 2009
Description: From doubly-linked lists to binary trees q Instead of using prev and next to point to a linear arrangement, use them to divide the universe in half Similar to binary search, everything less goes left, everything greater goes right \"koala\" How ...
Date Added: 2009-08-11 11:52:08

s13.ppt
Path: UNI >> CNS >> 051 Fall, 2009
Description: Session 13 Scaling PA01 We spent about 10 minutes talking about what I was looking for in makeGrayscale() What can I do when things aren\'t the size I want? Scaling Down My camera takes photos at 2304 x 1708 pixels. That is WAY too big for posting...
Date Added: 2009-08-11 12:01:20

rfc811.txt
Path: Allan Hancock College >> RFC >> 0500 Fall, 2009
Description: Ken Harrenstien RFC-811 Vic White 1 March 1982 Elizabeth Feinler Network Information Center SRI International HOSTNAMES SERVER INTRODUC...
Date Added: 2009-08-11 12:08:51

rfc814.txt
Path: Allan Hancock College >> RFC >> 0500 Fall, 2009
Description: RFC: 814 NAME, ADDRESSES, PORTS, AND ROUTES David D. Clark MIT Laboratory for Computer Science Computer Systems and Communications Group ...
Date Added: 2009-08-11 12:08:52

rfc962.txt
Path: Allan Hancock College >> RFC >> 0500 Fall, 2009
Description: Network Working Group M. A. Padlipsky Request for Comments: 962 Mitre-Bedford November 1985 ...
Date Added: 2009-08-11 12:09:16

rfc3402.txt
Path: Allan Hancock College >> RFC >> 3000 Fall, 2009
Description: Network Working Group M. Mealling Request for Comments: 3402 Verisign Obsoletes: 2915, 2168 October 2002 Category: Standards Track...
Date Added: 2009-08-11 12:09:49

rfc4416.txt
Path: Allan Hancock College >> RFC >> 4000 Fall, 2009
Description: Network Working Group J. Wong, Ed. Request for Comments: 4416 Nortel Networks Category: Informational February 2006 Goals for Internet ...
Date Added: 2009-08-11 12:11:09

rfc4437.txt
Path: Allan Hancock College >> RFC >> 4000 Fall, 2009
Description: Network Working Group J. Whitehead Request for Comments: 4437 U.C. Santa Cruz Category: Experimental G. Clemm ...
Date Added: 2009-08-11 12:11:12

rfc1110.txt
Path: Allan Hancock College >> RFC >> 1000 Fall, 2009
Description: Network Working Group A. McKenzie Request for Comments: 1110 BBN STC August 1989 A Probl...
Date Added: 2009-08-11 12:11:36

rfc2549.txt
Path: Allan Hancock College >> RFC >> 2500 Fall, 2009
Description: Network Working Group D. Waitzman Request for Comments: 2549 IronBridge Networks Updates: 1149 1 April 1999 Category: Experimental ...
Date Added: 2009-08-11 12:12:33

rfc1867.txt
Path: Allan Hancock College >> RFC >> 1500 Fall, 2009
Description: Network Working Group E. Nebel Request For Comments: 1867 L. Masinter Category: Experimental Xerox Corporation ...
Date Added: 2009-08-11 12:14:56

rfc4586.txt
Path: Allan Hancock College >> RFC >> 4500 Fall, 2009
Description: Network Working Group C. Burmeister Request for Comments: 4586 R. Hakenberg Category: Informational A. Miyazaki ...
Date Added: 2009-08-11 12:15:25

sams_intro.pdf
Path: Mercer >> CSC >> 20070521 Fall, 2009
Description: ...
Date Added: 2009-08-11 12:16:26

core.txt
Path: UCF >> COMS >> 541 Fall, 2009
Description: Com S 641 meeting -*- Outline -*- * core imperative language (Schmidt 1.1) - CORE OF A PROGRAMMING LANGUAGE def: the *core* of a programming language Examples: - . is the values and operations that establish its fundamental capab...
Date Added: 2009-08-11 12:23:02

Final5180Hiv2004.doc
Path: Université du Québec à Montréal >> INFO >> 5180 Fall, 2009
Description: Nom Code permanent Question # 1 (10 pts) Soit le schma relationnel suivant : <Table> <Table> Professeur {Cl primaire : codeProfesseur} codeProfesseur : CHAR(5) nom : VARCHAR(10) prnom : VARCHAR(10) Session {Cl primaire : codeSession} codeSession...
Date Added: 2009-08-11 12:23:22

slides6.ppt
Path: Duke >> X >> 004 Fall, 2009
Description: Searching and Hierarchies q SSAHA used buckets and hashing Precomputation to create buckets of possibilities Look in appropriate buckets for \"hits\" Ideally buckets contain few items What if we need a different kind of search? Hashing doesn\'t rea...
Date Added: 2009-08-11 12:34:26

ProgRep1.pdf
Path: Oakland University >> CSE >> 498 Fall, 2009
Description: Robust Conformational Sampling via Flexible Dihedrals Paul Brenner and David Salyers CSE 598k October 14, 2004 I. NOTES TO INSTRUCTOR In order to maintain a comprehensive reporting style this document will be updated periodically in line with the rep...
Date Added: 2009-08-11 12:34:36

PS119.lec_5.2005.10.05.doc
Path: Concordia Chicago >> WEB >> 119 Fall, 2009
Description: PhySci 119 Lecture 5 Oct. 5, 2005 Music,opening:RimskyKorsakov(18441908),FlightoftheBumble Bee,performedfirstin1901.FromTsarofSultan.Thecomposer receivedformaltraininginmusiconlylaterinlife,yetstillcreateda completelyoriginalpiecesuchasthis. Openinga...
Date Added: 2009-08-11 12:38:53

XML Introduction.ppt
Path: FIU >> N >> 6727 Fall, 2009
Description: XML Introduction By Hongming Yu Feb 6th, 2002 Index Markup Language: SGML, HTML, XML An XML example Why is XML important XML introduction XML applications XML support Markup Language A markup language must specify What mark...
Date Added: 2009-08-11 13:12:05

hugedna2.txt
Path: Duke >> X >> 006 Fall, 2009
Description: C79 ctgagctaaggacgcccacaagggaaacgcatagtctgaaaacatgatat agtcttgtactttgatccaagtgcctgtacctgaaagtttgaccacccat ctggtgccgtttctaccggctcgaatcaatggggcttctctgtagtgttt cagaactcgaacggcgcccaacttttgcacactcttcccaatgaggatat ttagcttgcgtgcX B5 gggctccttgacgacccatgtta...
Date Added: 2009-08-11 13:23:12

golf.txt
Path: UPenn >> STAT >> 102 Fall, 2004
Description: [LEXIS(R)-NEXIS(R)] [Main Menu] [Help] [Sources] [Results List] [Return to Search] [Previous Document] [Next Document] [Full View] [Kwic View] -- ...
Date Added: 2009-08-11 13:49:29

hw4-sol.ps
Path: Texas A&M >> CS >> 629 Fall, 2009
Description: %!PS-Adobe-2.0 %Creator: dvipsk 5.516a Copyright 1986, 1993 Radical Eye Software %Title: sol4.dvi %Pages: 3 %PageOrder: Ascend %BoundingBox: 0 0 612 792 %EndComments %DVIPSCommandLine: dvips sol4.dvi %DVIPSSource: TeX output 1999.04.14:1433 %BeginPro...
Date Added: 2009-08-11 13:52:58

L5.NPCompleteness.pdf
Path: Texas A&M >> CS >> 311 Fall, 2009
Description: AIAX yIAItg~ rrtXiUm5yg!5XXg !tyXy2gXh2~gh2y~UyyPBijiT | s } | { z x v t s q p 0U~iywur2o n s f w k cvmlg f s jivh f e w gxydc x i i s ...
Date Added: 2009-08-11 13:53:07

readme.txt
Path: Old Dominion >> CS >> 477 Fall, 2009
Description: = MICROSOFT FOUNDATION CLASS LIBRARY : setTitle2 = AppWizard has created this setTitle2 application for you. This application not only demonstrates the basics of using the Microsoft Foundation classes but is also a starting point for writin...
Date Added: 2009-08-11 14:00:26

01-Introduction.pdf
Path: Washington >> CSE >> 477 Spring, 2008
Description: CSE490D Design Studio Last Quarter Exploration (for CompE Capstone 2008) Learn about problems/issues Discuss possible projects generate ideas This quarter Design Propose and vet solutions Investigate related work Sketch architecture Determine ...
Date Added: 2009-08-11 14:00:27

6_11_09.pdf
Path: Rutgers >> CHEM >> 308 Fall, 2009
Description: ...
Date Added: 2009-08-11 14:19:45

Chp16.pdf
Path: Colgate >> MATH >> 102 Fall, 2009
Description: Part V. Chance Variability Chapter 16: The Law of Averages A foreshadowing example A good example of where we will be going with statistical analysis and chance variation is embodied in Review Exercise 15.11 [p. 262]: Is the observation of a smoker...
Date Added: 2009-08-11 14:22:27

L5.NPCompleteness.pdf
Path: Texas A&M >> CSE >> 311 Fall, 2009
Description: AIAX yIAItg~ rrtXiUm5yg!5XXg !tyXy2gXh2~gh2y~UyyPBijiT | s } | { z x v t s q p 0U~iywur2o n s f w k cvmlg f s jivh f e w gxydc x i i s ...
Date Added: 2009-08-11 14:26:15

hw4-sol.ps
Path: Texas A&M >> CSE >> 629 Fall, 2009
Description: %!PS-Adobe-2.0 %Creator: dvipsk 5.516a Copyright 1986, 1993 Radical Eye Software %Title: sol4.dvi %Pages: 3 %PageOrder: Ascend %BoundingBox: 0 0 612 792 %EndComments %DVIPSCommandLine: dvips sol4.dvi %DVIPSSource: TeX output 1999.04.14:1433 %BeginPro...
Date Added: 2009-08-11 14:26:17

200301manual.pdf
Path: UCSC >> CMPE >> 001 Fall, 2009
Description: Computer Engineering 012c University of California, Santa Cruz Alexandra Carey <fire@cse.ucsc.edu> Cliffton McIntire <mcintire@acm.org> Joel Ferguson <fjf@cse.ucsc.edu> Richard Hughey <rph@cse.ucsc.edu> The Happy Assembly Class Table of Contents ...
Date Added: 2009-08-11 14:32:52

bearman_chains.pdf
Path: Washington >> SOC >> 504 Fall, 2008
Description: Chains of Affection: The Structure of Adolescent Romantic and Sexual Networks1 Peter S. Bearman Columbia University James Moody Ohio State University Katherine Stovel University of Washington This article describes the structure of the adolescent ro...
Date Added: 2009-08-11 17:50:12

hw2.pdf
Path: University of Toronto >> CSC >> 373 Fall, 2009
Description: CSC 373H5 S Homework Assignment # 2 Winter 2006 Due: In tutorial on February 17 by 12:10pm 1. [15 marks] An independent set S is a set of vertices of a graph such that no two vertices in S are adjacent (no pair of vertices are joined by an edge). ...
Date Added: 2009-08-11 18:02:49

H13--CSC458.pdf
Path: University of Toronto >> CSC >> 458 Fall, 2009
Description: Professor Yashar Ganjali Department of Computer Science D t t fC t S i University of Toronto yganjali@cs.toronto.edu http:/www.cs.toronto.edu/ yganjali http:/www cs toronto edu/~yganjali Announcements Programming assignment 2 Due: Fri. Nov. 28th at...
Date Added: 2009-08-11 18:04:42

Chap012
Path: Loyola New Orleans >> FIN >> 315 Spring, 2009
Description: ...
Date Added: 2009-08-12 19:20:39

BIOL125_Ch14 Notes
Path: San Jacinto >> BIOL >> 125 Spring, 2009
Description: ...
Date Added: 2009-08-12 23:36:30

ch11.5
Path: Middle East Technical University >> DIFF >> 2343632 Fall, 2009
Description: ...
Date Added: 2009-08-13 08:15:05

gene expression 008
Path: Collin College >> BIO >> 1406 Summer, 2009
Description: ...
Date Added: 2009-08-13 21:56:03

midterm2studyguide.pdf
Path: Rutgers >> MATH >> 136 Fall, 2008
Description: Second Midterm Study Guide Approximately fifty percent of the exam will be on the convergence of specific series. Given a series, you\'ll need to be able to identify and apply whichever of the following tests is most appropriate for determining its ab...
Date Added: 2009-08-14 00:17:08

dolan59701sp06.pdf
Path: National Taiwan University >> PS >> 597 Fall, 2009
Description: Political Science 597.01: Nationalism and Interdependence Theme: Mass-Elite Interactions in Foreign Policy-Making Spring Quarter 2006 Instructor: Thomas M. Dolan Class: Tuesday-Thursday 9:30-11:18, 2019 McPherson Labs Office: 2012 Derby Hall, Office ...
Date Added: 2009-08-14 00:17:38

20 Bike Design.ppt
Path: Iowa State >> CE >> 453 Fall, 2009
Description: BICYCLE FACILITIES 1 DESIGN OUTLI NE \"De sign\" ve hicle \"De sign\" use r De sign param te e rs Thede sign proce ss Horizontal and ve rtical alignm nt e 2 THE \"DES GN\" VEHI C I LE Road Off-road Hybrid Re cum nt be 3 RO BI KES AD \"Tra...
Date Added: 2009-08-14 00:18:51

litrev.pdf
Path: Washington >> PAUS >> 9131 Fall, 2009
Description: UNIVERSITY OF WASHINGTON Psychology Writing Center 3937 15th Avenue NE Box 351525 Phone: 206.685.8278 psywc@u.washington.edu http:/depts.washington.edu/psywc/handouts.shtml Writing a Psychology Literature Review There are two main approaches to a l...
Date Added: 2009-08-14 00:20:49

Spring_Workshops.pdf
Path: New Haven >> UNH >> 04142008 Fall, 2009
Description: Spring 2008 Workshop Schedule * Sponsored By Career Services * Interview Skills Dodd\'s 204 Tuesday 2/5: Thursday 2/21: Thursday 3/13: Thursday 3/27: Tuesday 4/15: Tuesday 4/29: 12:15-1:15 pm 12:15-1:15 pm 5:00-6:00 pm 5:00-6:00 pm 2:30-3:30 pm - Dod...
Date Added: 2009-08-14 00:25:58

hw3.pdf
Path: University of Illinois, Urbana Champaign >> CS >> 273 Spring, 2008
Description: ...
Date Added: 2009-08-14 00:28:22

practicefinalsol_fa06.pdf
Path: Cornell >> WEB >> 1920 Fall, 2009
Description: Solutions to the Practice Problems for the Final, Fall 2006 1. Find the plane that contains the lines L1 : x = 1 + t, y = 1 - t, z = -t and L2 : x = 1 + 3t, y = -3t, z = -3 - 3t. SOLUTION: The lines are parallel. We choose two points on L1 , say (1, ...
Date Added: 2009-08-14 00:33:25

Spring_Workshops.pdf
Path: New Haven >> UNH >> 03102008 Fall, 2009
Description: Spring 2008 Workshop Schedule * Sponsored By Career Services * Interview Skills Dodd\'s 204 Tuesday 2/5: Thursday 2/21: Thursday 3/13: Thursday 3/27: Tuesday 4/15: Tuesday 4/29: 12:15-1:15 pm 12:15-1:15 pm 5:00-6:00 pm 5:00-6:00 pm 2:30-3:30 pm - Dod...
Date Added: 2009-08-14 00:35:41

HW04.pdf
Path: Lake County >> ECE >> 556 Fall, 2009
Description: University of Illinois Fall 2005 ECE 556/CS 577/MATH 579: Solutions to Problem Set 4 1. Number the positions from 0 to 15, i.e. the number is x1 + 2x2 + 4x3 + 8x4 . Now, let f (x) = a1,2 x1 x2 + a1,3 x1 x3 + a1,4 x1 x4 + a2,3 x2 x3 + a2,4 x2 x4 + a...
Date Added: 2009-08-14 00:47:46

chap11.pdf
Path: Lake County >> ECE >> 403 Fall, 2009
Description: 144 Chapter 11 Audio Coding Audio coding is the process of obtaining a compact representation of audio signals for efficient transmission over band-limited wired and wireless channels and/or storage. Today, audio coders have become essential compon...
Date Added: 2009-08-14 01:02:17

week_10_section
Path: Berkeley >> ECON >> 136 Fall, 2006
Description: ...
Date Added: 2009-08-14 08:17:41

Get Started With Course Hero Today!

Get study guides, join study groups, and more!
Sign up in seconds with your Facebook account!
Course Hero is a Facebook Application Partner.
Click below to sign-up for FREE.
 

Our Social Learning Network was built to provide students and key learning partners like professors a platform to share, meet and collaborate while accelerating their comprehension of course-related theories and concepts. We are committed to providing you immediate access to a growing wealth of study materials and an unparalleled academic network of students, professors and other key partners.

Why do you care? Because you want the best grade possible and at times need a 24/7 resource that’s responsive to your needs.

What People Are Saying About Course Hero

“I was going to fail my Evidence exam, but then I found a great outline on Course Hero!”
- Kim Cowan, Cornell University



“I worked for tens of hours on my chemistry lab reports this semester, and now I can publish my hard work to thousands of people who care to read about what I found.”
- David Grauer, Princeton University




“Many times, students learn best from other students, their peers, rather than from a teacher.  Course Hero provides such a forum for students to teach students.”
- Somerset Perry, Georgetown University


“Course Hero is a great new research tool for college students.  Students can find lots of pertinent information to their studies that they previously could not find or have access to.  It’s for sure an educational innovation and potentially an educational revolution.”
- Andy Suiter, UCLA and UC Davis



“As a freshman, Course Hero will help me to decide what I am actually interested in studying in college.”
- Caity Feindt, Ithaca College



“I have found lecture notes on corporate finance created by students from multiple schools, which has really helped me learn more about the subject.”
- John Stacey III, UCSB



“I study less and learn more with Course Hero.”
- John Sweazey, CU-Boulder



 

Explore the benefits of joining Course Hero's social learning network.

Get millions of study materials now!

Need lecture notes for a missed class or want insightful explanation of the theories and concepts you learn in class? Look no further, Course Hero’s Study Materials empowers you to find a broad and deep set of materials that can help you right now!

Click below to sign-up for FREE.
 

Get over 200,000 textbook solutions now!

Having difficulty with your homework and need documents that are relevant for your Textbook? Don't be frustrated. Course Hero's Textbook Help presents you study materials from many college courses.

Click below to sign-up for FREE.
 

Meet over 300,000 students and your fellow classmates now!

Want to meet your current classmates or those that took the class last year? Don’t worry or have anxiety. Course Hero’s Study Groups gives you the seamless opportunity to develop both anonymous or direct relationships with those classmates whom you want to meet and get help from right now!

Click below to sign-up for FREE.
 

Course Hero is not sponsored or endorsed by any college or university.