Course Solutions And Notes - 487718d6 29
| 3df5.pdf Path: Wisconsin >> WILL >> 0069 Fall, 2009 Description: ... Date Added: 2009-06-24 10:39:22 |
| 3ef1.pdf Path: Wisconsin >> WILL >> 0069 Fall, 2009 Description: ... Date Added: 2009-06-24 10:40:17 |
| 3b9b6b37.pdf Path: Wisconsin >> WILL >> 0051 Fall, 2009 Description: ... Date Added: 2009-06-24 10:42:03 |
| 24a3.pdf Path: Wisconsin >> WILL >> 0061 Fall, 2009 Description: ... Date Added: 2009-06-24 10:42:56 |
| 24ba.pdf Path: Wisconsin >> WILL >> 0061 Fall, 2009 Description: ... Date Added: 2009-06-24 10:43:00 |
| 1c45.pdf Path: Wisconsin >> WILL >> 0059 Fall, 2009 Description: ... Date Added: 2009-06-24 10:44:41 |
| 3b9ad9c9.pdf Path: Wisconsin >> WILL >> 0005 Fall, 2009 Description: ... Date Added: 2009-06-24 10:46:03 |
| 3b9ad9f4.pdf Path: Wisconsin >> WILL >> 0005 Fall, 2009 Description: ... Date Added: 2009-06-24 10:46:13 |
| 3b9ada44.pdf Path: Wisconsin >> WILL >> 0005 Fall, 2009 Description: ... Date Added: 2009-06-24 10:46:29 |
| 3b9adb28.pdf Path: Wisconsin >> WILL >> 0005 Fall, 2009 Description: ... Date Added: 2009-06-24 10:46:50 |
| 3b9ae8f4.pdf Path: Wisconsin >> WILL >> 0020 Fall, 2009 Description: ... Date Added: 2009-06-24 10:47:56 |
| 3b9ae84e.pdf Path: Wisconsin >> WILL >> 0020 Fall, 2009 Description: ... Date Added: 2009-06-24 10:48:14 |
| 3b9ae90b.pdf Path: Wisconsin >> WILL >> 0020 Fall, 2009 Description: ... Date Added: 2009-06-24 10:48:20 |
| 3b9b253a.pdf Path: Wisconsin >> WILL >> 0032 Fall, 2009 Description: ... Date Added: 2009-06-24 10:49:55 |
| 3b9b264f.pdf Path: Wisconsin >> WILL >> 0032 Fall, 2009 Description: ... Date Added: 2009-06-24 10:50:10 |
| 3b9b2558.pdf Path: Wisconsin >> WILL >> 0032 Fall, 2009 Description: ... Date Added: 2009-06-24 10:50:39 |
| 3b9b558a.pdf Path: Wisconsin >> WILL >> 0045 Fall, 2009 Description: ... Date Added: 2009-06-24 10:52:12 |
| 487796a4.pdf Path: Wisconsin >> WILL >> 0119 Fall, 2009 Description: ... Date Added: 2009-06-24 10:52:21 |
| 487796da.pdf Path: Wisconsin >> WILL >> 0119 Fall, 2009 Description: ... Date Added: 2009-06-24 10:52:30 |
| 487798b6.pdf Path: Wisconsin >> WILL >> 0119 Fall, 2009 Description: ... Date Added: 2009-06-24 10:52:57 |
| 487745e9.pdf Path: Wisconsin >> WILL >> 0095 Fall, 2009 Description: ... Date Added: 2009-06-24 10:53:30 |
| 4877453e.pdf Path: Wisconsin >> WILL >> 0095 Fall, 2009 Description: ... Date Added: 2009-06-24 10:54:26 |
| 3b9afdcc.pdf Path: Wisconsin >> WILL >> 0011 Fall, 2009 Description: ... Date Added: 2009-06-24 10:54:36 |
| 487713be.pdf Path: Wisconsin >> WILL >> 0081 Fall, 2009 Description: ... Date Added: 2009-06-24 10:57:12 |
| 487713dc.pdf Path: Wisconsin >> WILL >> 0081 Fall, 2009 Description: ... Date Added: 2009-06-24 10:57:18 |
| 487715bd.pdf Path: Wisconsin >> WILL >> 0081 Fall, 2009 Description: ... Date Added: 2009-06-24 10:57:48 |
| 4877125b.pdf Path: Wisconsin >> WILL >> 0081 Fall, 2009 Description: ... Date Added: 2009-06-24 10:58:02 |
| 3b9b13fd.pdf Path: Wisconsin >> WILL >> 0028 Fall, 2009 Description: ... Date Added: 2009-06-24 10:58:29 |
| 3b9b170e.pdf Path: Wisconsin >> WILL >> 0028 Fall, 2009 Description: ... Date Added: 2009-06-24 10:59:42 |
| 3b9b175b.pdf Path: Wisconsin >> WILL >> 0028 Fall, 2009 Description: ... Date Added: 2009-06-24 10:59:47 |
| 487730ba.pdf Path: Wisconsin >> WILL >> 0089 Fall, 2009 Description: ... Date Added: 2009-06-24 11:01:02 |
| 4876ef93.pdf Path: Wisconsin >> WILL >> 0072 Fall, 2009 Description: ... Date Added: 2009-06-24 11:01:49 |
| 4876f0e0.pdf Path: Wisconsin >> WILL >> 0072 Fall, 2009 Description: ... Date Added: 2009-06-24 11:02:21 |
| 3a52.pdf Path: Wisconsin >> WILL >> 0068 Fall, 2009 Description: ... Date Added: 2009-06-24 11:04:25 |
| 3a65.pdf Path: Wisconsin >> WILL >> 0068 Fall, 2009 Description: ... Date Added: 2009-06-24 11:04:28 |
| 3b75.pdf Path: Wisconsin >> WILL >> 0068 Fall, 2009 Description: ... Date Added: 2009-06-24 11:05:22 |
| 1a3.pdf Path: Wisconsin >> WILL >> 0052 Fall, 2009 Description: ... Date Added: 2009-06-24 11:05:54 |
| 2ac.pdf Path: Wisconsin >> WILL >> 0052 Fall, 2009 Description: ... Date Added: 2009-06-24 11:06:15 |
| 2c8.pdf Path: Wisconsin >> WILL >> 0052 Fall, 2009 Description: ... Date Added: 2009-06-24 11:06:21 |
| 1fc0.pdf Path: Wisconsin >> WILL >> 0060 Fall, 2009 Description: ... Date Added: 2009-06-24 11:07:53 |
| 1fe0.pdf Path: Wisconsin >> WILL >> 0060 Fall, 2009 Description: ... Date Added: 2009-06-24 11:08:00 |
| 22d0.pdf Path: Wisconsin >> WILL >> 0060 Fall, 2009 Description: ... Date Added: 2009-06-24 11:09:08 |
| 487782bf.pdf Path: Wisconsin >> WILL >> 0113 Fall, 2009 Description: ... Date Added: 2009-06-24 11:09:57 |
| 3b9b2a9d.pdf Path: Wisconsin >> WILL >> 0033 Fall, 2009 Description: ... Date Added: 2009-06-24 11:11:50 |
| 3b9b2b1a.pdf Path: Wisconsin >> WILL >> 0033 Fall, 2009 Description: ... Date Added: 2009-06-24 11:12:39 |
| 3b9b50c7.pdf Path: Wisconsin >> WILL >> 0044 Fall, 2009 Description: ... Date Added: 2009-06-24 11:14:26 |
| 3b9b50ec.pdf Path: Wisconsin >> WILL >> 0044 Fall, 2009 Description: ... Date Added: 2009-06-24 11:14:32 |
| 3b9b506c.pdf Path: Wisconsin >> WILL >> 0044 Fall, 2009 Description: ... Date Added: 2009-06-24 11:14:59 |
| 3b9b014e.pdf Path: Wisconsin >> WILL >> 0012 Fall, 2009 Description: ... Date Added: 2009-06-24 11:15:22 |
| 3b9b014c.pdf Path: Wisconsin >> WILL >> 0012 Fall, 2009 Description: ... Date Added: 2009-06-24 11:15:22 |
| 3b9b02cb.pdf Path: Wisconsin >> WILL >> 0012 Fall, 2009 Description: ... Date Added: 2009-06-24 11:15:37 |
| 3b9b05d2.pdf Path: Wisconsin >> WILL >> 0012 Fall, 2009 Description: ... Date Added: 2009-06-24 11:16:33 |
| 48777a86.pdf Path: Wisconsin >> WILL >> 0110 Fall, 2009 Description: ... Date Added: 2009-06-24 11:17:10 |
| 487778f4.pdf Path: Wisconsin >> WILL >> 0110 Fall, 2009 Description: ... Date Added: 2009-06-24 11:18:00 |
| 3b9ad64a.pdf Path: Wisconsin >> WILL >> 0004 Fall, 2009 Description: ... Date Added: 2009-06-24 11:19:12 |
| 3b9ad663.pdf Path: Wisconsin >> WILL >> 0004 Fall, 2009 Description: ... Date Added: 2009-06-24 11:19:41 |
| 3b9ad720.pdf Path: Wisconsin >> WILL >> 0004 Fall, 2009 Description: ... Date Added: 2009-06-24 11:19:49 |
| 3b9af77d.pdf Path: Wisconsin >> WILL >> 0023 Fall, 2009 Description: ... Date Added: 2009-06-24 11:20:49 |
| 3b9af655.pdf Path: Wisconsin >> WILL >> 0023 Fall, 2009 Description: ... Date Added: 2009-06-24 11:21:08 |
| 3b9af714.pdf Path: Wisconsin >> WILL >> 0023 Fall, 2009 Description: ... Date Added: 2009-06-24 11:21:13 |
| 4877486d.pdf Path: Wisconsin >> WILL >> 0096 Fall, 2009 Description: ... Date Added: 2009-06-24 11:23:02 |
| 48770f31.pdf Path: Wisconsin >> WILL >> 0080 Fall, 2009 Description: ... Date Added: 2009-06-24 11:23:50 |
| 48770f39.pdf Path: Wisconsin >> WILL >> 0080 Fall, 2009 Description: ... Date Added: 2009-06-24 11:23:52 |
| 48770f49.pdf Path: Wisconsin >> WILL >> 0080 Fall, 2009 Description: ... Date Added: 2009-06-24 11:23:54 |
| 487710b8.pdf Path: Wisconsin >> WILL >> 0080 Fall, 2009 Description: ... Date Added: 2009-06-24 11:24:26 |
| 487710c0.pdf Path: Wisconsin >> WILL >> 0080 Fall, 2009 Description: ... Date Added: 2009-06-24 11:24:28 |
| 487710e1.pdf Path: Wisconsin >> WILL >> 0080 Fall, 2009 Description: ... Date Added: 2009-06-24 11:24:34 |
| 5e8.pdf Path: Wisconsin >> WILL >> 0053 Fall, 2009 Description: ... Date Added: 2009-06-24 11:25:08 |
| 6cd.pdf Path: Wisconsin >> WILL >> 0053 Fall, 2009 Description: ... Date Added: 2009-06-24 11:25:21 |
| 48772b7c.pdf Path: Wisconsin >> WILL >> 0088 Fall, 2009 Description: ... Date Added: 2009-06-24 11:26:48 |
| 48772b11.pdf Path: Wisconsin >> WILL >> 0088 Fall, 2009 Description: ... Date Added: 2009-06-24 11:26:51 |
| 48772c39.pdf Path: Wisconsin >> WILL >> 0088 Fall, 2009 Description: ... Date Added: 2009-06-24 11:27:49 |
| 48772c48.pdf Path: Wisconsin >> WILL >> 0088 Fall, 2009 Description: ... Date Added: 2009-06-24 11:27:52 |
| 3b9b4bac.pdf Path: Wisconsin >> WILL >> 0043 Fall, 2009 Description: ... Date Added: 2009-06-24 11:30:14 |
| 3b9b4c05.pdf Path: Wisconsin >> WILL >> 0043 Fall, 2009 Description: ... Date Added: 2009-06-24 11:30:36 |
| 3b9b4d0d.pdf Path: Wisconsin >> WILL >> 0043 Fall, 2009 Description: ... Date Added: 2009-06-24 11:31:24 |
| 2b5c.pdf Path: Wisconsin >> WILL >> 0063 Fall, 2009 Description: ... Date Added: 2009-06-24 11:32:18 |
| 487755b1.pdf Path: Wisconsin >> WILL >> 0100 Fall, 2009 Description: ... Date Added: 2009-06-24 11:33:14 |
| 487755e1.pdf Path: Wisconsin >> WILL >> 0100 Fall, 2009 Description: ... Date Added: 2009-06-24 11:33:22 |
| 487756dc.pdf Path: Wisconsin >> WILL >> 0100 Fall, 2009 Description: ... Date Added: 2009-06-24 11:33:38 |
| 3b9b1e74.pdf Path: Wisconsin >> WILL >> 0030 Fall, 2009 Description: ... Date Added: 2009-06-24 11:34:34 |
| 3b9b1ebe.pdf Path: Wisconsin >> WILL >> 0030 Fall, 2009 Description: ... Date Added: 2009-06-24 11:34:48 |
| 48774b32.pdf Path: Wisconsin >> WILL >> 0097 Fall, 2009 Description: ... Date Added: 2009-06-24 11:35:40 |
| 48774c64.pdf Path: Wisconsin >> WILL >> 0097 Fall, 2009 Description: ... Date Added: 2009-06-24 11:36:41 |
| 48774cf2.pdf Path: Wisconsin >> WILL >> 0097 Fall, 2009 Description: ... Date Added: 2009-06-24 11:37:03 |
| 3b9b0aa9.pdf Path: Wisconsin >> WILL >> 0013 Fall, 2009 Description: ... Date Added: 2009-06-24 11:38:23 |
| 3b9b3bf9.pdf Path: Wisconsin >> WILL >> 0038 Fall, 2009 Description: ... Date Added: 2009-06-24 11:40:41 |
| 48772aa6.pdf Path: Wisconsin >> WILL >> 0087 Fall, 2009 Description: ... Date Added: 2009-06-24 11:41:46 |
| 487727b9.pdf Path: Wisconsin >> WILL >> 0087 Fall, 2009 Description: ... Date Added: 2009-06-24 11:42:02 |
| 48777e0f.pdf Path: Wisconsin >> WILL >> 0112 Fall, 2009 Description: ... Date Added: 2009-06-24 11:43:04 |
| 48777e3a.pdf Path: Wisconsin >> WILL >> 0112 Fall, 2009 Description: ... Date Added: 2009-06-24 11:43:08 |
| 48777f9a.pdf Path: Wisconsin >> WILL >> 0112 Fall, 2009 Description: ... Date Added: 2009-06-24 11:44:01 |
| 48777f74.pdf Path: Wisconsin >> WILL >> 0112 Fall, 2009 Description: ... Date Added: 2009-06-24 11:44:13 |
| 3b9ad2f2.pdf Path: Wisconsin >> WILL >> 0003 Fall, 2009 Description: ... Date Added: 2009-06-24 11:45:27 |
| 3b9af59d.pdf Path: Wisconsin >> WILL >> 0022 Fall, 2009 Description: ... Date Added: 2009-06-24 11:47:40 |
| 990.pdf Path: Wisconsin >> WILL >> 0054 Fall, 2009 Description: ... Date Added: 2009-06-24 11:48:40 |
| a42.pdf Path: Wisconsin >> WILL >> 0054 Fall, 2009 Description: ... Date Added: 2009-06-24 11:48:56 |
| ae3.pdf Path: Wisconsin >> WILL >> 0054 Fall, 2009 Description: ... Date Added: 2009-06-24 11:49:29 |
| 3b9b4a0b.pdf Path: Wisconsin >> WILL >> 0042 Fall, 2009 Description: ... Date Added: 2009-06-24 11:49:31 |
| 3b9b4ae9.pdf Path: Wisconsin >> WILL >> 0042 Fall, 2009 Description: ... Date Added: 2009-06-24 11:50:05 |
| PHY132_Formulae_F.pdf Path: SUNY Stony Brook >> PHY >> 132 Fall, 2008 Description: Electric Charge Q [C]: Current: I dQ/dt I = qnq Avdrift; vdrift E Coulomb Force: 1 Q1Q2 1 Force exerted by Q1 on F1 on 2 = r, = 8.998 109 Nm 2 /C 2 , 0 = 8.85 10-12 C 2 /(Nm 2 ) 2 4 0 r12 4 0 Q2, r12 points from 1 to 2 Electric Field (Vector Fi... Date Added: 2009-06-24 11:53:05 |
| test3key_old.pdf Path: UMiami >> PHY >> 110 Fall, 2008 Description: 0 tmp:1 KEY. 1 A 2 B 3 E 4 C 5 D 6 E 7 D 8 D 9 A 10 E 11 B 12 B 13 C 14 C 15 B 16 A 17 C 18 E 19 D 20 D 21 D 22 A 23 C 24 A 25 E 26 C 27 B 28 C 29 B 30 E 31 A 32 B 33 A 34 A 35 E 36 C 37 E 38 D 39 A 40 D 41 E 42 C 43 B 44 D 45 D 46 B 47 E 48 A 49 A 5... Date Added: 2009-06-24 11:54:59 |
| hw3.pdf Path: Syracuse >> PHY >> 361 Fall, 2008 Description: PHY 361 Modern Physics Spring 2009 Prof. Bowick Homework Assignment 3 Due Tuesday 2/24/2009 in class Problems: 1. TR 3.5.18 2. TR 3.8.22 3. TR 3.8.46 4. TR 3.8.48 5. TR 3.8.55(b) 6. TR 3.8.56 1 ... Date Added: 2009-06-24 12:05:40 |
| hw7.pdf Path: Tennessee >> MATH >> 341 Fall, 2009 Description: Math 341 Homework # 7 P80. 24, 25. P104. 2, 8, 9, 11. 24. Let f : [a, b] R be monotone. Prove that f has a limit both at a and at b. Proof: Suppose that f is increasing. Let L = inf{f (x) : a < x b}. For any > 0, since L + is not an upper bound of ... Date Added: 2009-06-24 12:07:06 |
| a9.pdf Path: Wisc Stevens Point >> MATH >> 357 Fall, 2009 Description: Math 357/557 Spring 2009 - Assignment #9 Due: Friday, April 17 20 points - 2 points each 1. 2. 3. 4. 5. Pages 512-513, problem 10.49 Pages 516 - 518, problems 10.50, 10.56 Pages 526 - 530, problems 10.64, 10.70 Pages 537 - 540, problems 10.78, 10.8... Date Added: 2009-06-24 12:12:56 |
| lecture20.ppt Path: Sveriges lantbruksuniversitet >> BISC >> 471 Fall, 2009 Description: Some things to consider What if: A child dies and one parent wants to clone it and the other doesn\'t. Who owns the rights to the dead person\'s DNA? People don\'t want to be cloned after they die? It becomes acceptable to clone a person once. Or 10... Date Added: 2009-06-24 12:14:53 |
| quiz12key.pdf Path: SDSMT >> MATH >> 125 Fall, 2009 Description: MATH 125 Calculus II Quiz 12 (4/21) Name_ Please show all of your work to receive credit! No Work No Credit! Leave answers in simplified form. Each problem is worth ten points. Be sure to reference the test you are using, state your conclusion and... Date Added: 2009-06-24 12:16:45 |
| Decomposition_Lecture_09.pdf Path: Washington >> FISH >> 547 Spring, 2008 Description: The Microbial Loop Terrestrial vegetation Leaching Groundwater runoff CPOM Fungi Shredders Predators DOM Bacteria Protozoa Meiofauna Microbial Loop FPOM Collectors Biogeochemical Processes: Nitrogen Transformations N-fixation N-immobilizat... Date Added: 2009-06-24 12:17:16 |
| columbiafeb08.pdf Path: UCSB >> GEOG >> 275 Spring, 2008 Description: Citizens as Sensors: Web 2.0 and the World of Volunteered Geography Michael F. Goodchild University of California Santa Barbara How is geographic information created? By authorities USGS NGA Ordnance Survey military in many countries state and... Date Added: 2009-06-24 12:20:04 |
| thermo2.pdf Path: East Los Angeles College >> CHRI >> 1704 Fall, 2009 Description: The Second Essay of Thermodynamics Max Atkin, Christ Church 04/09/2003 1 Functions of State and Exact Differentials A Function of State, when used in the context of thermodynamics, refers to a variable which depends only on the current state of th... Date Added: 2009-06-24 12:21:21 |
| multicalc.pdf Path: ASU >> STAT >> 272 Fall, 2009 Description: jrjjrj01jn y tk VV h oVV ViV V Uo RVVV o~t khi V eU ryr~UU thWiUUU rVUU r~U UU ty hk V THGPHGE ISRQI@FD Wsf1w1segff c1wdb aRff` ce1t`b fg1dY}r~ XtU d f q i X ggwfru1o$y XtU rufByxupegd y 1gd Fgf xgq tda$1ff1 sByypd degd C&tk XttUU y X d ... Date Added: 2009-06-24 12:23:07 |
| Pre_Test2_correction.pdf Path: Tennessee >> STAT >> 201 Fall, 2009 Description: Stat 201 Pre-Test 2 Dr. Bensmail NAME:. SS#. Exercise 1: .Calculate: 1. P0. 5 < z < 2. 1. = p0 < z < 2. 1 ? p0 < z < 0. 5 = 0. 4821 ? 0. 1915 = 0. 290 6 2. Pz > 2. 3 = 0. 5 ? p0 < z < 2. 3 = 0. 5 ? 0. 4893 = 0. 010 7 3.pz < 0. 5 = 0. 5 + p0 < z < ... Date Added: 2009-06-24 12:24:06 |
| final.pdf Path: ASU >> STAT >> 272 Fall, 2009 Description: MAT 272 Final Exam Instructor: John Quigg December 13, 2003 Name: No books, notes or calculators of any kind are permitted on the test. Do not use your own scratch paper. Write each solution in the space provided, not on scratch paper. If you... Date Added: 2009-06-24 12:25:19 |
| sequence.pdf Path: ASU >> STAT >> 371 Fall, 2009 Description: SEQUENCES JOHN QUIGG Exercise 1. Let (xn ) be a convergent sequence in R, and put x = lim xn . Dene a new sequence (k ) by k 1 k = xn . k n=1 Prove that k x. Hint: Break the sum into two parts, one of which has a xed number of terms, and the other ... Date Added: 2009-06-24 12:25:45 |
| Ch03-Validate.xls Path: Utah >> URPL >> 5010 Fall, 2009 Description: January February March April May June July August September October November December Rent Groceries Fuel Electricity Child Care Misc. Total $750.00 $214.00 $75.00 $87.00 $110.00 $175.00 $1,411.00 $750.00 $311.00 $88.00 $89.00 $110.00 $145.00 $1,493... Date Added: 2009-06-24 12:36:42 |
| BIO102HW8.pdf Path: El Camino >> BIO >> 102 Fall, 2009 Description: BIO 102 Homework #8 20 points Due Tuesday 12/9/08 1. Finish the outline where I left off on my powerpoint slides and in lecture (p190). 2. Pick an interesting virus and write a detailed paragraph of the virus include what organism it infects and the ... Date Added: 2009-06-24 12:41:45 |
| mtnotes_phillips.pdf Path: UMiami >> ECO >> 403 Spring, 2008 Description: THE PHILLIPS CURVE I A The Phillips Curve in the Data The Original Phillips Curve PHILLIPS CURVE. The relationship between unemployment (or sometimes output) and inflation. Phillips, an economist in Britian, plotted inflation vs. unemployment in Bri... Date Added: 2009-06-24 12:42:21 |
| 14Cancer.pdf Path: Lake County >> IB >> 385 Fall, 2009 Description: Immunophenotype of B-cell chronic lymphocytic leukemia (B-CLL) and lymphomas that resemble it. Antigen slg CD5 CD19 CD20 CD22 CD23 CD79b FMC7 CD10 240 subtypes of leukemia B-CLL Weak + + + Weak or + Weak or low-grade Mantle Cell + + + + + + + aggress... Date Added: 2009-06-24 12:43:56 |
| AmalDutta.pdf Path: Tennessee >> STAT >> 571 Fall, 2009 Description: Project Title : Mechanical Properties of Blended Single Wall Carbon Nanotube (SWCNT) Composites Admixed in Epoxy Amal K. Dutta University of Tennessee Statistics 571 November 25, 2003 Summary In this present study we analyze the behavior of blende... Date Added: 2009-06-24 12:46:33 |
| supl004.pdf Path: SUNY Stony Brook >> CHE >> 133 Fall, 2008 Description: SUPL-004 Some Comments About Graphing Prepared by Robert F. Schneider (Revised 03/2005) Graphs are an important means of displaying both experimental data and computed quantities. The presentation of data in a graph often permits regularities, or ir... Date Added: 2009-06-24 12:47:19 |
| HW_2_2006.pdf Path: Maryland >> P >> 405 Fall, 2009 Description: Physics 405 Spring 2006 Homework Assignment #2 (due 2/8/06 at beginning of class) 1. We report absolute uncertainties in our experimental results (x x), but usually relative uncertainties (x/x) are more meaningful. We want to know whether the result... Date Added: 2009-06-24 12:47:54 |
| hw34.pdf Path: NMT >> M >> 410 Fall, 2009 Description: M410 Homework Section 3.4 1 1. Find and plot the clamped cubic spline interpolant of f (x) = 1+25x2 at 2 the points xi = 1 + ih, i = 0; 1; : : : ; N , h = N . Use N = 4; 8; 16; 32. Use the built-in Matlab spline function to nd and evaluate the spline... Date Added: 2009-06-24 12:54:31 |
| YJR102C.t2k.CB_burial_14_7-logo.pdf Path: UCSC >> YJR >> 102 Fall, 2009 Description: YJR102C.t2k CB_BURIAL_14_7 2 1 AAA B B BC X X D C C C D C A B C C C D A D B F B CDD CDEAXDXXXXXXCCXXBBCDXXDXDCADFCDECXDCADXEEEFBC C D D C C C B C G E D A D DCAEGEDCXXADXCCDXX A D D A D D E C D D X X X X X X X X X X B B AA B AA BB B C X AA BB X ... Date Added: 2009-06-24 13:08:46 |
| Exam3Review.pdf Path: Parkland >> MAT >> 129 Fall, 2009 Description: Items that should be known (no work needs to be shown to justify convergence/divergence) *any geometric series *any p-series -1 n * n The following are our tests along with what you will be required to show on the exam. The n th term Test For Diverge... Date Added: 2009-06-24 13:13:21 |
| YNL048W.t2k.dssp-ehl2-logo.pdf Path: UCSC >> YNL >> 048 Fall, 2009 Description: YNL048W.t2k DSSP-EHL2 2 1 1 10 20 30 40 H 2 1 C H X X X X X H TH E H 51 60 70 80 90 E 2 1 CHHX H X T S E TS TH T 2 1 EEC C C E E S H E T E C C H H X X X X X X X 151 160 170 180 190 HT 2 1 H E T H HH 201 H C C H... Date Added: 2009-06-24 13:16:17 |
| YNL097C.t2k.alpha-logo.pdf Path: UCSC >> YNL >> 097 Fall, 2009 Description: YNL097C.t2k ALPHA 2 1 EEE BC A A B C B E B I H H II I I I I XXXXHXXXXXXIXIIXSXIIXXIIII X X I H I H H H H HHHHHHHHS X X X X H G X H 1 10 20 30 40 E 2 1 BEIH SBH HHHH I S S I I I E H H HH I HIIIIIIIIIIIIIII I I I I IISI I H G H I X X X... Date Added: 2009-06-24 13:16:20 |
| YNL007C.t2k.w0.5-logo.pdf Path: UCSC >> YNL >> 007 Fall, 2009 Description: YNL007C.t2k w0.5 4 3 2 1 M XX L X X K K XXXXXX K DYF NL F H S E P T G L E K L K D W H T I A W S Q F M V X 10 20 30 40 H 4 3 2 1 T T H T H AY L D R F S G V W L H S D V A I E Q PKR E K A L E E T G I S Q T V EV X XXX F M X N KK FE ... Date Added: 2009-06-24 13:16:51 |
| ISDS+Resume+6.pdf Path: LSU >> APPL >> 003 Fall, 2008 Description: Sample Rsum - Information Systems and Decision Sciences 225 5781548 career@lsu.edu www.lsu.edu/career MIKE T. TIGER Current: 123 Tiger Town Baton Rouge, LA 70803 (225) 578-3202 Objective To obtain an Information Systems and Decision Sciences posi... Date Added: 2009-06-24 13:17:43 |
| c10.pdf Path: Iowa State >> STAT >> 479 Fall, 2008 Description: Example C10 SAS Program proc format; value bf 1=\'Low\' 2=\'Moderate\' 3=\'High\' ; value gf 1=\' Low\' 2=\'Medium\' 3=\'High\'; value cf 1=\'High\' 2=\'Moderate\' 3=\'Low\' ; run; data world; infile \"C:\\Documents and Settings\\mervyn\\My Documents\\.\\demogr.data\"; input... Date Added: 2009-06-24 13:20:15 |
| T0393.t06.o_notor-logo.pdf Path: UCSC >> M >> 0393 Fall, 2009 Description: T0393.t06 o_notor 4 3 2 1 1 10 20 30 40 N 4 3 2 1 P NM H MGN P N H MN 51 60 70 80 90 HGN 4 3 2 1 GN P N H GN P N 101 110 120 130 140 H 4 3 2 1 GN PN H M 151 H N 160 AIASTLSNRVYDAD 150 SIPMNVWEGHVPHYGVFYPMQT... Date Added: 2009-06-24 13:22:05 |
| HW32.pdf Path: Arizona >> CHEE >> 201 Fall, 2008 Description: 8.25 a. 55 0 0 L (ST P)/ m in CH 3 O H (v ) 6 5 o C n 2 (mo l/ m in ) m w kg / min H 2 O( l, s at`d ) @ 9 0 o C Vw 2 ( m 3 /min ) m w kg / min H 2 O(v , s at`d ) @ 3 0 0 o C Vw 1 ( m3 /min ) n 2 mo l/m in CH 3 O H (v ) 2 60 o C n2 = 5500 L(STP) 1 ... Date Added: 2009-06-24 13:22:38 |
| cad1c.pdf Path: SWCCD >> ENGR >> 110 Fall, 2009 Description: 5.00 3.00 FRONT PRT_CSYS_DEF y z x 1.00 RIGHT 1.50 1.00 1.00 y TOP zRIGHT x PRT_CSYS_DEF 1.00 .50 Cad 1c ... Date Added: 2009-06-24 13:24:23 |
| cad5.pdf Path: SWCCD >> ENGR >> 110 Fall, 2009 Description: ... Date Added: 2009-06-24 13:24:24 |
| YKL013C.t2k.CB_burial_14_7-logo.pdf Path: UCSC >> YKL >> 013 Fall, 2009 Description: YKL013C.t2k CB_BURIAL_14_7 3 2 1 AAAA BBBB CCC D D D D X X X X 1 10 20 30 40 A 3 2 1 DBAE DF EDF DF D EA DA B D E C E E E A G F E E F E EFEXXXEFXX G C D D C D D B D X X X X X X X X X X X X X X X E E F D F B C AB BA X CCD ED F X ... Date Added: 2009-06-24 13:25:22 |
| YKL044W.t2k.stride-ebghtl-logo.pdf Path: UCSC >> YKL >> 044 Fall, 2009 Description: YKL044W.t2k EBGHTL 3 2 1 CCE X X X TECC E T C C T T E T X X X X X X X 1 10 20 30 40 E 3 2 1 T H EH THE H E E H H H H H E E X X X X X X X 51 60 70 80 90 E 3 2 1 H H X X T E T H E T TT TCCTH T C X C E H T X X X C 101 PS... Date Added: 2009-06-24 13:26:21 |
| 2006614_r01s_025344.pdf Path: Stanford >> GNSS >> 1036 Fall, 2009 Description: se 3 :02-cv-05344-JSW Document 84 Filed 06/14/2006 Page 1 of 6 2 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 Plaintiff, ) 16 v. 17 18 19 Defendants . 20 21 22 23 24 25 26 27 ) GENESIS MICROCHIP INC., AMNON ) FISHER , ERIC ERDMAN, and ANDERS ) FRISK ) Before... Date Added: 2009-06-24 13:33:46 |
| slac-pub-7392.pdf Path: Stanford >> PUBS >> 7250 Fall, 2009 Description: SLAC PUB 7392 Jan 1997 Initial Commissioning Results of Next Generation Photoinjector D. T. Palmer, X. J. Wangy , R. H. Miller M. Babzieny ,I. Ben-Zviy, C. Pellegrini, J. Sheehany , J. Skaritkay , H. Winick , M. Woodley , V. Yakimenkoy Stanford Li... Date Added: 2009-06-24 13:37:52 |
| Resp Resp Failure-ARDS-pp.ppt Path: Austin CC >> MODULE >> 2331 Fall, 2009 Description: Respiratory Respiratory Failure and ARDS Normal Respirations Respiratory Failure Not a disease process, sign of severe dysfunction Lungs unable to oxygenate blood & remove CO2 Alveolar ventilation is inadequate to meet the bodys need Commonly... Date Added: 2009-06-24 13:38:18 |
| 2-filtering.pdf Path: Acton School of Business >> OLD >> 433 Fall, 2009 Description: Digital Filtering ELEC 433 - Fall 2007 Chris Hunter, Sid Gupta Any Questions or Comments from Last Week\'s Lab? Last Week: lab1_4.mdl Wasn\'t full precision by default like lab exercise claimed Last Week: lab1_4.mdl Wasn\'t full precision by defaul... Date Added: 2009-06-24 13:39:49 |
| c2e3s02.pdf Path: University of North Carolina, Wilmington >> CHM >> 102 Summer, 2008 Description: CHM-102 Name Exam III Spring 2002 Raw Score T-Score You will have one hour to complete the exam. There is one best answer to each question and all questions are worth the same number of points. Sign your name on the answer sheet above the G... Date Added: 2009-06-24 13:42:34 |
| soln1a.pdf Path: Georgia Tech >> MATH >> 2401 Fall, 2008 Description: ... Date Added: 2009-06-24 13:43:30 |
| mass wasting.pdf Path: El Paso CC >> GS >> 106 Fall, 2009 Description: Creep Slump Rockslide Debris Flow Earthflow Cross section of Rockslide Occurred when sandstone bed slid off the saturated clay bed 1 Earthflow and Slump Triggered by Earthquake Permafrost Thawing permafrost 2 ... Date Added: 2009-06-24 13:43:50 |
| Experiment_Heat Exchanger.pdf Path: San Jose State >> CHE >> 161 Fall, 2008 Description: Unit Operations Laboratory Heat Exchanger HEAT EXCHANGER CHARACTERIZATION Objectives 1. Characterize the thermal performance of the heat exchanger Equipment Description Scott Double Pipe Heat Exchanger. This unit is capable of operating in co-curren... Date Added: 2009-06-24 13:44:06 |
| hesol.pdf Path: ASU >> MAT >> 447 Fall, 2009 Description: MAT 447 Fall 2006 Homework E Solutions Prof. Hurlbert 1. Suppose h : X Y is an (N, M )-hash function, and let h1 (y ) = {x : h(x) = y } for any y Y . Let denote the probability that h(x1 ) = h(x2 ), where x1 and x2 are random (not necessarily di... Date Added: 2009-06-24 13:48:10 |
| prac-midterm2.pdf Path: Lake County >> ECE >> 561 Fall, 2009 Description: | YW u rc Wpc bp gy r s rce g |dpcbbWeW ` q lpg u eycpeb p YWb )gsrphwIhcUnsewniwp$HUtw{$iwgh4s W eHww4p\"a{wwsdhpUfy\"r4w4n{nh4piUIwev\"HyaHhnGpchhpiwgtWUIh4inIUwsgfUrwg j dc o bWc h g b lec | rycW ` W qp u Y `c fbpW ub `c p s gd mg | q YWpe r qy... Date Added: 2009-06-24 13:49:36 |
| xapp463.pdf Path: Lake County >> ECE >> 412 Fall, 2009 Description: Application Note: Spartan-3 FPGA Family R Using Block RAM in Spartan-3 FPGAs XAPP463 (v1.1.2) July 23, 2003 Summary For applications requiring large, on-chip memories, Spartan-3 FPGAs provides plentiful, efficient SelectRAM memory blocks. Using va... Date Added: 2009-06-24 13:50:45 |
| ChanAndZenBuddhism.pdf Path: CSU Channel Islands >> PSY >> 344 Fall, 2008 Description: PSY344 Chan & Zen Buddhism Although Boddhidharma is often credited with bringing Buddhism to China, Buddhism had been established 400 years before the 28th patriarch arrived in 526 CE. While several hundred sutras had been translated into Chinese, ... Date Added: 2009-06-24 13:55:16 |
| KHP.doc Path: Michigan Flint >> CHM >> 261 Fall, 2009 Description: BURET CRAFT The buret itself 1. The buret is made of glass, and it can be broken. It also can be scratched on its internal surfaces, so a long brush should not be used for cleaning. 2. The buret is susceptible to long-term attack by strongly-basic me... Date Added: 2009-06-24 13:59:09 |
| Part4.pdf Path: Ball State >> MATH >> 412 Fall, 2009 Description: Part 4 Always make sure that you are viewing the latest version of this page by clicking the refresh button on your browser. 18 12. This is a eld. There is no need to check associativity, distributivity or commutativity, because all of these are in... Date Added: 2009-06-24 14:01:47 |
| w10.pdf Path: Heartland Community College >> CHEM >> 161 Fall, 2009 Description: WORKSHEET #10 CHEM 161 J. MUENCH 1. Show the formation of the IONIC compound using Lewis dot symbols. Remember that ionic compounds DO NOT share electrons. Ex) Na + Cl Na+ + a. MgO Cl -1 b. Na2S 2. Arrange the following ionic compounds in order of... Date Added: 2009-06-24 14:05:34 |
| herpes.pdf Path: Columbia >> M >> 8771 Fall, 2009 Description: ... Date Added: 2009-06-24 14:06:58 |
| Chap1part2_2.pdf Path: Illinois Springfield >> CHE >> 141 Fall, 2008 Description: What is Chemistry Chapter 1, Part 2 August 26th, 2004 How Good are My Numbers? Errors: Every measurement has an error that accompanies it. Precision and accuracy indicate the error. Precision: Measures how well same measurements agree with each ot... Date Added: 2009-06-24 14:08:10 |
| H193 W02 D02 LECT - Project Management & Design Schedule 06.ppt Path: Ohio State >> EG >> 193 Fall, 2009 Description: Engineering H193 - Team Project Project Management Week 2 Day 2 Spring Quarter 2006 Gateway Engineering Education Coalition P. 1 Engineering H193 - Team Project The Project Cycle Conceiving and defining the project Planning the project Im... Date Added: 2009-06-24 14:10:14 |
| T0331.t04.CB_burial_14_7-logo.pdf Path: UCSC >> T >> 0331 Fall, 2009 Description: T0331.t04 CB_burial_14_7 2 1 AA X 1 10 20 30 40 A 2 1 B DA EDBE B EDFEF D A BD FD ABD F D A EB B E F B E C E F C E C D D E F D D E E A C D F F A E E A D CCCCDFG CCCDEF B D D F D D D D D D X X X X XXXDDXXXXXXXXXDDDXXX B AA BB X X ... Date Added: 2009-06-24 14:14:41 |
| Environmemtal Epidemiology & Risk Assessment .ppt Path: CSU LA >> HS >> 370 Fall, 2009 Description: EnvironmentalEpidemiology Toestablishcausation,anassociationbetween exposureandoutcomemustbe: 1. 2. 3. 4. 5. 6. 7. Strong Specific Consistentwithpreviousfindings Biologicallyplausible Coherentwiththenaturalhistoryofdisease Supportedbyevidence(experi... Date Added: 2009-06-24 14:16:41 |
| T0295.dssp-ehl2-logo.pdf Path: UCSC >> T >> 0295 Fall, 2009 Description: T0295 dssp-ehl2 2 1 CCCC H H H H H E C C C C C C X X X X X X X X X X X X X X 1 10 20 30 40 H 2 1 E H E 51 60 70 80 90 H 2 1 E E H HHHHHH C C C C C X X X X X X X X X X E E HHCCXHXCCHHHHE C C H C C X H C C C C X X H CCC EEEE X... Date Added: 2009-06-24 14:17:32 |
| T0295.t2k.CB_burial_14_7-logo.pdf Path: UCSC >> T >> 0295 Fall, 2009 Description: T0295.t2k CB_burial_14_7 3 2 1 A X BAX C C D X C B B B A A D X X D C D A D D X X ABEDBD DBDEB A GF B C BC ECCEECEDA CBBCEGFFFFFFFFGFFFFGF DD EE CA E D F C DCDEXCACFDBDCCBF D E F D A E C X X X B X X X X F AA FG X D G D E C D E X X X X X X X X ... Date Added: 2009-06-24 14:17:36 |
| Ranunculaceae.pdf Path: Iowa State >> BIO >> 366 Fall, 2009 Description: Ranunculaceae Buttercup Family Dissected or lobed leaves Apocarpous gynoecium Ranunculales Enormous floral diversity Copious endosperm-rare for a dicot! Genera to know: Ranunculus, Aquilegia Ovary position: superior Number of Stamen: many Fruit t... Date Added: 2009-06-24 14:24:27 |
| PS06.pdf Path: Lake County >> ECE >> 313 Fall, 2009 Description: University Problem Set #6 ECE 313 of Illinois Page 1 of 3 Summer 2003 Assigned: Thursday, July 17 Due: Thursday, July 24 Reading: Ross Chapters 5.1-5.7, 9.1 Problems: 1. Let the random variable ID denote the indicator function of an event D, that is,... Date Added: 2009-06-24 14:40:32 |
| Chapter_2.pdf Path: Lake County >> ECE >> 313 Fall, 2009 Description: Chapter 2 Conditional Probability Suppose that we have partial knowledge of the result of a trial of the experiment - we know that event A occurred on the trial - but we do not know which outcome in A occurred; only that the ... Date Added: 2009-06-24 14:40:34 |
| PS13.pdf Path: Lake County >> ECE >> 313 Fall, 2009 Description: University of Illinois Spring 2008 ECE 313: Problem Set 13 Functions of Random Variables, Conditional Densities, Correlation and Covariance, Minimum-Mean-Square-Error Estimation This Problem Set contains ve problems Due: Reading: Noncredit exercise... Date Added: 2009-06-24 14:41:05 |
| ESRI_Conference1105.doc Path: JMU >> ARCHIVE >> 0408 Fall, 2009 Description: ESRI-MUG 2005 Annual Conference Just a reminder that the ESRI Mid-Atlantic User Group 2005 Annual Conference is next week. Late fees are being waived through Friday October 28th, so we encourage everyone to go to www.esrimug.org and register for the ... Date Added: 2009-06-24 14:42:41 |
| ProVsEnterprise.pdf Path: Cuyamaca College >> CIS >> 180 Fall, 2009 Description: So what is Visual Basic? The \"Visual\" part refers to the method used to create the graphical user interface (GUI). Rather than writing numerous lines of code to describe the appearance and location of interface elements, you simply drag and drop preb... Date Added: 2009-06-24 14:44:39 |
| lab_notes.pdf Path: University of Toronto >> ECE >> 334 Fall, 2009 Description: ECE334S University of Toronto Lab Notes ECE334S Groups Students will work in groups of two. Students must attend their designated lab section. Students are not required to keep a lab book for this course. Simulation Tools The simulation tools ne... Date Added: 2009-06-24 14:48:48 |
| 1999_test2.pdf Path: Maine >> ECE >> 486 Spring, 2008 Description: ECE-486 Test 2 Fall 1999 Due 5:00 PM, Dec. 7 and passband gain between 1. Design a 6th order lowpass lter with passband -0.2 dB and 0 dB. Set the minimum stopband attenuation to 60 dB, and make the transition between passband and stopband as narrow ... Date Added: 2009-06-24 14:50:20 |
| notes3.pdf Path: Lake County >> ECE >> 559 Fall, 2009 Description: Environment Flat Rural Urban Hilly Mall Indoors Spread 0.5 s 5 s 20 s 0.3 s 0.1 s Table 3.1: Typical delay spreads for various environments. If W > 1 , then the fading is said to be frequency selective, and h(t; ) can no longer be replaced by a ds... Date Added: 2009-06-24 14:52:52 |
| h19.pdf Path: Lake County >> ECE >> 359 Fall, 2009 Description: ECE 359 Handout # 19 HOMEWORK ASSIGNMENT 10 Reading: Handouts 18, 20 Due Date: May 6, 2003 (in class) Spring 2003 April 24, 2003 1. Let s(t) and r(t) be two signals that are both non-zero only on the interval [0, T ]. Suppose we correlate these two... Date Added: 2009-06-24 14:52:57 |
| lapadat98.pdf Path: Indiana >> EDUCY >> 520 Fall, 2009 Description: Paper presented at the Annual Meeting of the American Educational Research Association, San Diego, CA, April 13-17, 1998. (Eric Document Number ED 419 821) Examining Transcription: A Theory-Laden Methodology Judith C. Lapadat Anne C. Lindsay1 Tran... Date Added: 2009-06-24 14:53:09 |
| variable_types.pdf Path: Indiana >> EDUCY >> 520 Fall, 2009 Description: Types of Variables Binary variable Obsevations (i.e., dependent variables) that occur in one of two possible states, often labelled zero and one. E.g., improved/not improved and completed task/failed to complete task. Usually an independent or pred... Date Added: 2009-06-24 14:53:10 |
| inquiry.pdf Path: Indiana >> EDUCY >> 520 Fall, 2009 Description: Spring 2001 Y520: 8525 Strategies for Educational Inquiry What is Inquiry? Philosophy & Inquiry This is not a a course in philosophy, rather a course in research design and methods. Methods and designs rest on assumptions about knowledge, causalit... Date Added: 2009-06-24 14:53:14 |
| project5answerform.pdf Path: CSU Long Beach >> GEOG >> 400 Fall, 2009 Description: GEOG 400 Project 5 Preliminaries Check Name: Possible shortcoming Level of measurement Absolute minimum # var STV ratio Min # observations Normalcy All variables scalar? Absolute minimum What is our STV ratio? Ideal minimum Number of chemicals with... Date Added: 2009-06-24 14:56:26 |
| Section 5_8 Path: N.C. State >> MA >> 241 Spring, 2009 Description: WebAssign Section 5.8 (Homework) About this Assignment Question Points 123456 222222 Total 12/12 Description Integration Using Tables and Computer Algebra Systems The due date for this assignment is past. Your work can be viewed below, but no chang... Date Added: 2009-06-24 14:57:00 |
| Section 7_9 Path: N.C. State >> MA >> 241 Spring, 2009 Description: WebAssign Section 7.9 (Homework) About this Assignment Question Points 123 4 56 3 3 3 1.25 4 3 Total 17.25/17.25 Description Applications of Second-Order Differential Equations The due date for this assignment is past. Your work can be viewed below... Date Added: 2009-06-24 14:57:12 |
| IST220CHAP24.ppt Path: Penn State >> IST >> 220 Fall, 2008 Description: vti_encoding:SR|utf8-nl vti_timelastmodified:TR|19 Nov 2001 02:14:06 -0000 vti_extenderversion:SR|5.0.2.2623 vti_author:SR|CT146\\gwc2 vti_modifiedby:SR|CT146\\gwc2 vti_timecreated:TR|19 Nov 2001 02:14:06 -0000 vti_cacheddtm:TX|19 Nov 2001 02:14:06 -00... Date Added: 2009-06-24 15:02:31 |
| syll_Geog150_hc_sum09.pdf Path: CUNY Baruch >> GEOG >> 150 Fall, 2009 Description: GEOG 150: World Regional Geography Summer 2009 Mr. Sirotin Sec 001: MTuWTh 1.10-3.05 pm, HN C002 hsirotin@hunter.cuny.edu Office hours: MTuW 3.30-4.30 pm, HN 1032, and by appt. Text: Clawson, Johnson, Haarman, and Johnson, World Regional Geography, 9... Date Added: 2009-06-24 15:04:06 |
| lecture1.pdf Path: Maryland >> ENEE >> 350 Fall, 2008 Description: d Vp Sp e q z h U S h uQ SQ I qQ a w U SpQ q I V X U h r c St ` V r q u Ryyc{cbW$DiTRiS lyIhRWS {cy` % `hw` q qV Wd` @iyIie f Xp S d h d c V wQ q unnGu{pg f p h X c d hQ ` xV ylX iIyij qQ Vp h e Q w eQ w Q w e I ddn f dPH I q ` h U uQ V e VQ V... Date Added: 2009-06-24 15:07:18 |
| midterm_sample.pdf Path: Lake County >> ECE >> 441 Fall, 2009 Description: ... Date Added: 2009-06-24 15:12:00 |
| solution4.pdf Path: Wesleyan >> PHYS >> 213 Fall, 2009 Description: ... Date Added: 2009-06-24 15:15:37 |
| DSAdatasheet.pdf Path: Lake County >> ECE >> 486 Fall, 2009 Description: Agilent Technologies 35670A Dynamic Signal Analyzer Technical Specifications Versatile two- or four-channel high-performance FFT-based spectrum/network analyzer 122 Hz to 102.4 hHz 16-bit ADC Key Specifications Frequency Range Dynamic Range Accura... Date Added: 2009-06-24 15:23:15 |
| Earth_week2.ppt Path: Washington University in St. Louis >> EPSC >> 210 Fall, 2009 Description: ... Date Added: 2009-06-24 15:24:57 |
| atmos6.pdf Path: SUNY Stony Brook >> PHY >> 521 Fall, 2009 Description: 29 The Curve of Growth of the Equivalent Width Spectral lines are broadened from the transition frequency for a number of reasons. Thermal motions and turbulence introduce Doppler shifts between atoms and the radiation eld. The probability that an a... Date Added: 2009-06-24 15:25:32 |
| hw3.pdf Path: SUNY Stony Brook >> AST >> 105 Summer, 2008 Description: AST 105: Introduction to the Solar System HOMEWORK # 3, DUE 19 February 1. The Suns power output is 3.8 1026 watts. How much energy does the Sun radiate in one second? 2. Suppose a light wave has a wavelength of 1 meter. What frequency does it have?... Date Added: 2009-06-24 15:25:43 |
| Homework1ans.pdf Path: SUNY Stony Brook >> AST >> 101 Spring, 2008 Description: AST 101 Spring 2008 Homework #1: UNIT CONVERSION Due in class February 13, 2008 Name: _ANSWER KEY_ SBU ID:_ The goal of these exercises is to help you become accustomed to the type of unit analysis and calculations well be doing in the course. For yo... Date Added: 2009-06-24 15:25:51 |
| MAT220_FinalReview.pdf Path: Glendale Community College >> MAT >> 220 Fall, 2008 Description: MAT220 Final Exam Review 1. Let f(x) be an even function and g(x) be an odd function. Complete the following table. x f(x) g(x) -2 5 5 -1 4 4 0 0 0 1 2 2. Consider the functions f, g and h in the table below. x f(x) g(x) h(x) 0 10 10 10 1 9 7 5 2 6 4... Date Added: 2009-06-24 15:25:56 |
| poster.pdf Path: NSCC >> GEOL >> 101 Fall, 2009 Description: Geology 101 The poster project Poster mechanics A poster is a visually-oriented stand-alone presentation of a topic. As a visual presentation, posters follow the same rules as advertisements: The title (and the name(s) of the author(s) are prominent... Date Added: 2009-06-24 15:26:08 |
| ex7.pdf Path: NSCC >> CHE >> 103 Fall, 2009 Description: Chemistry 103 Name(s): Exercise 7: Michaelis-Menten kinetics The study of enzyme kinetics is key to understanding the mechanism of how an enzyme performs its function. In 1913, Leonor Michaelis (German physician) and Maud Menten (Canadian physician... Date Added: 2009-06-24 15:26:42 |
| syllabus.pdf Path: National Taiwan University >> AST >> 143 Fall, 2009 Description: ASTRONOMY 143: The History of the Universe Fall Quarter 2008 Mon Wed Fri 1:30 - 2:48 pm Mendenhall 191 Where do we come from? What are we? Where are we going? Paul Gauguin, 1897 Instructor: Professor Barbara Ryden Oce: 4035 McPherson Lab (4th oo... Date Added: 2009-06-24 15:32:29 |
| Ch 7 exercise.doc Path: Cal Poly Pomona >> EC >> 402 Fall, 2009 Description: Ch 7 exercise 2.ConsidertwofirmsfacingthedemandcurveP=505Q,whereQ=Q1+Q2.The firmscostfunctionsareC1(Q1)=20+10Q1andC2(Q2)=10+12Q2. a. Suppose both firms have entered the industry. What is the joint profit maximizinglevelofoutput?Howmuchwil... Date Added: 2009-06-24 15:33:37 |
| sect_5_2.pdf Path: WVU >> STAT >> 211 Fall, 2008 Description: ... Date Added: 2009-06-24 15:36:28 |
| formation.pdf Path: National Taiwan University >> AST >> 161 Fall, 2009 Description: Formation of the Solar System Any theory of formation of the Solar System must explain all of the basic facts that we have learned so far. 1 The Solar System The Sun contains 99.9% of the mass. The Solar System is mostly empty space. The Solar ... Date Added: 2009-06-24 15:37:16 |
| lecture24.pdf Path: Mich Tech >> CM >> 5300 Spring, 2008 Description: ... Date Added: 2009-06-24 15:40:06 |
| Mar_12.pdf Path: University of Toronto >> MAT >> 1062 Fall, 2009 Description: Mat1062: Introductory Numerical Methods for PDE Mary Pugh March 12, 2009 1 Ownership These notes are the joint property of Rob Almgren and Mary Pugh. 2 Finite Element Methods For nite element methods we need a Hilbert Space. This is a complete... Date Added: 2009-06-24 15:40:32 |
| laser_intensities2.ps Path: Stanford >> SOI >> 071107 Fall, 2009 Description: %!PS-Adobe-3.0 %BoundingBox: 0 0 566 396 %Title: Graphics produced by IDL %For: couvidat@stitch.Stanford.EDU, /auto/scr20/couvidat/HMI %Creator: IDL Version 6.1.1 (linux x86 m32) %CreationDate: Wed Nov 21 13:29:11 2007 %DocumentData: Clean7bit %Requi... Date Added: 2009-06-24 15:46:53 |
| SynopticI-Mod02-SfcPlot.pdf Path: Maryville MO >> ATMS >> 4710 Fall, 2009 Description: Synoptic Meteorology I Surface Analysis Surface Plotting 1. obtain METAR reports decode METAR METAR plot METAR 2. 3. Surface Plotting KIRK 270853Z 20013KT 9SM RA OVC040 28/17 A2991 RMK A02 SLP129 8/5/ T02780172 57020= 82 9 63 129 -20 1 Surfac... Date Added: 2009-06-24 15:47:44 |
| YJL059W.t2k.w0.5-logo.pdf Path: UCSC >> YJL >> 059 Fall, 2009 Description: YJL059W.t2k w0.5 4 3 2 1 R K D V X XXX R K L X S X LL V VI XX X XXXXXXXXXX XXXXXXXX XXXXX L F V L FWLL Y I Y LV I E E A I V K K I S W T T F V F V V M M VI F I L X GL NN YV D D F Y ICGGL S S L V F L W H V I I IVS I LLVFT A A F M A VML... Date Added: 2009-06-24 16:03:23 |
| YJL076W.t2k.dssp-ebghstl-logo.pdf Path: UCSC >> YJL >> 076 Fall, 2009 Description: YJL076W.t2k EBGHSTL 3 2 1 C EEEEE C G X CE EC E H S H S E X X X X X X X X X X X X X X X X CC C E C C EGSTHCGCCSECCSEC CH CTCSS EEESSSES TG SCHTG T S G S E T S S CCTTCC E E T T B X X X X X X X X E C C S GC TTSSTCCCSCCHSC CCTC C C TSSCHH... Date Added: 2009-06-24 16:04:05 |
| lv.txt Path: NYU >> JK >> 1786 Fall, 2009 Description: clv cxlv lv xlv ... Date Added: 2009-06-24 16:04:47 |
| finalsol.pdf Path: SUNY Stony Brook >> MAT >> 530 Fall, 2008 Description: MAT 530: Topology&Geometry, I Fall 2005 Final Exam Solutions Part I (choose 2 problems from 1,2, and 3) 1. Suppose X is a T 1 topological space. Show directly from the denitions that X is normal if and only if for every closed subset A of X and open... Date Added: 2009-06-24 16:06:54 |
| Facing the challenges to come.pdf Path: Texas A&M >> FINC >> 645 Fall, 2008 Description: ... Date Added: 2009-06-24 16:09:46 |
| Boiler Plate.doc Path: UF >> EIN >> 6918 Fall, 2008 Description: Industrial and Systems Engineering Graduate Seminar Approximation Algorithms for Facility Location Problems Jiawei Zhang Department of Management Science and Engineering Stanford University Thursday, January 29, 2004 Period 8 (3:00 3:50) Williamson ... Date Added: 2009-06-24 16:10:54 |
| balance.xls Path: Penn State >> JUG >> 187 Fall, 2009 Description: Comp. Sci. 203 Joshua George 06/18/2009 08:48:36 Jackson\'s Bright Ideas Monthly Balance Due Report Customer Costa, Dan Hernadez, Abraham Mc Cartan, John Paoli, Pam Ramirez, Alberto Vaughn, Noah Xiong, James Totals Highest Lowest Average Beginning... Date Added: 2009-06-24 16:16:53 |
| 2007_edap02.pdf Path: Pittsburgh >> AEI >> 7518 Fall, 2009 Description: European Diversity and Autonomy Papers EDAP 02/2007 Commissions Approach to Minority Protection during the Preparation of the EUs Eastern Enlargement: Is 2 Better than the Promised 1? Dimitry Kochenov www.eurac.edu/edap Managing editors: Emma Lant... Date Added: 2009-06-24 16:20:46 |
| ExcelPortfolio.xls Path: Penn State >> SDB >> 5028 Spring, 2009 Description: Government Bonds Long-Term Bonds Bond Issuer T. Rowe Price U.S. Treasury Long-Term Rydex Govt Long Bond 1.2x Strategy A Wasatch-Hoisington U.S. Treasury Vanguard Long-Term U.S. Treasury Short-Term Bonds Bond Issuer State Farm Interim Federated U.S. G... Date Added: 2009-06-24 16:21:53 |
| T0489.t04.dssp-ebghstl-logo.pdf Path: UCSC >> T >> 0489 Fall, 2009 Description: T0489.t04 dssp-ebghstl 3 2 1 1 10 20 30 40 H 3 2 1 H T H TS H 51 60 70 80 90 E 3 2 1 T E H T G T E S E 101 110 120 130 140 TE 3 2 1 T E TE T S E HG H T E H 151 160 170 180 190 T 3 2 1 T H T 201 21... Date Added: 2009-06-24 16:22:00 |
| heart.pdf Path: Cornell >> BEE >> 4530 Fall, 2009 Description: Hearts ablaze! Radio Frequency Ablation as Treatment for Cardiac Arrhythmia Kelly Gillen, Jason Greenberg, Sam Pevzner, Becky Rounds, Quinn Schneller Bee 453: Computer-Aided Engineering Professor Ashim K. Datta May 2, 2003 Executive Summary: This p... Date Added: 2009-06-24 16:23:50 |
| Proposal 3.31.pdf Path: Penn State >> KMH >> 326 Fall, 2009 Description: MilestoneBusinessPark Building#4 Germantown,Maryland KristenMHlopick ConstructionManagement Dr.Riley Proposal January15,2008 MilestoneBuilding#4 KristenMHlopick ConstructionManagement|Dr.Riley|Germantown,Maryland|January15... Date Added: 2009-06-24 16:24:04 |
| 20451.txt Path: UNC >> DOCS >> 20451 Fall, 2009 Description: Project Gutenberg\'s The Confessions of Artemas Quibble, by Arthur Train This eBook is for the use of anyone anywhere at no cost and with almost no restrictions whatsoever. You may copy it, give it away or re-use it under the terms of the Project Gu... Date Added: 2009-06-24 16:26:47 |
| 20989.txt Path: UNC >> DOCS >> 20989 Fall, 2009 Description: The Project Gutenberg EBook of \'A Comedy of Errors\' in Seven Acts, by Spokeshave (AKA Old Fogy) This eBook is for the use of anyone anywhere at no cost and with almost no restrictions whatsoever. You may copy it, give it away or re-use it under the... Date Added: 2009-06-24 16:27:19 |
| 20157.txt Path: UNC >> DOCS >> 20157 Fall, 2009 Description: The Project Gutenberg eBook, The Call of the Blood, by Robert Smythe Hichens, Illustrated by Orson Lowell This eBook is for the use of anyone anywhere at no cost and with almost no restrictions whatsoever. You may copy it, give it away or re-use i... Date Added: 2009-06-24 16:27:26 |
| final-a04-solutions.pdf Path: NSULA >> GEL >> 21410 Fall, 2009 Description: Reseaux de neurones (GIF-21410 / GIF-64326) D partement de G nie electrique et de G nie Informatique e e e Automne 2004 EXAMEN FINAL (solutions) Instructions : Toute documentation permise Ce questionnaire comporte 2 pages et 8 questions Dur e d... Date Added: 2009-06-24 16:32:17 |
| synthesisstatement.doc Path: Johns Hopkins >> DATA >> 412 Fall, 2009 Description: Synthesis Statements in Online Discussions Facilitators of discussion forums use synthesis statements to provide summary and closure to a conversation, as well as to redirect the discourse to further explore a topic. Synthesis statements can also be ... Date Added: 2009-06-24 16:34:20 |
| Chap010.pdf Path: CSU Sacramento >> COURSE >> 001 Fall, 2009 Description: Chapter 10 Reporting and Interpreting Bonds Irwin/McGraw-Hill The McGraw-Hill Companies, Inc., 2001 Business Background The mixture of debt and equity used to finance a companys operations is called the capital structure: Debt - funds from credit... Date Added: 2009-06-24 16:34:41 |
| hw0301.pdf Path: JMU >> A >> 241 Fall, 2009 Description: HOMEWORK DUE MARCH 1, 1999 ACTG 241 Section 1 Issued on Februar 23, 1999 Within your group, step through the examples given in Chapters Four and Five. Cover each individual transaction and be sure every member of your group understands why the trans... Date Added: 2009-06-24 16:35:05 |
| lecture16.pdf Path: Berkeley >> EE >> 123 Fall, 2009 Description: ... Date Added: 2009-06-24 16:35:32 |
| Pbsetans1.doc Path: Sveriges lantbruksuniversitet >> CHEM >> 120 Fall, 2009 Description: NUSC 341 Set 1 Solutions to problem set #1 1) Use E = h = hc/ then = hc/E where c is velocity of light and h Planck constant. 19 1 eV = 1.602x10 J h = 6.626x10 34 J s c = 2.998x108 m s 1 One gets: for 10 eV : 124 nm (UV) 0.1 MeV = 105 eV : ... Date Added: 2009-06-24 16:39:37 |
| hw6.txt Path: Clarkson >> CS >> 451 Fall, 2009 Description: CS451/551 Artificial Intelligence Fall 2007 Assignment #6 due: Thursday, 11/8/07 The Assignment: - Download OTTER from http:/www-unix.mcs.anl.gov/AR/otter If you want you can run my version direc... Date Added: 2009-06-24 16:52:53 |
| CHEM 255 Assignment 1 Answers 2007.doc Path: St. Francis IL >> CHEM >> 255 Fall, 2009 Description: ... Date Added: 2009-06-24 16:53:11 |
| projectoutlineINBS540.doc Path: Mt. Mercy >> INBS >> 540 Fall, 2009 Description: COURSE PROJECT INBS540, Fall 07 Your Project Plan: The Indispensable Tool The project plan is the heart of project management. It defines the scope, resources, and schedule in one place, thus enabling you to keep these factors in balance throughout... Date Added: 2009-06-24 17:08:15 |
| hw2.pdf Path: Kent State >> MATH >> 61052 Fall, 2008 Description: MATH 6/71052 Homework #2 Due: Wednesday, January 30 Reading: For Mon., January 28: 8.2 For Weds., January 30: 8.3 Problems to turn in: 7.6: 1, 3, 4, 5(a), 5(c). 8.1: 4(a), 10, 11(a,b), 11(c). I. Determine the set of units in the ring of Gaussian Int... Date Added: 2009-06-24 17:11:57 |
| page134.pdf Path: Kent State >> MATH >> 61052 Fall, 2008 Description: ... Date Added: 2009-06-24 17:12:27 |
| sf_bee_tt_equipment_tracking.ppt Path: Stanford >> EE >> 392 Fall, 2009 Description: Frame 1 Frame 1 Frame 127 Frame 250 Frame 444 Frame 417 Frame 490 Frame 585 ... Date Added: 2009-06-24 17:16:26 |
| Reference letter guidelines.pdf Path: Indiana State >> CARBON >> 431 Fall, 2009 Description: Requests for reference letters must be made at least two weeks before the due date of the letter. When requesting a reference letter, please provide the following: (1) A clear and thorough description of what you are applying for (med school, grad sc... Date Added: 2009-06-24 17:18:07 |
| 5697.txt Path: UNC >> DOCS >> 5697 Fall, 2009 Description: The Project Gutenberg EBook of Tales of Chinatown, by Sax Rohmer This eBook is for the use of anyone anywhere at no cost and with almost no restrictions whatsoever. You may copy it, give it away or re-use it under the terms of the Project Gutenberg... Date Added: 2009-06-24 17:26:21 |
| 5928.txt Path: UNC >> DOCS >> 5928 Fall, 2009 Description: The Project Gutenberg EBook of The History of Don Quixote, Vol. II., Part 25, by Miguel de Cervantes This eBook is for the use of anyone anywhere at no cost and with almost no restrictions whatsoever. You may copy it, give it away or re-use it unde... Date Added: 2009-06-24 17:27:24 |
| 23170.txt Path: UNC >> DOCS >> 23170 Fall, 2009 Description: The Project Gutenberg EBook of A Brace Of Boys, by Fitz Hugh Ludlow This eBook is for the use of anyone anywhere at no cost and with almost no restrictions whatsoever. You may copy it, give it away or re-use it under the terms of the Project Gutenb... Date Added: 2009-06-24 17:28:27 |
| revsine16.doc Path: NYU >> B >> 2302 Fall, 2009 Description: Financial Reporting and Analysis Chapter 16 Solutions Intercorporate Equity Investments Exercises Exercises E16-1. Mark-to-market for trading and available-for-sale securities (AICPA adapted) 16-1 Requirement 1: Only the unrealized holding gains/los... Date Added: 2009-06-24 17:28:48 |
| dynam1a.doc Path: East Los Angeles College >> CIVE >> 1400 Fall, 2009 Description: Fluid Dynamics Objectives Introduce concepts necessary to analyse fluids in motion Identify differences between Steady/unsteady uniform/non-uniform compressible/incompressible flow Demonstrate streamlines and stream tubes Introduce the Continuity... Date Added: 2009-06-24 17:30:16 |
| YML133W-A.t2k.w0.5-logo.pdf Path: UCSC >> YML >> 133 Fall, 2009 Description: YML133W-A.t2k w0.5 1 M L I V XXXXXXXXXXXXXXXXXXXXX A E IIL LL VVI V I L V IFI LLL S S A VVV Y VIVAIIIAT V L G LL G S V I L G A G A I L V S G X X X XXXXXXXXXXXXXXXXXXXXXXXXXX S G G D S P G D V I L G A S A G S I G G D S P V... Date Added: 2009-06-24 17:31:45 |
| Moench.pdf Path: Stanford >> ERE >> 1977 Fall, 2009 Description: TRANSIENT P RESSURE ANALYSIS I N GEOTHERMAL STEAM R E S E R V O I R S WITH AN IMMOBILE V A P O R I Z I N G L IQUID P HASE - - SUMMARY REPORT A. F. Moench U .S. G e o l o g i c a l Survey Water Resources D i v i s i o n 3 45 M i d d l e f i e l d Roa... Date Added: 2009-06-24 17:34:11 |
| After Imus-End the Executions.doc Path: Texas Tech >> BA >> 5371 Fall, 2009 Description: WONDER LAND By DANIEL HENNINGER After Imus: End the Executions May 3, 2007; Page A16 Don Imus, Bernard McGuirk, Trent Lott, Larry Summers, the Duke lacrosse team, Jimmy the Greek, the kid who yelled \"water buffalo\" at Penn, Howard Cosell, Jon Stewa... Date Added: 2009-06-24 17:36:59 |
| 115 ch 14.xls Path: Drexel >> ACCT >> 115 Fall, 2009 Description: Ex. 14.2 2005 Sales . 163% Cost of goods sold .195% 2004 148% 160% 2003 123% 135% 2002 118% 123% 2001 100% 100% The trend of sales is favorable with an increase each year. However, the trend of cost of goods sold is unfavorable, because it is i... Date Added: 2009-06-24 17:37:34 |
| wksht3.pdf Path: Ill. Chicago >> MATH >> 182 Fall, 2008 Description: MATH 182 Emerging Scholars Workshop for Calculus II, Spring 2009 TA: Troy Hernandez Worksheet 3 1. a) 2 Evaluate the integral. r 5 0 4 r2 dr b) f (x)3 f (x) dx c) ln(cos1 x) dx (cos1 x) 1 x2 d) e2x e4x dx ex e) ex (e2x + 1)3 dx f) ln(ln x) dx... Date Added: 2009-06-24 17:43:34 |
| week2_inclass.doc Path: Columbia >> SW >> 2279 Fall, 2009 Description: PLAN4577:WEEK2:INCLASSEXERCISE TodayinclassIhopewegetanunderstandingofthefollowing: 1. GraspanUnderstandingoftheArcGISInterface. 2. UnderstandMapCompositionsandLayouts. 3. ViewInformationaboutDatafilesinArcCatalog. 4. LearnaboutMapSymbology. Step1:O... Date Added: 2009-06-24 17:46:21 |
| Joshi.doc Path: Stanford >> MSANDE >> 237 Fall, 2009 Description: Anjali Joshi, Executive Vice President Engineering Anjali Joshi directs all Covad engineering activities including the architecture, implementation and capacity management of Covad\'s national network. She also leads the development of Covad\'s network... Date Added: 2009-06-24 17:51:31 |
| w97 The Attorney General\'s List of Subversive Organizations 1948.doc Path: Minnesota >> HIST >> 1015 Fall, 2009 Description: The Attorney General\'s list of subversive organizations was published on the Federal Register 13 on 20 March 1948. The list consists of organizations classified as Soviet communist controlled. Inc. Abraham Lincoln Brigade Abraham Lincoln School,... Date Added: 2009-06-24 17:56:04 |
| PHYS2102003_grades_0927.pdf Path: LSU >> PHYS >> 2102 Spring, 2007 Description: SID 0005 0073 0145 0457 0812 0815 0923 0948 1060 1217 1264 1362 1467 1493 1585 1593 1639 1727 1784 1796 1940 2573 2713 2835 2967 2980 3102 3298 3417 3437 3567 3934 4223 4292 4306 4431 4435 4501 4686 4715 4854 5101 5387 5461 5498 5632 5658 5991 6168 6... Date Added: 2009-06-24 17:56:47 |
| kim.ppt Path: USC >> CSCI >> 586 Fall, 2008 Description: A Conceptual Architecture for Semantic Web Enabled Web Services Christoph Bussler, Dieter Fensel, and Alexander Maedche Outline Introduction SWWS Requirements Web Service Modeling Framework SWWS Conceptual Architecture Summary and Outlook In... Date Added: 2009-06-24 17:58:33 |
| 08HW4.pdf Path: Michigan >> PERSONAL >> 256 Fall, 2009 Description: Math 256 Applied Honors Calculus IV: Dierential Equations Fall 2008 Homework Set 4 Due Monday, October 6, 2008 Recommended Reading: Feynman Lectures on Physics Volume I, Chapter 22 is an interesting account of the complex exponential. It derives Eul... Date Added: 2009-06-24 18:02:39 |
| output.txt Path: Maryland >> ENEE >> 114 Fall, 2008 Description: Enter expression number 1 to be evluated: operand expected Enter expression number 2 to be evluated: Invalid Expression. Only single digit constants allowed Enter expression number 3 to be evluated: The value of the expression is: 23 Enter expres... Date Added: 2009-06-24 18:08:59 |
| YBL108C-A.t2k.str2-logo.pdf Path: UCSC >> YBL >> 108 Fall, 2009 Description: YBL108C-A.t2k STR2 3 2 1 CC 1 H H S XXXTXX X B S T CCSST H G X CC C T C Q H Y HSSSMM CY XXXXXXXXXXX X H HHHHH A A TTC T Z CX Z CZ A Y H A H X X H C C Y C CYZQZ S H C TSST C T XXXXXXXXXXXCHX X XX H X X HH 10 20 30 H ZH T 40 M... Date Added: 2009-06-24 18:10:35 |
| RUSSIPOL.pdf Path: DePaul >> GEO >> 100 Fall, 2009 Description: 60N 20W 80N 160 E 180 W 0 14 160W 160 W 0 40 RUSSIAN REGION Political Map Over 1,000,000 500,0001,000,000 (selected cities) Selected smaller cities 0 0 250 250 500 km 500 mi 50 N A r c tic e Circl 40 E 180 1 60 E 80E 120 E 40 E 16... Date Added: 2009-06-24 18:13:37 |
| GRP 7 the secret garden.ppt Path: Laurentian >> MGT >> 3806 Fall, 2009 Description: TheSecretGarden Business Plan Presented by Jason Adams Morgan Bell Rosalind Davis Sara Inkster Vishal Joshi Xiao Li Executive Summary Remembering special occasions is the highlight to every relationship Devoted to making that special someone feel ... Date Added: 2009-06-25 18:17:53 |
| CO840205.pdf Path: Minnesota >> ECON >> 8402 Fall, 2008 Description: ... Date Added: 2009-06-25 18:19:12 |
| HD110434.bigplot.ps Path: Cal Poly Pomona >> A >> 12019 Fall, 2009 Description: ... Date Added: 2009-06-25 18:21:57 |
| Lecture 22.pdf Path: Colorado >> APS >> 1120 Fall, 2009 Description: ASTR 1120 May 1 The Last Lecture . The Big Bang The New Cosmology Final Exam will be in this room 1:30-4:00, Wednesday May 7 Robyn will hold a review session in G131 Monday, May 5, from 5 to 6pm I will be in my office by 11:30 on Wednesday. Third E... Date Added: 2009-06-25 18:22:23 |
| Lecture22-Devel-Metamor.pdf Path: Sveriges lantbruksuniversitet >> BISC >> 317 Fall, 2009 Description: DEVELOPMENT AND METAMORPHOSIS Eggs hatch from eggshell = ECLOSION - insects emerge with a body that has adult number of segments - EPIMORPHIC - the immature insect begins to feed and grow until it reaches adulthood. - But this is difficult because it... Date Added: 2009-06-25 18:24:58 |
| A_1055B.TXT Path: Texas A&M >> ODP >> 1055 Fall, 2009 Description: Sheet1 SiteHoleCoreTypeSectionInt1Int2mbsfRaw a*Sm a*Offsetmcd 1055B1H199.10.090.270.270.150.24 1055B1H11414.10.140.110.110.150.29 1055B1H11919.10.19-0.19-0.190.150.34 1055B1H12424.10.24-0.3-0.220.150.39 1055B1H12929.10.29-0.2-0.30.150.44 1055B1H1343... Date Added: 2009-06-25 18:30:04 |
| thx1910.txt Path: UNC >> DOCS >> 2939 Fall, 2009 Description: *The Project Gutenberg Etext of The Circulation of the Blood* #39 in our series by Thomas H. Huxley Copyright laws are changing all over the world, be sure to check the laws for your country before redistributing these files! Please take a look at ... Date Added: 2009-06-25 18:35:54 |
| jchgr10.txt Path: UNC >> DOCS >> 2963 Fall, 2009 Description: The Project Gutenberg Etext of Holland and Germany by Jacques Casanova #13 in our series by Jacques Casanova Copyright laws are changing all over the world, be sure to check the laws for your country before redistributing these files! Please take a... Date Added: 2009-06-25 18:36:11 |
| Lawn-Care.doc Path: Iowa State >> HORT >> 121 Fall, 2008 Description: Lawn Care Review Functions of the home landscape? What trees should you avoid? What are the 3 main categories of nursery trees? What color should a trunk wrap be? Should mulch be mounded up to the trunk? Outline Lawn care Types of Grasses ... Date Added: 2009-06-25 18:38:10 |
| PruningTrees.doc Path: Iowa State >> HORT >> 121 Fall, 2008 Description: Hort 121 - Pruning Trees Answer these questions on a sheet of paper w/ your name What is Pruning? Should the lower limbs of a tree be removed at planting first years (limbed-up)? What is the proper way to remove a large limb? What time of ye... Date Added: 2009-06-25 18:38:11 |
| infoproc.ppt Path: Western Kentucky University >> PSY >> 321 Fall, 2008 Description: The information-processing approach Multistore models (structure over process) Limited-resource model (process over structure) The information-processing approach Multistore models (structure over process) Limited-resource model (process over struct... Date Added: 2009-06-25 18:41:17 |
| retest02_ans.pdf Path: SUNY Albany >> MATH >> 112 Fall, 2009 Description: Retest #2 Answers 1) Use implicit differentiation and the chain rule to find the derivative of (2x + 4y)4 = xsec(csc(2x + 4y). 4(2x + 4y)3(2 + 4dy/dx) = sec(csc(2x + 4y) sec(csc(2x + 4y)tan(csc(2x + 4y)csc(2x + 4y)cot(2x + 4y)(2 + 4dy/dx) dy /dx[16(... Date Added: 2009-06-25 18:44:35 |
| homework-set-01-answers.pdf Path: Mines >> PH >> 398 Fall, 2009 Description: ... Date Added: 2009-06-25 18:45:05 |
| acetatesD.pdf Path: NSULA >> H >> 100 Fall, 2009 Description: Chapitre 13 13.1 13.2 13.3 13.4 13.5 13.6 13.7 Thorie des graphes Graphes et chemins Reprsentation matricielle des graphes Classes de graphes particulires Isomorphisme Circuits Hamiltoniens Graphes planaires Arbres 13.1 Graphes et chemins Graphe... Date Added: 2009-06-25 18:45:37 |
| assignment4.ps Path: Cornell >> CS >> 211 Fall, 2008 Description: %!PS-Adobe-2.0 %Creator: dvips 5.55 Copyright 1986, 1994 Radical Eye Software %Title: mwu-final.dvi %CreationDate: Tue Feb 25 23:26:25 1997 %Pages: 7 %PageOrder: Ascend %BoundingBox: 0 0 612 792 %EndComments %DVIPSCommandLine: dvips mwu-final %DVIPSP... Date Added: 2009-06-25 18:46:18 |
| DlabDio5_sch.pdf Path: Cal Poly >> CPE >> 329 Fall, 2009 Description: ... Date Added: 2009-06-25 18:52:10 |
| 20091SpringNJITPhys202A102grades.doc Path: NJIT >> PHYS >> 202 Fall, 2009 Description: New Jersey Institute of Technology College of Science and Liberal Arts Department of Physics Introductory Astronomy and Cosmology Laboratory, Section 102 Phys 202A102 Spring 2009 Mondays, 06:00 p.m. to 08:00 p.m. Tiernan Hall, Room 409 Final Grades ... Date Added: 2009-06-25 18:52:57 |
| ESS 439 Lecture 18 slides.pdf Path: Washington >> ESS >> 439 Fall, 2008 Description: Arc magmatism (volcanic/plutonic) Arcuate/linear chains of volcanoes and/or plutons developed above active subduction zones. Why are the chains arcuate? The arc magma paradox. Why is there magmatic activity in regions where cold lithospheric slabs ar... Date Added: 2009-06-25 18:55:07 |
| xzero.txt Path: Berkeley >> ASTRO >> 00152325 Fall, 2009 Description: Source Contamination: 1.74E-06 +/- 7.8E-08 cts/s ... Date Added: 2009-06-25 18:56:56 |
| Strength Training Terminology.doc Path: MN State >> PE >> 102 Fall, 2009 Description: PE 102 Weight Training Strength Training Terminology The following terms are used in all strength training programs and familiarity with these terms will help you to understand the rest of the text. Intensity Volume Repetition The amount of resistan... Date Added: 2009-06-25 19:00:10 |
| scop99_1_1.pdf Path: Pittsburgh >> AEI >> 841 Fall, 2009 Description: The Reform of the EU Structural Funds: 10 Questions on the Magnitude and Direction of Reforms* Frank Bollen1 Lecturer, EIPA Introduction As part of the Agenda 2000 package, the EU Structural Funds are currently going through a reform process in orde... Date Added: 2009-06-25 19:01:31 |
| ESM210slides5.ppt Path: UCSB >> ESM >> 210 Fall, 2008 Description: ESM210StrategicManagement Session5 C and Diffe ntiation S gie ost re trate s Magali De as lm C ourseoutline Firmscompetitiveenvironment(Automobileindustry); BMWthehydrogencar Social,political,technologicalandnaturalenvironmentof firms(Environment... Date Added: 2009-06-25 19:01:36 |
| Enonce_Lab2.pdf Path: Université du Québec à Montréal >> M >> 224674 Fall, 2009 Description: 2007-04-16 But Laboratoire n 2 Plan de projet logiciel En se basant sur votre document de vision (labo 1), laborer un plan de projet logiciel en utilisant un gabarit Gabarit de la socit Rational Software intitul Software Development Plan lequel se t... Date Added: 2009-06-25 19:03:35 |
| wp125En.pdf Path: Pittsburgh >> AEI >> 11010 Fall, 2009 Description: Economic Importance of Belgian Transport Logistics Working Paper Document by Frdric Lagneaux January 2008 No 125 NATIONAL BANK OF BELGIUM WORKING P APERS - DOC UMENT SERIES ECONOMIC IMPORTANCE OF BELGIAN TRANSPORT LOGISTICS __ Frdric Lagneaux ... Date Added: 2009-06-25 19:07:37 |
| Practice-Problems04-Solutions.ps Path: Toledo >> AER >> 334 Fall, 2009 Description: %!PS-Adobe-2.0 %Creator: dvips(k) 5.86 Copyright 1999 Radical Eye Software %Title: Practice-Problems04-Solutions.dvi %Pages: 2 %PageOrder: Ascend %BoundingBox: 0 0 612 792 %DocumentFonts: CMBX12 CMR10 CMMI10 CMR8 CMSY10 CMBX10 CMMI8 CMEX10 %+ CMSY8 %... Date Added: 2009-06-25 19:07:39 |
| FamilyDynamics80211.pdf Path: SIU Edwardsville >> CS >> 598 Fall, 2008 Description: The Family Dynamics of The 802.11 family of standards is helping to move wireless LANs into promising new territory. 802.11 T hree trends are driving the rapid growth of wireless LAN (WLAN): The increased use of laptops and personal digital assistan... Date Added: 2009-06-25 19:11:37 |
| TSM2.pdf Path: Allan Hancock College >> PHYS >> 3905 Fall, 2009 Description: Lecture 2 Maxwell Distribution: Ideal Gases In this lecture I introduce the Maxwellian distribution, and use it to derive some properties of ideal gases. The Maxwell distribution of velocities describes the thermal motions of distribution of classic... Date Added: 2009-06-25 19:12:59 |
| StartNetBeans.doc Path: East Los Angeles College >> CS >> 288 Fall, 2009 Description: 1 Setting Up NetBeans IDE for Java Projects CS288, Autumn 2005 Purpose This short document leads you through how to set up NetBeans for the first Lab exercises. By the end of the document you should have initialised the necessary folders and compila... Date Added: 2009-06-25 19:16:34 |
| AutoCAD2008AdvancedTools_Part4_DimensionStyle.pdf Path: Drexel >> ARCH >> 150 Fall, 2009 Description: Other useful tools Dimension Type dimlin into the Command line to add dimensions to your drawing. The arrows and text will probably not be correctly sized for your drawing. To adjust this, click the Dimension Style Manager button to make adjustments.... Date Added: 2009-06-25 19:16:54 |
| 23712-readme.txt Path: UNC >> DOCS >> 23712 Fall, 2009 Description: The Project Gutenberg EBook Tarzan of the Apes by Edgar Rice Burroughs This eBook is for the use of anyone anywhere at no cost and with almost no restrictions whatsoever. You may copy it, give it away or re-use it under the terms of the Project Gu... Date Added: 2009-06-25 19:16:58 |
| lecture slide_3.pdf Path: Youngstown >> ECON >> 3790 Fall, 2008 Description: Econ 3790: Business and Economics Statistics Instructor: Yogesh Uppal Email: yuppal@ysu.edu Lecture Slides 3 Measures of Variability Measures of Distribution Shape, Relative Location, and Detecting Outliers Introduction to probabilities Coefficien... Date Added: 2009-06-25 19:25:50 |
| christley-abstract.txt Path: Oakland University >> CSE >> 598 Fall, 2009 Description: Agent-based Simulation of Morphogenesis Scott Christley Xiaorong Xiang ABSTRACT We will design and implement an agent-based model and simulation of three-dimensional morphogenesis for cell sorting and chicken limb growth. Agent-based simulation i... Date Added: 2009-06-25 19:34:00 |
| Carmen Hung_488_TheFemaleGothic.ppt Path: Sveriges lantbruksuniversitet >> CMNS >> 488 Fall, 2009 Description: Gothic Facebook Group Gothic, Gender and Identity Sexuality and The Female Body Gothic as Subculture? Sarah Brightmans Symphony Andy Bennett: Style Tribe In consuming popular music the individual is free to choose, not only between various music... Date Added: 2009-06-25 19:40:29 |
| 0205.pdf Path: Washington >> GS >> 55304 Fall, 2009 Description: GENOME553 Winter 2004 Paper for Thursday 5 February 2004 Rrth, P. 1996. A modular misexpression screen in Drosophila detecting tissue-specific phenotypes. Proc. Natl. Acad. Sci. USA 93: 12418-12422. Brand and Perrimon (1993) showed that the GAL4 tr... Date Added: 2009-06-25 19:41:40 |
| Syllabus.doc Path: Minnesota >> CHAK >> 0036 Fall, 2009 Description: UNIVERSITYWRITINGANDCRITICALREADING EngC1011.014,M57:30pm LindH303 MadhurimaChakraborty OfficeHours:M35pm(andbyappointment) Email:chak0036@umn.edu Mailbox:Lind330b OfficeLind26 TEXTREQUIREMENT: Barnet,SylvanandHugoBedau.CurrentIssuesandEnduringQuest... Date Added: 2009-06-25 19:45:04 |
| 081-MASx.pdf Path: Arizona >> SCHEDULE >> 081 Fall, 2009 Description: Crs. # (units) Call # Sec # Course/Section Title Time Days Instructor Bldg. Room # Crs. # (units) Call # Sec # Course/Section Title Time Days Instructor Bldg. Room # MEXICAN-AMERICAN STUDIES (MAS ) Dr. Antonio Estrada, Department Head, Cesar ... Date Added: 2009-06-25 19:50:13 |
| ICNDCh6.ppt Path: CSU Chico >> ECE >> 255 Fall, 2009 Description: Bridged/Switched Networks Nature and function of bridged/switched network is to provide enhanced network services by segmenting network into multiple collision domains However, without some other mechanism, bridged/switched network is still a singl... Date Added: 2009-06-25 20:12:48 |
| man-k-email.txt Path: UMBC >> LEC >> 201 Fall, 2009 Description: audiosend (1) - Send an audio email message showaudio (1) - Play an audio email message ... Date Added: 2009-06-25 20:13:20 |
| Animales_MesoAmericanos.pdf Path: Holy Cross College >> SPAN >> 409 Fall, 2009 Description: ... Date Added: 2009-06-25 20:15:14 |
| week7.ppt Path: Allan Hancock College >> COMP >> 2070 Fall, 2009 Description: 1 Semester 1, 2009 Lecture 7 IPv6 and Migration COMP5116 The University of Sydney 2 Comer Readings Chapter 31 IPv6 overview The University of Sydney 3 Outline Introduction Motivation: whats wrong with IPv4 IPv6 overview IPv6 descriptio... Date Added: 2009-06-25 20:16:50 |
| FINAL Programmers Manual.pdf Path: WVU >> EE >> 480 Fall, 2008 Description: WEST VIRGINIA UNIVERSITY Lane Department of Computer Science and Electrical Engineering BIOM/CpE/CS/EE 481: Senior Design Project Fall 2005 Assignment: BioWeb: Biometric Web Access Programmer Manual December 12, 2005 Group 16 Bio-Web: Biometric Web... Date Added: 2009-06-25 20:17:26 |
| 496498 Summer 2008 3.doc Path: UNLV >> FACULTY >> 496498 Fall, 2009 Description: 1 Psy 496 Independent Study and Psy 498 Independent Research Psy 766 Independent Study Kim Barchard Summer 2008 Students enrolled: Psy 496 Shatoyia Burns (2 credits), Heidi Johanson (2 credits), Viridiana Linares (1 credit), Holly Walker (3 credits),... Date Added: 2009-06-25 20:17:58 |
| AlternateConcepts.doc Path: WVU >> EE >> 480 Fall, 2008 Description: WEST VIRGINIA UNIVERSITY Lane Department of Computer Science and Electrical Engineering EE/CpE 480 Senior Design Seminar Spring 2005 ALTERNATE CONCEPTS SUBMISSION DATE: 03/21/2005 GROUP 21: NSA/Identix Biometric Demo TEAM MEMBERS Brendan Forst Jeffr... Date Added: 2009-06-25 20:19:44 |
| SystemDescription.doc Path: WVU >> EE >> 480 Fall, 2008 Description: WEST VIRGINIA UNIVERSITY Lane Department of Computer Science and Electrical Engineering EE/CpE 480 Senior Design Seminar Spring 2005 System Description and Performance Analysis SUBMISSION DATE: 04/04/2005 GROUP 21: NSA/Identix Biometric Demo TEAM ME... Date Added: 2009-06-25 20:19:45 |
| readings_102005.pdf Path: CUNY Baruch >> GEOG >> 383 Fall, 2009 Description: Land Use and Urban Spatial Development Fall 2005 Readings for October 20th class. Items to review or read are highlighted in Yellow Urban Land Use Modeling: SLEUTH Applications and Associated Analyses Websites Project Gigalopolis: Urban and Land Cov... Date Added: 2009-06-25 20:23:35 |
| lecture2.pdf Path: Carnegie Mellon >> CS >> 10701 Fall, 2009 Description: Machine Learning 10-701/15-781, Fall 2008 10- 701/15- Theory of Classification and Nonparametric Classifier Eric Xing Lecture 2, September 10, 2008 Reading: Chap. 2,5 CB and handouts Eric Xing @ CMU, 2006-2008 Classification Representing data: X1... Date Added: 2009-06-25 20:33:05 |
| Problem Set 9 Rev01.pdf Path: ECCD >> ELEC >> 2501 Fall, 2009 Description: Problem Set 9 (Posted for Tuesday Nov. 14/06) Resonance: 9.1 Given the network below find 0, V0 ( 0 ) and Q. 9.2 Repeat Problem 9.1 if the value of R is changed to 1 . 9.3 Determine the resonant frequency, Q, BW, and the average power dissipated by ... Date Added: 2009-06-25 20:34:31 |
| T0403.t06.o_notor-logo.pdf Path: UCSC >> T >> 0403 Fall, 2009 Description: T0403.t06 o_notor 3 2 1 MGRDLQVTLYGTIKAGVEVSRVKDAGTYKAQGGKSKTATQIADFGSKIGFKGQEDLGNGMKAIWQLEQKASIAGTNSGWGNRQSFIGLKGGFGTVRAGNL 1 10 20 30 40 50 60 70 80 90 N 3 2 1 P MPN ABN AB AB N B N B PBN NTVLKDSGDNVNAWESGSNTEDVLGLGTIGRVESREISVRYDSPVFAGFSGS... Date Added: 2009-06-25 20:40:18 |
| l08a_09_program_control_instructions.pdf Path: Appalachian State >> PHY >> 4635 Fall, 2009 Description: PHY4635/5635 Spring 2009 Lecture 8: Program Control Instructions Short, Near and Far Jumps Short jump: jump is within +127 to -128 bytes from the address following the jump. Relative jumps: moves with the code since it stores only the relative dis... Date Added: 2009-06-25 20:44:19 |
| n003.pdf Path: Rutgers >> FO >> 1957 Fall, 2009 Description: e v u h r h F $ e q $ & g v g h h u F h 2 l Y $ i v o e o e r 0 io ` g G g ) ) Y1 ! fY| (t iQ7) 01 o ) ... Date Added: 2009-06-25 20:46:33 |
| HumanPop1.xls Path: Michigan State University >> FW >> 364 Spring, 2008 Description: Human population size (N) Source: Pulliam and Haddad (1994). year 1800 1850 1870 1890 1910 1930 1950 1970 1975 1980 1985 1990 1995 N 910000000 1130000000 1300000000 1490000000 1700000000 2020000000 2510000000 3620000000 3970000000 4410000000 48400000... Date Added: 2009-06-25 20:52:53 |
| c7.pdf Path: Purdue >> CS >> 158 Fall, 2008 Description: 150 Chapter 7: Least-Squares Method Least-Squares Data Fitting (An application of simultaneous-equation solving.) Given a set of data values (generated from an experiment or a computer simulation), we often want to determine a function that best app... Date Added: 2009-06-25 20:53:20 |
| m051nt.pdf Path: East Los Angeles College >> M >> 051 Fall, 2009 Description: M051 Preface to Miao songs and stories. Document E. By Yang Yung-xing. Notes. Line 3. The Ndu-na-yi-mo, !\"#$!\"%!&\'!()* was the great river which flowed through the ancient Miao homeland. Under Chinese pressure they had ultimately to abandon the home... Date Added: 2009-06-25 20:53:44 |
| 320 -- Chapter 9 (Study Problems).doc Path: CSU Fullerton >> FIN >> 320 Fall, 2009 Description: Study Problem 9-2(a) Determine the IRR for the following project: An initial outlay of $10,000 resulting in a cash flow of $1,993 at the end of each year for the next 10 years. Keystrokes 2nd P/Y 1 ENTER CE/C CE/C 2nd CLR TVM 10000 +/- PV 10 N 1993 P... Date Added: 2009-06-25 20:55:30 |
| Assignment2_Methods.doc Path: Maple Springs >> PSYC >> 3010 Fall, 2009 Description: Methods Von Restorff effect experiment Maximum of 1000 words Double-spaced When in doubt, follow APA guidelines Describe what was done under these headings: participants stimulus and task design analysis On course Website: Excel spreadsheet of Experi... Date Added: 2009-06-25 21:00:41 |
| notesA.pdf Path: Utah >> CS >> 6220 Spring, 2008 Description: ... Date Added: 2009-06-25 21:08:12 |
| modeloscillatoryexper.pdf Path: Minnesota >> SHAP >> 0029 Fall, 2009 Description: 8.0E5 1.2E6 Lake Volume, m3 Lake Volume, m3 7.0E5 6.0E5 5.0E5 4.0E5 3.0E5 2.0E5 30 year period 10 year period running mean 1.0E6 8.0E5 6.0E5 4.0E5 2.0E5 0 30 year period 10 year period running mean d18O, VSMOW d18O, VSMOW 60 70 80 90 100 -4... Date Added: 2009-06-25 21:08:42 |
| chem120a_exam3_yang_sol.pdf Path: Berkeley >> CHEM >> 120 Fall, 2009 Description: Chem120a : Exam 3 (Chem Bio) Solutions November 27, 2006 Problem 1 This problem will basically involve us doing two Hckel calculations: one for the linear geometry, u and one for the triangular geometry. Well start with the linear geometry. In this... Date Added: 2009-06-25 21:11:53 |
| Guide to making circuit diagrams.docx Path: UCSD >> MAE >> 156 Fall, 2008 Description: vti_encoding:SR|utf8-nl vti_timelastmodified:TR|09 Oct 2008 23:54:44 -0000 vti_extenderversion:SR|5.0.2.6790 vti_backlinkinfo:VX|old_announcements-Fall2008.htm ... Date Added: 2009-06-25 21:11:58 |
| gauss_ep_flu.txt Path: Berkeley >> ASTRO >> 00164279 Fall, 2009 Description: # Ep lEiso 1.023 -11.748 1.052 -11.853 1.208 -11.811 1.302 -11.574 1.351 -11.701 1.464 -11.910 1.535 -11.803 1.597 -11.686 1.692 -11.816 1.696 -11.811 1.790 -11.680 1.984 -11.753 2.055 -11.559 2.203 -11.658 2.346 -11.753 2.405 -11.894 2.663 -11.704 2... Date Added: 2009-06-25 21:15:17 |
| telecom.txt Path: Creighton >> MBA >> 553 Fall, 2009 Description: From tbegley@creighton.edu Tue Feb 29 09:15:46 2000 Date: Tue, 29 Feb 2000 09:14:50 -0600 (CST) From: \"Terry Begley, CoBA Technology Coordinator\" <tbegley@creighton.edu> Reply-To: mis353c@creighton.edu To: mis353c@creighton.edu Subject: [mis353c] TEL... Date Added: 2009-06-25 21:15:20 |
| interest spread.xls Path: CSU Northridge >> PMB >> 64311 Fall, 2009 Description: PercentCompositioninHumans element percent Hydrogen 61.0% Oxygen 26.0% Carbon 10.5% Nitrogen 2.4% Calcium 0.2% Phosphorus 0.1% Sulphur 0.1% ElementalCompositionofHumans 70.0% 60.0% 50.0% 40.0% Percent 30.0% 20.0% 10.0% 0.0% 10.5% 2.4% Hydrogen Oxyge... Date Added: 2009-06-25 21:16:32 |
| IS 387 Guest Lecture.docx Path: UMBC >> IS >> 387 Fall, 2008 Description: IS 387 0301 Guest Lecture Names _ Instructions : Please complete in pairs and hand-in at end of lecture Web Site Evaluation in terms of grouping, ordering, decoration, alignment, white space and clutter Is site compliant for disabled users? Check ... Date Added: 2009-06-25 21:16:49 |
| guestspeakercelese.pdf Path: UMBC >> IS >> 387 Fall, 2008 Description: Soyouwanttobean InformationArchitect? Presentedby: CelesteLynPaul HCC,UMBC IS387 April212009 About Celeste Education HumanCenteredComputing UMBC 2 WorkExperience SeniorInteractionArchitect UserCenteredDesign,Inc. M.S.InteractionDesignand Informa... Date Added: 2009-06-25 21:16:49 |
| Week 1 Equations 08.pdf Path: Kentucky >> BAE >> 103 Fall, 2008 Description: BAE 103: Energy in Biological Systems Equations Force, Work, and Power (Week 2) F = ma F= Gm1m2 = mg R2 F d = F v t W = F d H= Heat Engines (Week 2) e= Th Tl Th Fluid Statics (Week 5) p= F A m v pabs = patm + p guage s.g . = p = gh = ... Date Added: 2009-06-25 21:19:10 |
| 124.figGD.ps Path: Washington >> K >> 124 Fall, 2009 Description: ... Date Added: 2009-06-25 21:26:42 |
| 124.figMH.ps Path: Washington >> K >> 124 Fall, 2009 Description: ... Date Added: 2009-06-25 21:26:48 |
| l15.ps Path: Michigan >> EECS >> 498 Fall, 2008 Description: %!PS-Adobe-2.0 %Creator: dvips 5.83 (MiKTeX 1.20a) Copyright 1998 Radical Eye Software %Title: l15.dvi %CreationDate: Fri Mar 07 01:52:18 2003 %Pages: 11 %PageOrder: Ascend %BoundingBox: 0 0 596 842 %EndComments %DVIPSWebPage: (www.radicaleye.com) %D... Date Added: 2009-06-25 21:28:48 |
| USC.Introduction.to.Computer.Forensics.Day.1.pdf Path: USC >> ITP >> 499 Fall, 2009 Description: Introduction to Computer Forensics David Nardoni CISSP, EnCE dnardoni@firstresponseconsulting.com Chi So chiso@usc.edu 2005 First Response Consulting Services, Inc. All Rights Reserved Overview Introduction to computer forensics Hand out and disc... Date Added: 2009-06-25 21:29:12 |
| HW02s03.pdf Path: Georgia Tech >> ECE >> 2025 Fall, 2008 Description: GEORGIA INSTITUTE OF TECHNOLOGY SCHOOL of ELECTRICAL and COMPUTER ENGINEERING ECE 2025 Spring 2003 Problem Set #2 Assigned: 13-Jan-03 Due Date: Week of 20-Jan-03 Reading: In SP First, all of Ch. 2, and start reading in Chapter 3: Spectrum Representa... Date Added: 2009-06-25 21:31:52 |
| 1915_complete.pdf Path: CSU Chico >> BCD >> 1915 Fall, 2009 Description: ... Date Added: 2009-06-25 21:32:24 |
| arch.pdf Path: DePaul >> LECTURE >> 536 Fall, 2009 Description: NTP Architecture, Protocol and Algorithms David L. Mills University of Delaware http:/www.eecis.udel.edu/~mills mailto:mills@udel.edu Sir John Tenniel; Alices Adventures in Wonderland,Lewis Carroll 22-Jul-07 1 Process decomposition Server 1 Peer... Date Added: 2009-06-25 21:33:15 |
| Lec5.pdf Path: Princeton >> CHE >> 199 Fall, 2009 Description: Lecture 5: Refrigerants: Food Spoilage Need for Refrigerant Food storage and prevention of spoilage Desiccation, salt and sugar curing Acidity and alkalinity, pickling Low temperature, ice Air condition, de-humidification, human comfort, hospi... Date Added: 2009-06-25 21:36:21 |
| sp04-part3v03.ps Path: Maryland >> CMSC >> 420 Fall, 2005 Description: %!PS-Adobe-2.0 %Creator: dvips(k) 5.86 Copyright 1999 Radical Eye Software %Title: sp04-part3v03.dvi %Pages: 30 %PageOrder: Ascend %BoundingBox: 0 0 612 792 %EndComments %DVIPSWebPage: (www.radicaleye.com) %DVIPSCommandLine: dvips sp04-part3v03 %DVIP... Date Added: 2009-06-25 21:39:55 |
| recursion.ppt Path: ECCD >> SCS >> 2402 Fall, 2009 Description: How The Recursive Method Works public class Recursive { public static void main (String [ ] args) { int [ ] a = {2, 4, 1, 5}; int s = sum (a, 4); System.out.println(s); } public static int sum (int [ ] a, int n) { int s; if (n = 1) { s = a[0]; } else... Date Added: 2009-06-25 21:41:14 |
| NOTES_CH_8.pdf Path: Cincinnati >> ENFD >> 382 Fall, 2008 Description: Chapter 8 Exergy: A Measure of Work Potential Study Guide in PowerPoint to accompany Thermodynamics: An Engineering Approach, 5th edition by Yunus A. engel and Michael A. Boles The energy content of the universe is constant, just as its mass conten... Date Added: 2009-06-25 21:43:37 |
| ep_fl_dat.txt Path: Berkeley >> ASTRO >> 00303609 Fall, 2009 Description: # Ep dEp lprob lEiso dlEiso 30.131 0.025 4.69e-05 -11.208 0.161 30.158 0.029 1.44e-04 -11.208 0.152 30.189 0.033 2.51e-04 -11.208 0.151 30.224 0.038 3.46e-04 -11.208 0.151 30.264 0.043 4.30e-04 -11.208 0.151 30.311 0.049 4.94e-04 -11.208 0.151 30.364... Date Added: 2009-06-25 21:44:54 |
| 341-Lecture12.ppt Path: W. Alabama >> CS >> 341 Fall, 2009 Description: Lecture 12: Lower bounds By \"lower bounds\" here we mean a lower bound on the complexity of a problem, not an algorithm. Basically we need to prove that no algorithm, no matter how complicated or clever, can do better than our bound. This is often h... Date Added: 2009-06-25 21:46:25 |
| exm2s96.doc Path: CSU San Marcos >> PS >> 100 Fall, 2009 Description: PSCI 100 Spring, 1996 Dr. Nichols STUDY QUESTION FOR MID-TERM #2 One of the following questions will be randomly selected for the second mid-term exam. Be ready to answer any of them, then, and you will do well. Remember that the best answers integra... Date Added: 2009-06-25 21:48:37 |
| tf5500.txt Path: UCSB >> CS >> 130 Fall, 2009 Description: 1 CreateSet backyarder CreateSet accessaries CreateSet achieve CreateSet achievements CreateSet acanthaceae Insert backyarder tubber ReplaceSetName backyarder acheulean ReplaceSetName accessaries acanthad ReplaceSetName acheulean achigan ReplaceSetNa... Date Added: 2009-06-25 21:48:58 |
| Exam2a.pdf Path: UMass (Amherst) >> CH >> 112 Fall, 2009 Description: Chemistry 112, Fall 2006, Section 1 (Garman and Heuck) Exam 2a (100 points) 9 Nov 2006 Name: _ YOU MUST: Put your name and student ID on the bubble sheet correctly. Put the exam number on the bubble sheet on the upper left side above the word NAME.... Date Added: 2009-06-25 21:49:27 |
| facteurs.pdf Path: Université du Québec à Montréal >> R >> 10735 Fall, 2009 Description: ECO 6080 : Economie nanci`re e Mod`les factoriels de la variance et du e rendement anticip e Steve Ambler Dpartement des sciences conomiques e e Ecole des sciences de la gestion Universit du Qubec ` Montral e e a e c 2003, 2004, 2005, 2007 : Steve ... Date Added: 2009-06-25 21:49:48 |
| pchap4.pdf Path: Rutgers >> MATH >> 591 Fall, 2008 Description: Chapter 4 Convergence in Distribution and the Central Limit Theorem 4.1 Motivation: the central limit problem. Consider a sequence of i.i.d. random variables X1 , X2 , . . . with nite mean n and nite variance 2 , and let Sn = 1 Xi , n 1, denote th... Date Added: 2009-06-25 21:51:28 |
| dtsfcal-stack-52532-log.ps Path: Stanford >> MEETING >> 050301 Fall, 2009 Description: %!PS-Adobe-2.0 %Title: dtsfcal-stack-52532-log.ps (Portrait A 4) %Pages: (atend) %Creator: HIGZ Version 1.26/04 %CreationDate: 2005/03/01 13.21 %EndComments %BeginProlog /s {stroke} def /l {lineto} def /m {moveto} def /t {translate} def /sw {stringwi... Date Added: 2009-06-25 21:55:39 |
| Social Awareness Project.ppt Path: E. Kentucky >> ST >> 729 Fall, 2009 Description: RUNNING WORKOUT AllenQuesadaPacheco Stretching Calf:Standafootfromawall,post,ortree.Holdingonlightlywithyourhands,placetoeof Groin:Sitwiththesolesoffeettogether,backstraight,andheadup.Gentlyleanforwardas youpressthighswithelbows,holdingfor30seco... Date Added: 2009-06-25 22:00:31 |
| final-a06.pdf Path: NSULA >> GEL >> 19966 Fall, 2009 Description: Algorithmes de ling nieur I (IFT-19966) e D partement de G nie electrique et de G nie Informatique e e e Automne 2006 EXAMEN FINAL Instructions : 1 feuille aide-m moire manuscrite est permise (recto-verso) e Utilisez le verso des pages pour les b... Date Added: 2009-06-25 22:02:24 |
| AugmentedTM.doc Path: CSU Chico >> CSCI >> 256 Fall, 2009 Description: 7#$#)-# # # # # #!#J######(#(#(#(#(#(#A ugmented Turing MachinesWhat possible variations on Turing machines might one anticipate. Doubly-infinite Multi-tracks Multi-tapes Multi-heads Nondeterminist... Date Added: 2009-06-25 22:03:41 |
| Pythagorean.ppt Path: N. Georgia >> ACJACK >> 3190 Fall, 2009 Description: InGSP Pythagorean Theorem InaRIGHTTriangle c a 2 + b2 = c2 a b Whydowesquareeachside? Does this picture give you a hint? c b a Pythagorean Theorem Becauseitisactuallytheareaofthe squaresmadebyeachofthesidesthat causestherel... Date Added: 2009-06-25 22:04:58 |
| Lab1el304.rtf Path: Capitol College >> CS >> 356 Fall, 2009 Description: Objective: The objective of this lab is to familiarize myself with standard logic gates; AND, OR and NOT using a Simulation software. Materials: circuit maker 74xx08 74xx32 Chips that we would use: Assignment: A bank vault has three locks with a d... Date Added: 2009-06-25 22:06:40 |
| Concluding Design Example2.pdf Path: Washington University in St. Louis >> CSE >> 131 Fall, 2009 Description: ... Date Added: 2009-06-25 22:07:28 |
| Writing Assignment 4.pdf Path: Western Michigan >> MATH >> 1100 Fall, 2008 Description: Math 1100 Writing Assignment 4 Name: _ Instructor&Class Time: _ Attach this cover sheet to your work. Be sure to completely answer each of the following questions. 1) You are asked to graph some data in which the input values range from 0 to 150 and ... Date Added: 2009-06-25 22:08:15 |
| PAL22V10_address_decoding.pdf Path: Oregon State >> ECE >> 573 Fall, 2008 Description: FINAL COML: -7/10/15 PAL22V10 Family, AmPAL22V10/A 24-Pin TTL Versatile PAL Device DISTINCTIVE CHARACTERISTICS s As fast as 7.5-ns propagation delay and 91 MHz fMAX (external) s 10 Macrocells programmable as registered or combinatorial, and active ... Date Added: 2009-06-25 22:08:43 |
| words.txt Path: Wisconsin Milwaukee >> LIB >> 5391 Fall, 2009 Description: 125 32205:63416:1225:395 1964 29907:52249:3064:811 55268:57338:3039:831 2nd 26714:42746:1328:415 3rd 51666:41122:1174:415 a 51156:52942:664:554 44592:60525:664:534 accomplishments 17775:50507:11722:574 active 25871:54526:4699:0 21862:54467:3882:574 a... Date Added: 2009-06-25 22:11:28 |
| YDL061C.t06.n_sep-logo.pdf Path: UCSC >> YDL >> 061 Fall, 2009 Description: YDL061C.t06 n_sep 3 2 1 1 10 20 30 40 D 3 2 1 A DAD A D H D ADADAD 51 GFHKYR 50 MAHENVWFSHPRRFGKGSRQCRVCSSHTGLVRKYDLNICRQCFREKANDI ... Date Added: 2009-06-25 22:13:03 |
| L11.ppt Path: UMBC >> PUB >> 104 Fall, 2009 Description: The while Looping Structure Topics The while Loop Program Versatility Sentinel Values and Priming Reads Checking User Input Using a while Loop o Reading Section 5A.1-5A.3 , 5A.6 L11 Review: Repetition Structure A repetition structure allows ... Date Added: 2009-06-25 22:14:48 |
| l08_AlternatingTreesFreundMason.pdf Path: Neumont >> IFT >> 3390 Fall, 2009 Description: ... Date Added: 2009-06-25 22:16:12 |
| assign4.pdf Path: Utah >> MATH >> 1170 Fall, 2008 Description: MATH 1170 MATHEMATICS FOR LIFE SCIENTISTS Computer Assignment IV Due September 28, 2004 tion, you can cobweb with The iread(iter); command iterplot and iterplot2. If you > cobweb(f,20,.02,0.1); loads a cobweb command into Maple, in addition to have ... Date Added: 2009-06-25 22:16:21 |
| refcard-gdb.pdf Path: Colorado >> CS >> 1300 Fall, 2008 Description: t wuxv tyq v Fit uv wg RFt ye S RH je ut g Xf a s s s U u u x i c t wuxv tyq v Fi uv wg RH xy r R o r yuv Aig v v uS fS jjiy q vr4s r eit xy 7h Sp k4iurg e nt F xyg R xy o4fuv HT yuvuv eit eit p x Sfp eit pynt j oxq qnxyg t umug g xy... Date Added: 2009-06-25 22:16:38 |
| ME265HW3 optimizationS09.doc Path: San Jose State >> ME >> 265 Fall, 2008 Description: San Jose State University Mechanical & Aerospace Engineering department ME265 Homework 3 Optimization (Due Wed. April 22) Spring 2009 1 You are asked to design a rectangular cross sectional beam subjected to a maximum bending moment of M = 40,000 N... Date Added: 2009-06-25 22:17:37 |
| final.pdf Path: BYU >> MATH >> 672 Winter, 2008 Description: Math 672 Final Exam Do all of the following problems. The exam is due on Friday, April 20 at 3:00 PM. You may spend unlimited time preparing for the exam, but there is a limit of three hours that you may spend writing the exam after the last day of c... Date Added: 2009-06-25 22:18:08 |
| YKL148C.t2k.dssp-ehl2-logo.pdf Path: UCSC >> YKL >> 148 Fall, 2009 Description: YKL148C.t2k DSSP-EHL2 2 1 CC 1 C C C E E X X X X X X X X X X X X C CCCCCC C C C C X C X X X X X X C C H C X X H C X C C C C X X X X X C C C X X X C C C C H C H C C C H C C C C H H H H H H H H X X X X X X X X X X X X X X X X X X X X ... Date Added: 2009-06-25 22:20:27 |
| YKL127W.t2k.str2-logo.pdf Path: UCSC >> YKL >> 127 Fall, 2009 Description: YKL127W.t2k STR2 5 4 3 2 1 CC H TS CZCQQYSSSCCTCZYCCSC CS S Q E T GCSSBS Z S S T XXXYXXXXXXXXSGXXXXXXTXXXX X X Q Y H Z Z S H S S E Z Z T Y T G H H X X CZCC YZCCCC 10 TS CC Q T Z S C H T H T H H H H H H H H S H S H T C C C S TTTC CSH S C ... Date Added: 2009-06-25 22:20:38 |
| YKL175W.t2k.dssp-ehl2-logo.pdf Path: UCSC >> YKL >> 175 Fall, 2009 Description: YKL175W.t2k DSSP-EHL2 2 1 CCC H H X X X X X X HH H CCCCCCCCCCCCCC C C C C C C C H C H H C C C H H H C C C C C C C C X X X X X X X X X X X X X X X X X 1 10 20 30 40 T H 2 1 HHHHHHHHHHHH HHHH C C C C C C X X X X X X X X X X X X HCCCCCCH HC... Date Added: 2009-06-25 22:21:05 |
| tp3.pdf Path: Neumont >> A >> 6266 Fall, 2009 Description: Departement dinformatique et de recherche op rationnelle e Automne 2008 IFT 6266: Algorithmes dapprentissage Yoshua Bengio et James Bergstra, pift6266@iro.umontreal.ca Devoir #3, Donn le 6 octobre 2008, D le 20 octobre 2008 e u 1. (4 points) Vous ... Date Added: 2009-06-25 22:23:34 |
| CST556_T10.pdf Path: East Los Angeles College >> CST >> 556 Fall, 2009 Description: CST556: Cryptography Lab Session 10 Assignment 2 This session is dedicated to support for the assignment. We may also practice exam questions. ... Date Added: 2009-06-25 22:26:54 |
| exam_soln_01_2009.pdf Path: Carnegie Mellon >> PHYSICS >> 33228 Fall, 2009 Description: ... Date Added: 2009-06-25 22:29:18 |
| s3lect08.ppt Path: Missouri State >> A >> 114 Fall, 2009 Description: \"Ah, but a man\'s reach should exceed his grasp, or what\'s a heaven for?\" Robert Browning New homework posted Wednesday Friday will be a group workday. Group Project Grading Criteria Science Objective(s) Already been done? Impossible or too futur... Date Added: 2009-06-25 22:30:20 |
| s3lect01.ppt Path: Missouri State >> A >> 114 Fall, 2009 Description: If I had my life to live over, I would start barefoot in the spring earlier and stay that way later in the fall. I would go to more dances. I would ride more merry-go-rounds. I would pick more daisies. Nadine Stair Test 2 short answer grading 10 = p... Date Added: 2009-06-25 22:30:21 |
| Phys250_00_11_LSSGrowth.pdf Path: Berkeley >> PHYSICS >> 250 Fall, 2008 Description: The Dark Side B.Sadoulet Pattern and Growth of Cosmic Structure Cosmic Microwave Background Expansion versus time Pattern and growth of cosmic structure Laboratory searches DARK ENERGY ORDINARY MATTER Big Bang formation of light nuclei DARK MATTE... Date Added: 2009-06-25 22:34:06 |
| sampling.pdf Path: NMT >> GEOP >> 505 Fall, 2009 Description: Spring, 2001 Data Processing and Analysis (GEOP 505) Rick Aster February 27, 2001 Sampled Time Series Most geophysical and other scientic data consists of numerical series or matrices, i.e., sets of spatially or temporally ordered numbers that appro... Date Added: 2009-06-25 22:42:17 |
| hwk6.pdf Path: Missouri S&T >> EE >> 213 Fall, 2009 Description: d i i j i i i f { qf j d wuv Xsk{vn0y`fd 6`p~yhk{s yl{`tynkesrqvnu{lxwrunyw{kgvit{ kjd uv`f dvvn q ylvnk{`kfvnxdvf8`fkgiPwunwpy d i i hf j f i n d k{suk`wpynkjiu0w{ukkirywlfunCPwdi vuxd 6wp~yhk{svyl{`ty i ifh ... Date Added: 2009-06-25 22:43:57 |
| L13 NVA with capacitors.pdf Path: Berkeley >> EECS >> 100 Fall, 2002 Description: C:\\Users\\Bernhard Boser\\Documents \\Files\\Class\\100\\Lectures\\L13 NVA 10/16/2007 Page 1 of 5 Reference:W:\\Lib\\MathCAD\\Default\\defaults.mcd EE100 Lecture 13: RLC Circuits in the Time Domain Announcement: Complex numbers, quiz 5 1. Analysis of genera... Date Added: 2009-06-25 22:48:49 |
| fortran90_io_fields.pdf Path: Wisconsin >> ENGR >> 476 Fall, 2009 Description: EP/EMA/NEEP 476, Spring 2006 Fortran 90 Field Specifications for I/O Field an Definitions character of field-size n Example* WRITE(*,(a8) eight eight en.d exponential of field-size n with d decimal places scientific exponential of field-size n w... Date Added: 2009-06-25 22:53:53 |
| units.txt Path: Allan Hancock College >> CSE >> 4213 Fall, 2009 Description: UNITS = {BUS1010, BUS1100, BUS1110, BUS2011, BUS2120, BUS2176, BUS2710, BUS3000, BUS3010, BUS3020, BUS3112, BUS3150, BUS3502, BUS3530, BUS3600, BUS3720, BUS3960, BUS4011, BUS4420, BUS5021, BUS5030, BUS5112, BUS5150, BUS5410, BUS5500, BUS5502, BUS5510... Date Added: 2009-06-25 23:00:27 |
| 011107-thurs.doc Path: CSU Northridge >> MG >> 640721 Fall, 2009 Description: Daily Log Report Lab tech: Minerva Garcia Assigned hours: 12 p.m. - 8 p.m. Actual hours: 0 a.m. 0 p.m. Explain differences between hours: N/A Change in Shift Detail: N/A Paper Count: Computer lab: SSU Day: Friday Date: 01/12/07 Time 8:00am: 9:00am... Date Added: 2009-06-25 23:00:52 |
| p3.pdf Path: New Mexico >> EECE >> 314 Fall, 2009 Description: ... Date Added: 2009-06-25 23:03:22 |
| HW4key.pdf Path: Columbia >> C >> 3443 Fall, 2009 Description: ... Date Added: 2009-06-25 23:04:24 |
| hw1.ps Path: Bryn Mawr >> CS >> 355 Fall, 2009 Description: %!PS-Adobe-2.0 %Creator: dvips(k) 5.95a Copyright 2005 Radical Eye Software %Title: hw1.dvi %Pages: 3 %PageOrder: Ascend %BoundingBox: 0 0 595 842 %DocumentFonts: CMR12 CMR10 CMBX10 CMSY10 CMTT10 %DocumentPaperSizes: a4 %EndComments %DVIPSWebPage: (w... Date Added: 2009-06-25 23:10:04 |
| valverde[1].PP..pdf Path: SUNY Albany >> GV >> 382 Fall, 2009 Description: La poltica en evaluacin y currculo ante el desafo de la calidad Lecciones de Pases Bajos y los Estados Unidos Gilbert A. Valverde, Ph.D. University at Albany State University of New York valverde@uamail.albany.edu El El desafo Lograr que todos los... Date Added: 2009-06-25 23:10:41 |
| exam02 Path: University of Toronto >> MATH >> MAT 400 Fall, 2008 Description: Computer Science 341 Discrete Mathematics Final Exam Guidelines: No collaboration is permitted on the nal. You may refer to your own notes, textbooks (including those other than the two course texts), and all materials posted on the course web site. ... Date Added: 2009-06-25 23:13:07 |
| poster_model.ppt Path: Penn State >> HUL >> 135 Fall, 2009 Description: TheoryintoPractice:WhenIDTheoriesmeetBlueprints TheoryintoPractice:WhenIDTheoriesmeetBlueprints KyuYonLim,HyeonWooLee INSYS525/527 ElaborationTheory Topic:ProjectPlanninginISDProjectusingGanttChart ClassificationofObjective:ProceduralKnowledge Instru... Date Added: 2009-06-25 23:14:30 |
| Phys1000-StatsLab-Heights.xls Path: Laurentian >> PHYS >> 10007 Fall, 2009 Description: Physics 1000 Fall 2006 Student Heights 1 183 187 154 168 160 172 168 168 159 167 186 186 170 178 166 184 176 2 181 183 183 175 170 170 168 161 177 174 168 172 131 158 176 183 180 177 3 169 187 172 171 180 184 170 164 170 175 170 175 165 179 185 155 1... Date Added: 2009-06-25 23:18:33 |
| chapter03.ppt Path: Southern New Orleans >> CS >> 4101 Fall, 2009 Description: IntroductiontoAlgorithms (2ndedition) byCormen,Leiserson,Rivest&Stein Chapter3:GrowthofFunctions (slidesenhancedbyN.AdlaiA.DePano) Overview Orderofgrowthoffunctionsprovidesasimple characterizationofefficiency Allowsforcomparisonofrelativep... Date Added: 2009-06-25 23:22:54 |
| Results.doc Path: UNL >> PSYC >> 4512009 Fall, 2009 Description: Homework Results Use the criterion variable of Body Image Perception (beltself) Use the discriminating variables of ethnic background (ethnic), school type (sctyp), Moms education (momed), Dads education (daded), height (height), and body weight (... Date Added: 2009-06-25 23:23:03 |
| project_2.txt Path: Georgia Tech >> CS >> 4451 Fall, 2008 Description: / / /* You need to fill in the information about yourself */ / / / / KEEP THE FOLLOWING LINE: / Assignment # 2: Ver. 1.0 #include <glut.h> #include <GL/gl.h> #include <GL/glu.h> #include <math.h> #include <stdlib.h> #include <vector> #include ... Date Added: 2009-06-25 23:33:21 |
| digestion b.pdf Path: Western Michigan >> BIOS >> 3500 Fall, 2008 Description: Digestion Tour Continued! Human Physiology: BIOS 3500 Next stop: The small intestines 1 Pancreatic exocrine cells Secrete enzymes from the acinar cells: Proteolytic enzymes Pancreatic amylase Pancreatic lipase Secrete sodium bicarbonate Pancreat... Date Added: 2009-06-25 23:36:04 |
| Email_RelatedDocs.txt Path: USC >> CS >> 577 Fall, 2009 Description: To: Scott Henninger <scotth@cse.unl.edu> Subject: BORE 5.1.1 - Related Documents not linked properly Scott, In previous BORE versions (4.10.48, 5.0.2) and the current version (5.1.1), we have been unable to download the related documents we uplo... Date Added: 2009-06-25 23:42:37 |
| Bfields.pdf Path: ASU >> PUBLIC >> 101 Fall, 2009 Description: EXPERIMENT 10: MAGNETIC FIELDS Introduction: In this lab, you will use compasses and iron lings to investigate the magnetic eld of a bar magnet and the magnetic eld of a long straight current. The magnetic eld is our way of describing the condition o... Date Added: 2009-06-25 23:44:38 |
| 2001final.pdf Path: Colorado State >> ECE >> 102 Fall, 2008 Description: ... Date Added: 2009-06-25 23:48:55 |
| morph_w-title.pdf Path: San Diego State >> ART >> 448 Spring, 2008 Description: Ky cs eo l fa ... Date Added: 2009-06-25 23:49:49 |
| Titles.docx Path: San Diego State >> ART >> 448 Spring, 2008 Description: Gameboy DS Von Zipper Shades Game Frames Gaming Glasses Video Lenses A New Shade of Gaming See Games Under a Whole New Light Real D Gaming Frames Dual Screen Light/UV Light Gaming Glassic Gaming Frame Rate Game ... Date Added: 2009-06-25 23:50:04 |
| q7tr.pdf Path: UMBC >> IS >> 450 Fall, 2008 Description: IS450/650TR Martens Yourname: Quiz7 5/12/09 ConsiderTCP\'sthreewayhandshake. 1.Whatistheprimarypurposeofthefirstmessageabove? FortheclienttorequestaTCPconnectionwiththeserver. 2.Whatistheprimarypurposeofthesecondmessageabove? Fortheservertotellth... Date Added: 2009-06-25 23:51:50 |
| teb-sa-paper1.pdf Path: Penn State >> HSA >> 109 Fall, 2009 Description: A MANUAL FOR THE ASSESSMENT OF HISTORIC LOAD-BEARING MASONRY STRUCTURES Thomas E. Boothby 1 and H. Sezer Atamturktur 2 Abstract The assessment of unreinforced masonry structures, especially in arched or vaulted forms, is difficult to undertake in pr... Date Added: 2009-06-25 23:56:44 |
| exer.pdf Path: Allan Hancock College >> STAT >> 100 Fall, 2009 Description: 6.1 Tutorial exercises Exercise 6.1 A sample of 64 students commuting distance is taken and X = 35km, s = 5km. What is the 95% CI for the true mean commuting distance? Exercise 6.2 Two instructors oer extra help designed to improve students scores... Date Added: 2009-06-26 00:01:32 |
| PracTest1.pdf Path: N.C. State >> MA >> 225 Spring, 2008 Description: Practice Test 1 MA225 Directions: On the test no aid (books, notes, calculators or any other kind) will be allowed. You will have 75 minutes. Make sure that you read the questions carefully, you write understandably in full sentences, and that you sh... Date Added: 2009-06-26 00:03:00 |
| hmwk4.pdf Path: Wisconsin >> ECE >> 353 Fall, 2008 Description: HOMEWORK ASSIGNMENT #4 Due Monday, March 28th, 2005 1. (10 points) System Organization Do Problem 2 from page 322, Chapter 10 of the text. 2. (10 points) System Bus Do Problems 3 and 4 on page 322, Chapter 10 of the text. 3. (10 points) Bus Cycles Do... Date Added: 2009-06-26 00:07:51 |
| p6sp09b.pdf Path: Cornell >> CS >> 1112 Fall, 2009 Description: CS1112 Spring Project 6 (Part II) due Thursday 4/30 at 11pm You must work either on your own or with one partner. You may discuss background issues and general solution strategies with others, but the project you submit must be the work of just you... Date Added: 2009-06-26 00:13:48 |
| sc_task list1.pdf Path: University of Illinois, Urbana Champaign >> AE >> 441 Fall, 2008 Description: AE 441 Spring 2009 Aerospace Vehicle Design Aircraft Design Section Light Sport Aircraft (LSA) Task List #1 Stability and Control 1. What particular RFP requirements are critical to your technical area? 2. Read Section 6.5 in Raymer (4th ed) on geom... Date Added: 2009-06-26 00:14:31 |
| aero_task list3.pdf Path: University of Illinois, Urbana Champaign >> AE >> 441 Fall, 2008 Description: AE 441 Aerospace Vehicle Design Aircraft Design Section Light Sport Aircraft (LSA) Spring 2009 Aerodynamics Task List #3 1. List some aerodynamics/system trade studies being considered for your design. Include two detailed trade studies in your PDR a... Date Added: 2009-06-26 00:14:31 |
| 1206_review_test2_solns.pdf Path: Virginia Tech >> MATH >> 1206 Fall, 2008 Description: ... Date Added: 2009-06-26 00:14:46 |
| lec26h.pdf Path: Berkeley >> EECS >> 12202 Fall, 2009 Description: Fall & Walrand Lecture 26 Another Look at Sharing EECS 122, Lecture 26 Kevin Fall kfall@cs.berkeley.edu Jean Walrand wlr@eecs.berkeley.edu Computer network are shared resources, leading to contention under high load By specific allocation of resour... Date Added: 2009-06-26 00:16:17 |
| ppjacob.pdf Path: University of Toronto >> STA >> 257 Fall, 2009 Description: g h { (R1P y ha x i| # h }| #tr | og w r r o i | r w w x i 1nR@mtSytqyx #u t1q#Rvvt#1vRqtyw`wtv@1#Tn1k s r o k k r xs k rg i r o h | og w r p x w |g s rg r o | s o i i x r x r o i ox } o w } | yqf1y9ytr P #1n1q#yw vy11tf#yRqftfvng... Date Added: 2009-06-26 00:22:24 |
| 106 problems fall 2007.pdf Path: BYU >> PHYSICS >> 106 Fall, 2009 Description: Physics 106 Homework Problems, Fall 2007 Sec. 1, Cheryl Davis These problems are adapted from Serway and Faughn, College Physics, and are used with permission from Harcourt Brace College Publishers. 1-1. A 4.51-nC charge is located [01] m from a 2.86... Date Added: 2009-06-26 00:22:32 |
| ass2.pdf Path: University of Toronto >> STA >> 2102 Fall, 2009 Description: h e GhHu H xR b` q hh Gd u G ` q P hRhHR u G ` b` R G R G ` H xR x q eP q RPR qH VRI%Ypapvti`pqghI\'IcitcV%VpIicv\'piaIppRIcg`vcg`pSwfgq R q H Rh h q ` d x H R R P u `b q P H R q H G d ` e P G h h P u ` u u G ` b ` h Rh e q... Date Added: 2009-06-26 00:22:45 |
| 3table.pdf Path: Michigan State University >> LIB >> 1987 Fall, 2009 Description: ... Date Added: 2009-06-26 00:22:55 |
| mar9.pdf Path: University of Toronto >> STA >> 450 Fall, 2009 Description: Notes No class this Friday or next Friday No ofce hours next Thursday or Friday HW 3 coming on Mar 16, due last day of classes project due 1 week after last day of classes STA 450/4000 S: March 9 2005: , 1 Tree-based methods (9.2) 9... Date Added: 2009-06-26 00:24:15 |
| mar30.pdf Path: University of Toronto >> STA >> 450 Fall, 2009 Description: Project Project due (before) Wednesday, April 13 (5 pm) Two to three pages of write-up: introduction to data questions of interest methods and models used tables and figures conclusions code as Appendix STA 450/4000 S: March 30 2005: , 1 Unsuperv... Date Added: 2009-06-26 00:24:15 |
| hw1.pdf Path: University of Toronto >> STA >> 410 Fall, 2009 Description: STA 410S/2102S: Homework #1 Due February 4, 2005 Note: The answers to each question should be written or typed as a report to a nonstatistician. The numerical results should be summarized in tables, and the text should provide the interpretation. Al... Date Added: 2009-06-26 00:24:23 |
| coefficients.pdf Path: Tennessee >> PSC >> 512 Fall, 2009 Description: A B C D E F G 1 Calcuating the Regression Equation: (Yi) (Xi) 2 % with 16+ years Per Capita of 2 Income education (Yi-Ybar) (Xi-Xbar) (Yi-Ybar)(Xi-Xbar) (Xi-Xbar) 3 State 4 AL 8681 12.2 -1736.8 -4.1 7147.98 16.94 5 AK 13650 21.1 3232.2 4.8 15464.03 2... Date Added: 2009-06-26 00:28:08 |
| Defs.pdf Path: Concordia Chicago >> P >> 223 Fall, 2009 Description: Definitions 1 Hilbert Spaces Recall that a complex vector space is a set H, together with a mapping add mult H H H (called addition, and written x+y) and a mapping CH H (called scalar multiplication, and written c x), satisfying the nine or so sta... Date Added: 2009-06-26 00:31:58 |
| TM 8 ARTICLE - The Living Company.doc Path: Laurentian >> MGT >> 200703 Fall, 2009 Description: The Living Company by Arie De Geus Harvard Business Review (March 1997) In the world of institutions, commercial corporations are newcomers. They have been around for only 500 years a mere blip in the course of human civilization. In that time, as p... Date Added: 2009-06-26 00:34:09 |
| homework1sol.pdf Path: Colorado >> ATOC >> 5560 Fall, 2008 Description: ATOC/ASTR 5560 Homework 1 Solutions Due: September 17, 2001 1. Assume the Sun radiates as a blackbody at 5783 K and is a uniform sphere with radius 6.96 105 km. Calculate the broadband radiance and irradiance of sunlight at the orbits of Venus and ... Date Added: 2009-06-26 00:38:55 |
| propLogic.pdf Path: Texas >> CS >> 336 Fall, 2009 Description: ... Date Added: 2009-06-26 01:15:15 |
| Lect_07.pdf Path: Rochester >> WEB >> 203 Fall, 2009 Description: Astronomy 203/403, Fall 1999 7 7.1 Lecture, 23 September 1999 On-axis aberrations of conic section mirrors: spherical aberration To illustrate why the spot diagrams we generated above have the size and shape they do, we will consider a couple of s... Date Added: 2009-06-26 01:34:01 |
| overflow2.pdf Path: Washington >> CS >> 451 Fall, 2009 Description: Lecture 3: Buffer overflow and race condition exploits Lecture topics l l Buffer overflow exploits Data race exploits CS 916, Application Security Gleb Naumovich First of all, whats a buffer? l Buffer is a continuous block of memory that holds... Date Added: 2009-06-26 01:49:05 |
| hw1_soln.pdf Path: UCSD >> WEBER >> 116 Fall, 2009 Description: Econ 116 Homework 1 - Suggested answers Problem 1 (10 points) The data in Table 2 show that services are more labor intensive than commodities, which is necessary to Bhagwati\'s argument because he states that services are cheap relative to commoditie... Date Added: 2009-06-26 01:50:26 |
| hw1_soln.pdf Path: UCSD >> DOCS >> 116 Fall, 2009 Description: Econ 116 Homework 1 - Suggested answers Problem 1 (10 points) The data in Table 2 show that services are more labor intensive than commodities, which is necessary to Bhagwati\'s argument because he states that services are cheap relative to commoditie... Date Added: 2009-06-26 01:50:26 |
| L1.pdf Path: Duke >> CPS >> 237 Spring, 2009 Description: U c y a a 6fpf U fC e f a ii c c U XU U W c ~6`ypf (W Y fdc pf c U f fU XU i e dW `CU fT U i` U bXU UY a e Y Y W c Y % \' (e \' w%{Y y d p %0 c U e c Y ... Date Added: 2009-06-26 02:41:21 |
| spring99solutions.pdf Path: University of Toronto >> CSC >> 209 Fall, 2009 Description: CSC209S Midterm (L0101) Spring 1999 University of Toronto Department of Computer Science Date: Time: Duration: February 26, 1999 12:10 pm 50 minutes Notes: 1. This is a closed book test, no aids are allowed. 2. Print your name, student number, and c... Date Added: 2009-06-26 02:43:35 |
| Lec16Notes2.pdf Path: University of Toronto >> CSC >> 2427 Fall, 2009 Description: CSC 2427: Algorithms for Molecular Biology Spring 2006 Lecture 16 March 10 Lecturer: Michael Brudno Scribe: Jim Huang 16.1 Overview of proteins Proteins are long chains of amino acids (AA) which are produced through the operation of translating... Date Added: 2009-06-26 02:44:42 |
| HW5-key.pdf Path: Lake County >> ASTR >> 100 Fall, 2009 Description: Homework #5 - Astr100 Spring 2009 1. d 2. d 3. b 4. d 5. a 6. a 7. a 8. c 9. d 10. a ... Date Added: 2009-06-26 02:45:12 |
| 16-Testing1.pdf Path: University of Toronto >> CSC >> 302 Fall, 2009 Description: University of Toronto Department of Computer Science Lecture 15: Introduction to Testing Defects vs. Failures Effectiveness of defect detection strategies Basics of Testing Testing and integration Types of test coverage 2008 Steve Easterbrook. Th... Date Added: 2009-06-26 02:46:04 |
| lecture04.pdf Path: Lake County >> ASTR >> 596 Fall, 2009 Description: Rotatingflows Considerfluidinacoordinatesystemrotatingwithangularvelocity. SecondNavierStokesequationbecomes(uinrotatingframe) u 1 2 u u= Pr 2u u t Canwritecentrifugaltermas 1 2 2 r = r \' 2 1 P P 2 r \' 2 2 centrifugal Coriolis z Forincom... Date Added: 2009-06-26 02:47:37 |
| lecture22.pdf Path: Lake County >> ASTR >> 596 Fall, 2009 Description: Particleparticle(PP)ordirectNbody SimplestpossibleNbodytechnique. 1.Foreachparticlei,compute ai=G m j j=1 ji N xi x j xi x j 3 2.Foreachparticle,integrate 3.Repeat. d xi , vi dt = vi , ai fromtntotn+t. Advantages: Forcelawisexact,soforap... Date Added: 2009-06-26 02:47:39 |
| campbell07.pdf Path: University of Toronto >> CSC >> 2518 Fall, 2009 Description: Speaker Recognition: A Tutorial JOSEPH P. CAMPBELL, JR., SENIOR MEMBER, IEEE Invited Paper A tutorial on the design and development of automatic speakerrecognition systems is presented. Automatic speaker recognition is the use of a machine to recogn... Date Added: 2009-06-26 02:47:41 |
| Colin Roby and Jaewook Kim - WindowsThread-FINAL.ppt Path: UMBC >> PUB >> 621 Fall, 2009 Description: [CMSC 621] Advanced Operating Systems Windows Threading Colin Roby Jaewook Kim OS, Process, and Thread for Windows OS Applications Programming paradigms Threads Interface Microkernel MultiProcessor Computing System P P P P P Operating System .... Date Added: 2009-06-26 03:21:05 |
| chaos.xls Path: Texas >> MATH >> 375 Fall, 2009 Description: 5 11.88 26.16 48.29 62.43 58.64 60.63 59.67 60.16 59.92 60.04 59.98 60.01 59.99 60 60 60 60 60 60 60 60 60 60 60 60 60 60 60 60 60.2 60.15 60.1 60.05 60 59.95 59.9 59.85 59.8 59.75 Column A 0 5 10 15 20 25 5 14.2 35.95 67.92 64.27 67.74 64.47... Date Added: 2009-06-26 03:33:54 |
| lect01.pdf Path: Maryland >> CMSC >> 412 Fall, 2001 Description: Operating Systems Review Syllabus read the warning about the size of the project make sure you get the 6th edition (or later) of the book Class Grades Server Grades.cs.umd.edu Program #0 Handout its due in just over one week purpose is to get ... Date Added: 2009-06-26 03:41:15 |
| Sect13_problem5.pdf Path: University of Toronto >> ACT >> 247 Fall, 2009 Description: Example: The APV of a discrete whole life insurance of 1 issued to (x) is .8. Annual eective interest is at rate 6%. The insurer notices that the mortality probabilities used at ages x and x+1 were qx = 0.2 and qx+1 = 0.1 , but they should have been ... Date Added: 2009-06-26 03:58:01 |
| SLM_4_5.pdf Path: Allan Hancock College >> CS >> 3000 Fall, 2009 Description: SERVICE LEVEL MANAGEMENT: 4.5 The On-going process file:/E|/cd/content/sd/sd04_05.htm 4.5.1 Monitoring and Reporting 4.5.2 Service review meetings 4.5.3 Service Improvement Programme 4.5.4 Maintenance of SLAs, contracts and OLAs The following ongo... Date Added: 2009-06-26 04:20:07 |
| l27.pdf Path: Midwestern State University >> CSE >> 5311 Fall, 2009 Description: t u v Pyx}9`t5dfDUD3oa2 z 1SSiEWSD`y y p 7 v 7 G4 G 2R 62 C j 6 (QGW C 2Q2 VGUS3QUB DE6XH9HqUnD6 z ccYYdE6D32EAHc1#m C TR CR 4 e ( WG T m C 2 G (G WG 62 @ CWW4 pQ4 C A 0 CWW ( 2 C R2 R 2 C T 2Q 0 T y p 7 v 7 C C WQ2 A @2 C C @Q2G2 DHG z... Date Added: 2009-06-26 04:38:52 |
| l09.ps Path: Duke >> X >> 100 Fall, 2009 Description: %!PS-Adobe-3.0 %Title: (Microsoft PowerPoint - l09.ppt) %Version: 1 1 %Creator: (PScript5.dll Version 5.2) %CreationDate: (D:20050201143700) %For: (Administrator) %DocumentData: Clean7Bit %BoundingBox: 0 0 792 612 %Pages: 12 %DocumentProcessColors: (... Date Added: 2009-06-26 04:45:15 |
| lec22b&w-01.pdf Path: Bergen CC >> EE >> 100 Fall, 2009 Description: Silicon Crystal Structure Periodic Table Boltzmann Equation ne0 = Electron Density (No Potentials) nh0 = Hole Density (No Potentials) e = |Electron Charge| = +1.6 1019 C (x) = Local Potential ne (x) = ne0 exp(e(x)/kT ) nh (x) = nh0 exp(e(x)/kT ) ... Date Added: 2009-06-26 05:44:55 |
| 445 outline Path: Waterloo >> ACTSC >> 445 Spring, 2009 Description: ACTSC 445/845: Asset-Liability Management Spring 2009 Instructor: Class Times: Tutorial: Office Hours: Pre-requisites: Course webpage: Syllabus 1. Fixed-income securities, duration, convexity, immunization strategies 2. Interest rate models, pricing... Date Added: 2009-06-27 12:36:52 |
| 24 Path: Texas >> PHY >> 303L Fall, 2008 Description: Kapoor (mk9499) homework24 Turner (60230) This print-out should have 12 questions. Multiple-choice questions may continue on the next column or page find all choices before answering. 001 10.0 points A toroid having a rectangular cross section (a... Date Added: 2009-06-28 22:18:12 |
| 3000-HW1-Sample Soln 1 Path: Georgia Tech >> CEE >> 3000 Spring, 2009 Description: ... Date Added: 2009-06-29 18:55:49 |
| 105PS3 Path: Berkeley >> PHYSICS >> 105 Spring, 2009 Description: UNIVERSITY OF CALIFORNIA AT BERKELEY DEPARTMENT OF PHYSICS PHYSICS 105 SPRING SEMESTER 2009 LEROY T. KERTH Problem Set 3 Note: this problem set is due Tuesday as Monday is a holiday. All problems from Taylor 1. 3.19 page 101 2. 320 page 102 3. 3.21 p... Date Added: 2009-07-01 04:40:20 |
| Preparation_for_the_Quiz Path: Pittsburgh >> HIST >> 1614 Spring, 2009 Description: Preparation for the Quiz: History 1614 The quiz is on Unit One. There will be 10 objective questions taken from information in the Unit One outline (five multiple choice questions, and five true or false questions). Each is worth 1 point for a total ... Date Added: 2009-07-02 19:56:53 |
| Bio1AL_Sum09_lab2_wksht Path: Berkeley >> BIO 1A >> 1AL Summer, 2009 Description: Cell and Ligation Worksheet. Due at the end of your lab. Name GSI & Sect # Station # 1) On the left include a drawing of one of the gram stained bacteria (indicate the color, if it is Gram + or -, and the morphology). One ruler division equals one m... Date Added: 2009-07-04 02:34:38 |
| Chap12 Path: 東京大学 >> BUS >> BAM303 Summer, 2009 Description: Chapter 12 Labor Markets and Labor Unions 2006 Thomson/South-Western 1 Three Uses of Time Individuals can use their time in three ways Undertake market work selling time in the labor market in return for income Undertake nonmarket work using t... Date Added: 2009-07-06 21:09:28 |
| lecture9 Path: 東京大学 >> BUS >> BAM314 Spring, 2009 Description: Capital Budgeting Objectives Study the purpose and importance of capital budgeting Study different capital budgeting criteria for evaluating investment proposals Study methods of project selection under capital rationing 07/07/09 Richard ... Date Added: 2009-07-06 22:51:43 |
| Soln11188 Path: LSU >> CE >> 2460 Spring, 2009 Description: COSMOS: Complete Online Solutions Manual Organization System Chapter 11, Solution 188. (a) Construction of the curves. Construct the at curve. 0 < t < 10 s: 10 s < t < 26 s: 26 s < t < 41 s: 41 s < t < 46 s: 46 s < t < 50 s: a = slope of v t cur... Date Added: 2009-07-07 11:56:47 |
| Soln12010 Path: LSU >> CE >> 2460 Spring, 2009 Description: COSMOS: Complete Online Solutions Manual Organization System Chapter 12, Solution 10. Kinematics: Uniformly accelerated motion. ( x0 = 0, v0 = 0 ) x = x0 + v0t + 1 2 at , 2 or a= 2 x ( 2 )(10 ) = = 1.25 m/s 2 2 2 t ( 4) Fy = 0: N - P sin 50 - mg c... Date Added: 2009-07-07 12:00:42 |
| Table vs CSS.doc Path: San Diego State >> DESIGN >> 344 Fall, 2009 Description: Dylan Drake Project 1: Web Page Deconstruction 9.14.08 Outline Introduction: Origin of TableBased Design Origin of CSS Design Benefits of TableBased Design: better for large amounts of complex information if 30% use browsers that do not support C... Date Added: 2009-07-08 01:32:47 |
| hw7 Path: UCSB >> ME >> 210C Spring, 2009 Description: Due: Thursday, May 28 th Finite Difference Methods for Partial Differential Equations: Professor: Paul J. Atzberger All homeworks are to be turned in at the beginning of class. Do the following problems from Finite Difference Schemes for Part... Date Added: 2009-07-08 17:35:28 |
| ps8 Path: MIT >> CSE >> 6.046J/18. Fall, 2001 Description: Introduction to Algorithms Massachusetts Institute of Technology Singapore-MIT Alliance Professors Erik Demaine, Lee Wee Sun, and Charles E. Leiserson Day 26 6.046J/18.410J SMA5503 Handout 27 Problem Set 8 MIT students: This problem set is due in l... Date Added: 2009-07-09 10:37:26 |
| 3_RedesDeColas Path: Peru State >> FIECS >> EC314 Spring, 2009 Description: Redes de colas Redes de colas Una red de colas es un sistema donde existen varias colas y los trabajos van fluyendo de una cola a otra Ejemplos: Fabricacin (trabajos=artculos) Oficinas (trabajos=documentos) Redes de comunicaciones (trabajos=paquete... Date Added: 2009-07-09 18:34:50 |
| hw 25 Path: Texas >> PHY 302K >> 92160 Spring, 2009 Description: Patel (pnp223) homework 25 Turner (92160) This print-out should have 10 questions. Multiple-choice questions may continue on the next column or page find all choices before answering. 001 10.0 points Calculate the average speed of the Moon around... Date Added: 2009-07-11 01:43:30 |
| CEE100-Spring04-mt1-Troy-soln Path: Berkeley >> CEE >> cee Fall, 2005 Description: ... Date Added: 2009-07-11 21:01:34 |
| chapter14_part1 Path: Stony Brook University >> CHE >> 131 Fall, 2008 Description: Chapter 14: Chemical Equilibrium 633 End-of-Chapter Solutions for Chapter 14 Summary Problem 1. Answer: see equations below (other answers are possible) Strategy and Explanation: The production of H2 needs to be accomplished with a minimum producti... Date Added: 2009-07-15 23:03:13 |
| Runnable (Java 2 Platform SE v1.4.2) Path: Carleton CA >> SYSC >> 3303 Spring, 2009 Description: Runnable (Java 2 Platform SE v1.4.2) http:/java.sun.com/j2se/1.4.2/docs/api/ Java 2 Platform Std. Ed. v1.4.2 All Classes TM TM Overview Package Class Use Tree Deprecated Index Help Java 2 Platform Std. Ed. v1.4.2 PREV CLASS NEXT CLASS FRAMES NO F... Date Added: 2009-07-16 03:26:55 |
| Test1Solns Path: Carleton CA >> MATH >> 3705 Winter, 2008 Description: MATH 3705-B TEST 1 SOLUTIONS* January 2007 *Note: This version of solutions was edited by Andrey Zakurdaev and differs slightly from the original written by Dr. Elena Devdariani. It contains detailed solutions to MC questions and displays the al... Date Added: 2009-07-16 03:43:33 |
| Homework9Solution[1] Path: BU >> MA >> 214 Spring, 2008 Description: Homework 9 Solution Chpt 8, P404: (SAS)1, 2, 3 1. The FREQ Procedure Table of therapy by complic therapy complic Frequency| Percent | Row Pct | Col Pct |Yes |z_No | Total -+-+-+ 1 | 89 | 911 | 1000 | 4.45 | 45.55 | 50.00 | 8.90 | 91.10 | | 41.20 | 5... Date Added: 2009-07-16 12:57:25 |
| p151_ch10_attract _post-1 Path: UC Davis >> PSC >> 151 Spring, 2009 Description: Psychology 151 5/4/2009 WrapChapter 9 Wrap-up: Conflict Relationships Similarity There is no strong evidence for the complementarity view (i.e. that opposites attract) Rather, similarity is a powerful predict... Date Added: 2009-07-16 17:16:42 |
| oldexams Path: Maastricht >> GEOL >> 100 Spring, 2009 Description: Warning! This document is over 240 pages in length. If printing the entire document, it is recommended that you choose the printing option of \"2 pages per sheet\" (typically in lower left corner of print window). This will print out the entire documen... Date Added: 2009-07-16 23:53:14 |
| lab04_salt_sand_mixture Path: City Colleges of Chicago >> PSE >> 121 Spring, 2009 Description: Laboratory: Separation of Salt and Sand Materials For each pair of students 1 container of sand and coarse salt mixed together Standard laboratory glassware Filter paper Magnifying glass Through out this laboratory keep a detailed log of all observat... Date Added: 2009-07-19 08:53:27 |
| active_loads Path: MIT >> CSAIL >> 6.012 Fall, 2003 Description: 6.012 - Electronic Devices and Circuits - 11/18/03 Two Active Loads for Differential Amplifiers: The Lee Load and the Current Mirror Load 1 Two Active Loads for Differential Amplifiers: 1. Current mirror load 2. Lee load 1. The current mirror load:... Date Added: 2009-07-20 10:26:06 |
| Intermed AC 12e- Ch 21- Test Bank Path: DeVry Addison >> AC >> 557 Spring, 2009 Description: Intermediate Accounting 12th Edition (by D. E. Kieso, J. J. Weygandt, T. D. Warfield 2007 CHAPTER 21 ACCOUNTING FOR LEASES TRUE-FALSE-Conceptual Answer T F F T F F T F F T F F T F T F T F T T No. 1. 2. 3. 4. 5. 6. 7. 8. 9. 10. 11. 12. 13. 14. 15. ... Date Added: 2009-07-20 13:19:20 |
| AME404SampleMidterm Path: USC >> AME >> 404 Fall, 2008 Description: AME 404 Midterm Exam Place: MHP 101. Time: 11-12:20. Date: October 6, 2004 Professor: M. Dravinski Name Instructions. Closed books and notes. No calculators or computers. 1. (30 Pts.) (a) Using Gauss elimination with partial pivoting perform the perm... Date Added: 2009-07-20 16:50:31 |
| Microsoft Word - Solutions_midterm_Fall_08_white Path: USC >> BUAD >> 311T Fall, 2008 Description: SECTION: 8 am 10 am PRINT NAME: SOLUTIONS (Circle One) MARSHALL SCHOOL OF BUSINESS UNIVERSITY OF SOUTHERN CALIFORNIA BUAD 311T: Operations Management For Accounting Majors Professor Ashok Srinivasan MIDTERM EXAM-1 Fall 2008 QUESTION 1 2 3 4 5... Date Added: 2009-07-21 00:54:17 |
| Midterm-2009 Path: NCTU >> EE >> IEE5703 Spring, 2009 Description: Detection and Estimation Midterm, 2009 1. (35%) Assume we have observed N samples x[0], x[1], ., x[N-1], whose model is expressed as x[n] = A + w[n], w[ n ]e - p( w[n]) = ( w[n])! 0 n = 0, 1, ., N - 1 . where A is known and w[n] is white Poi... Date Added: 2009-07-21 08:54:47 |
| Chapter 11_English Path: NCTU >> CM >> EM5102 Fall, 2008 Description: Chapter 11 Spectral Representation Te r: S ache in-Horng C n he Office Engine ring Bld. #4, Room805 : e Te e 31822 l: xt. Em sche m ail: n@ ail.nctu.e du.tw 11.1 Factorization and Innovations This section discusses a signal modeling method to rep... Date Added: 2009-07-21 09:23:29 |
| hw #9 Path: Case Western >> ENGR >> 210 Fall, 2007 Description: ENGR 210 Homework #9 Fall 2008 Due October 29, 2008 Mutual Inductance Problem 1 There is no energy stored in the circuit shown below at the time the switch is opened. (a) Derive the differential equation which describes the behavior of i2 if L1=10... Date Added: 2009-07-21 17:06:43 |
| Practice_Quiz_2_blank Path: USC >> CHEM >> 322AL Summer, 2009 Description: Chemistry 322aL Practice Quiz 2 (1) For each compound below, draw the three-dimensional structure predicted by VSEPR theory and show the direction of any molecular dipole moment. HCCl3 trichloromethane H2C=CF2 1,1-difluoroethene H2C=O formaldehyde ... Date Added: 2009-07-22 20:19:49 |
| Ch_322a_9.010 Path: USC >> CHEM >> 322AL Summer, 2009 Description: Spin-Spin Coupling The splittings observed in the resonances follow a pattern: A resonance due to a group of magnetically equivalent H is split into n+1 lines by n H on adjacent carbons. Equivalent H on adjacent carbons do not cause such splittings. ... Date Added: 2009-07-22 20:33:52 |
| 21 BIO 326R Transformation Path: Texas >> BIO326R >> 52035 Spring, 2009 Description: BIO 326R Transformation and recombination History Fred Griffith 1928 Injecting mice with Streptococcus pneumoniae Uses a virulent and non-virulent strain of S. pneumoniae Strains are visually distinguishable Virulent strain has capsule a... Date Added: 2009-07-24 20:54:34 |
| College_Preparatory_Chemistry_Ch_4_ppt. Path: Cosumnes River College >> CHEM >> 45434 Spring, 2009 Description: College Prep. Chemistry Ch. 4 p. 1 Light quantum mechanical model for the electron grew out of the study of light. Light has both wave like and particle like properties. In the wave model, light is an electromagnetic wave that travels in ... Date Added: 2009-07-24 21:26:45 |
| 348 Path: Rutgers >> POLS >> 101 Spring, 2009 Description: Political Science 348: Culture and Ethnic Conflict Management Fall 2005 Monday and Wednesday 2:30-4 Mr. Ross Many observers see intransigent ethnic conflicts as the greatest contemporary threat to peace. While some of these conflicts, such as in Sri... Date Added: 2009-07-25 19:09:45 |
| Lecture 4 Path: UCSD >> BILD 2 >> 2 Fall, 2008 Description: Figure 41.13 The Development of Human Sex Organs LE 46-10b Seminal vesicle (Rectum) Vas deferens Ejaculatory duct Prostate gland Bulbourethral gland Vas deferens Epididymis Testis Scrotum (Urinary bladder) (Public bone) Erectile tissue of penis Ur... Date Added: 2009-07-25 19:38:00 |
| 241HW Path: Hawaii >> MATH >> 215 Spring, 2009 Description: Calculus I (Math 241) Discussion of curves Problem 1. Discuss the function f (x) = x2 (6 - x2 ) - 4. Problem 2. Discuss the function f (x) = x3 3x2 + 1 In retrospect, enter the function on your graphing calculator and decide whether it would have he... Date Added: 2009-07-26 07:33:43 |
| HW26 Path: Texas >> PHY 303L >> 303L Fall, 2005 Description: Platt, David Homework 26 Due: Nov 9 2005, 4:00 am Inst: Ken Shih This print-out should have 8 questions. Multiple-choice questions may continue on the next column or page find all choices before answering. The due time is Central time. 001 (part ... Date Added: 2009-07-26 21:33:58 |
| Chem504and488Lecture20 Path: Rutgers >> CHEM >> 504 Spring, 2009 Description: ... Date Added: 2009-07-27 14:33:33 |
| Week 6 Quiz Path: DeVry Cincinnati >> BIS >> 311 Fall, 2008 Description: 1. Which of the following statements is true about the ADO.net object model? It provides a way of validating user input It is used primarily in a business services class It automates the process of accessing data in a database All of the a... Date Added: 2009-07-27 16:12:29 |
| Lab8Driver Path: Anne Arundel CC >> CSI >> 161 Spring, 2009 Description: /* * The Lab8Driver class <Driver * for Employee and SalariedEmployee * class creates objects and displays * output using toString> * @author Jeff Cox * */ import java.io.*; i import java.util.Scanner; public class Lab8Driver { public static void mai... Date Added: 2009-07-28 14:22:27 |
| 1 2009TEst1A_2204-6-8 answers Path: IIT Madras >> ORGANIC CH >> CHEM 2204 Winter, 2008 Description: Chemistry 2204/6/8 (\'09) Test 1A Name: Marks are in parentheses 1.(15) Name the top 12 reactions of carbonyl containing compounds and give an example of each using prototypical compounds and reagents. Note: 3 reactions are subdivided into two subcate... Date Added: 2009-07-28 21:52:42 |
| abstract 7 Path: Texas A&M >> HEALTH SYS >> 1501 Spring, 2009 Description: Esteban Sanchez 3/10/2009 PLAN 370-500 Abstract 7 Coming to Grips with Food borne Infection - Peanut Butter, Peppers, and Nationwide Salmonella Outbreaks Each year, approximately 110,000 persons acquire endemic E. coli infection, and 50 of them die. ... Date Added: 2009-07-30 15:52:02 |
| Solution to FM12 Ch 11 P23 Build a Model Path: DeVry Chicago >> FI >> FI504 Summer, 2009 Description: Chapter 11. Solution for Chapter 11 P23 Build a Model Gardial Fisheries is considering two mutually exclusive investments. The projects\' expected net cash flows are as follows: Expected net cash flows Project A Project B ($375) ($575) ($300) $190 ($2... Date Added: 2009-08-01 15:01:02 |
| 2007 Chap.2 Path: University of Phoenix >> ACC /483 >> BASIC INT Spring, 2008 Description: Chapter I2 Determination of Tax Discussion Questions I2-1 a. Gross income is income from taxable sources. Form 1040 combines the results of computations made on several separate schedules. For example, income from a proprietorship is reported on Sche... Date Added: 2009-08-02 13:27:15 |
| SCED 480 A Path: Western Washington >> SCED >> 480 Spring, 2009 Description: ... Date Added: 2009-08-03 13:32:29 |
| Synopsis_09_Jesus_in_Jerusalem Path: LSU >> HNRS >> 3030 Spring, 2009 Description: Synopsis 9: Jesus in Jerusalem 9.1 Jesus on donkey Matt 21:1-7 PMkA 21:1 And when they drew near to Jerusalem and came to Bethphage, to the Mount of Olives, then Jesus sent two disciples, 2 saying to them, \"Go to the village that is opposite you, and... Date Added: 2009-08-04 05:32:10 |
| stocks Path: Lindenwood >> MKTG >> 101 Spring, 2009 Description: Christie Strawser 3/12/2008 WALL STREET JOURNAL ASSIGNMENT PART 2 Ini tial Purchases: Stock Name Date Closing P r ice Walmart (WMT) 2/13/200 9 Big Lots (BIG) 2/13/200 9 Family Dollar (FDO) 2/13/200 9 TOTAL $9,996.90 $26.61 150 $3,991.50 $14.70 92 ... Date Added: 2009-08-04 14:25:16 |
| chap018 Path: Rutgers >> ACCT >> Intermedia Spring, 2009 Description: Chapter 18 AACSB assurance of learning standards in accounting and business education require documentation of outcomes assessment. Although schools, departments, and faculty may approach assessment and its documentation differently, one approach is... Date Added: 2009-08-04 20:03:09 |
| EE555-USC-Spring08-Silvester-HW4 B-2(iv) Plot Path: USC >> EE >> 555 Spring, 2009 Description: Question: B-2 (iv) Throughput Plot Figure . Total Throughput plot vs. f1 ... Date Added: 2009-08-05 12:57:19 |
| HW1 Q1 [Hussain03b] Path: USC >> CSCI >> 551 Spring, 2009 Description: b) What is the key, title, and authors of the paper? Ans: [Hussain03b] A Framework for classifying Denial of Service Attacks, Ale?ya Hussain, John Heidemann, Christos Papadopoulos c) What are the key ideas or claims of the paper (state the idea and... Date Added: 2009-08-05 13:37:02 |
| quiz1.pdf Path: Penn State >> ME >> 106 Fall, 2009 Description: ... Date Added: 2009-08-05 17:16:34 |
| Problem set 2 Path: Berkeley >> ECON >> 140 Spring, 2008 Description: Problem set 2 1. Given the simple linear regression model y i = + xi + i , derive OLS estimators for and , i.e., what are and in terms of xi and yi? ... Date Added: 2009-08-06 12:07:00 |
| fa2001_exam2soln Path: UIllinois >> ECE >> 210 Fall, 2007 Description: ... Date Added: 2009-08-08 02:30:00 |
| fa2002_exam2soln Path: UIllinois >> ECE >> 210 Fall, 2007 Description: ... Date Added: 2009-08-08 02:30:38 |
| 7.8 Path: City College SF >> ENGN >> 45 Spring, 2009 Description: Alternative deformation process to slip twinning If slip is restricted, another type of deformation mechanism may take place called twinning. It is not as common as slip. It can occur in bcc and hcp materials at low temperatures or high load rates. ... Date Added: 2009-08-10 17:11:44 |
| ascii.xls Path: Clarkson >> COMM >> 214 Fall, 2009 Description: Blank Decimal Octal Hex Binary Val - - -0 0 0 0 NUL 1 1 1 1 SOH 2 2 2 10 STX 3 3 3 11 ETX 4 4 4 100 EOT 5 5 5 101 ENQ 6 6 6 110 ACK 7 7 7 111 BEL 8 10 8 1000 BS 9 11 9 1001 HT 10 12 00A 1010 LF 11 13 00B 1011 VT 12 14 00C 1100 FF 13 15 00D 1101 CR 14... Date Added: 2009-08-10 19:49:32 |
| ascii.xlsx Path: Clarkson >> COMM >> 214 Fall, 2009 Description: Blank Decimal Octal Hex Binary Val - - -0 0 0 0 NUL 1 1 1 1 SOH 2 2 2 10 STX 3 3 3 11 ETX 4 4 4 100 EOT 5 5 5 101 ENQ 6 6 6 110 ACK 7 7 7 111 BEL 8 10 8 1000 BS 9 11 9 1001 HT 10 12 00A 1010 LF 11 13 00B 1011 VT 12 14 00C 1100 FF 13 15 00D 1101 CR 14... Date Added: 2009-08-10 19:49:32 |
| S06Ex4SG1.doc Path: Illinois State >> LILT >> 160 Fall, 2009 Description: Study Guide for the Final Exam Spring 2006 From the Film \"Spin the Bottle\": How do gender roles (what it means to be M or F) relate to drinking? How are sexual assault and drinking related? How does MTV\'s Spring Break programming relate to college st... Date Added: 2009-08-10 19:49:51 |
| Reflection and Class Loading.ppt Path: Texas >> EE >> 380 Spring, 2000 Description: vti_encoding:SR|utf8-nl vti_timelastmodified:TR|26 Aug 2004 20:14:08 -0000 vti_extenderversion:SR|5.0.2.6417 vti_author:SR|ENGR\\chasec vti_modifiedby:SR|ROO\\chase vti_timecreated:TR|01 Dec 2000 21:04:42 -0000 vti_title:SR|PowerPoint Presentation vti_... Date Added: 2009-08-10 19:51:17 |
| T0500.t06.str2-logo.pdf Path: UCSC >> T >> 0500 Fall, 2009 Description: T0500.t06 str2 3 2 1 401 410 420 430 440 H 3 2 1 T H S H H T T Z H Z Y 451 460 470 480 490 Z 3 2 1 T S Z E Z Y Z Y Z H T T S T 501 510 520 530 540 H 3 2 1 T Y A Z T 551 560 570 580 590 H Z Y Z T S Z Y Z A Y ... Date Added: 2009-08-10 19:51:49 |
| H10.pdf Path: Stanford >> EE >> 384 Fall, 2009 Description: Overview of Topics Intro to queueing theory Discrete-time queues: the Geom/Geom/1 queue Continuous-time queues: the M/M/1 queue Little\'s Law Poisson Arrivals See Time Averages (PASTA) Corollary: Determinism Minimizes Delay References for queu... Date Added: 2009-08-10 19:53:08 |
| hw3-sol.pdf Path: Stanford >> EE >> 384 Fall, 2009 Description: Stanford University Department of Electrical Engineering EE 384X: Packet Switch Architectures-I 18 February, 2006 Solutions to Problem Set No: 3 1. Ehrenfest Queues (a) Under the PGR scheme: P (choosing a particular bin) = 0.5 b1 (t) =p 4 b1 (t) =q ... Date Added: 2009-08-10 19:53:11 |
| lec1_final.pdf Path: Stanford >> EE >> 384 Fall, 2009 Description: Review of Probability Theory Review Session 1 EE384X Winter 2006 EE384x 1 Random Variable A random experiment with set of outcomes Random variable is a function from set of outcomes to real numbers Winter 2006 EE384x 2 Example Indicator rando... Date Added: 2009-08-10 19:53:12 |
| Resume(Eun Jung Kim)2009.doc Path: Penn State >> EUK >> 138 Fall, 2009 Description: <?xml version=\"1.0\" encoding=\"UTF-8\"?> <Error><Code>NoSuchKey</Code><Message>The specified key does not exist.</Message><Key>29ab66d9112c0b43b4429fae22af89d6892fb3f3.doc</Key><RequestId>A A3C14034E7E8050</RequestId><HostId>mTUGMz3f9RycSXADh+RKhXNaOqj... Date Added: 2009-08-10 19:53:22 |
| trendlines.xls Path: University of Montana >> CS >> 172 Fall, 2008 Description: Year 1990 1991 1992 1993 1994 1995 1996 1997 1998 1999 2000 2001 2002 % of women smoking while pregnant 17.7 17 16 14.9 13.9 12.7 11.9 11.2 10.8 10.4 9.5 9.3 8.6 X 1 2 3 4 5 6 7 8 9 10 11 12 Y 50 40 30 24 20 17 14 13 12 10 9.5 8 Diamond Costs Car... Date Added: 2009-08-10 19:53:34 |
| assignment6.pdf Path: Duke >> STA >> 290 Fall, 2008 Description: STA290 ASSIGNMENT 6 Due November 24, 2008 1. Consider the hierarchical random effects model from class Yij j with non-informative prior p(, , ) -1 -1 where = 1/ and = 2 2 1/ . N (j , 2 ) 2 N (, ) (1) (2) (3) (a) If the (improper) prior di... Date Added: 2009-08-10 19:53:49 |
| AAPL_Summary_Schnoor_Winter09.doc Path: Portland >> IT >> 573 Fall, 2009 Description: AAPL Sector: Information Technology Current Price 52 Week Range Price / TTM Earnings $88.63 $78.20 192.24 15.43 Apple Inc. Current Data Market Cap (B) $78.93B 3/10/09 Analyst: Benjamin Schnoor ROE (ttm) Price to Sales (TTM) Dividend Yield 27.19% 2... Date Added: 2009-08-10 19:53:56 |
| sandia_lng_1204.pdf Path: Maryville MO >> OCE >> 495 Fall, 2009 Description: SANDIA REPORT SAND2004-6258 Unlimited Release Printed December 2004 Guidance on Risk Analysis and Safety Implications of a Large Liquefied Natural Gas (LNG) Spill Over Water Mike Hightower, Louis Gritzo, Anay Luketa-Hanlin, John Covan, Sheldon Ties... Date Added: 2009-08-10 19:54:05 |
| Fluidized Bed Production of Steel Shot.ppt Path: Mich Tech >> MSE >> 3110 Fall, 2009 Description: Production of Steel Shot Josh Ball jbball@mtu.edu Matt Calcutt mtcalcut@mtu.edu Sean Loney smloney@mtu.edu Introduction Background Process Overview Calculations Conclusions Background What is Steel Shot? Tiny steel balls What is it used ... Date Added: 2009-08-10 19:54:12 |
| September17.pdf Path: Ill. Chicago >> BSTT >> 511 Fall, 2008 Description: b p WUstDr j DW#@0#b j #sscq0dq@#sf}cg|CD0U#{vzp y#w l gT Rb rtf gb tb tr pb r bqTboT p b gbb x hd wqUtvDr j DgWT@`a~g0#b j t#btsrsqc0dq@#sf}cg|CD0U#{vzp yw l b p T b pb r bqTboT p b gbb x h wb p uf tr pb r bqTbo m hy WvtDr j Wtssqfrq@0qpn0Bw l ... Date Added: 2009-08-10 19:54:25 |
| lecture12.pdf Path: Midwestern State University >> PHYS >> 102 Fall, 2009 Description: ... Date Added: 2009-08-10 19:54:27 |
| presentation.pdf Path: Penn State >> JTE >> 132 Fall, 2009 Description: Northside Piers Brooklyn, NY Structural System Redesign Jeremiah Ergas AE 482 5th Year Senior Thesis Structural Option April 15th, 2008 Faculty Consultant: Dr. Ali Memari Presentation Outline Intro Intro Building Overview Redesign Goals Slab Des... Date Added: 2009-08-10 19:54:29 |
| Notes on Sensation and Perception.doc Path: Collin College >> PSYC >> 2301 Fall, 2008 Description: Notes on Sensation and Perception SENSATION: The process by which our sensory receptors and nervous system receive and represent stimulus energies from our environment. Perception: The process of organizing and interpreting sensory information en... Date Added: 2009-08-10 19:55:28 |
| G16.11.001.txt Path: Stanford >> YJM >> 789 Fall, 2009 Description: >G16.11.001 Chr16 contig 11 bases 16.1548 TCACGTTGTTGGTCCTAGAGGTGCACTAACAATATTCTCCCACGCAGCTA TCCTGTCTGTGAAATTAGTGCTAGCAAGATCATCGTAGATCCCCACGTAT AAATCAGTAACGCCATCGCAACCTTCTTCAATAAAGTTTCTTACAGGGGC CACATTCAAGCAACCGCATCGGCTCAACCTGATCATGCAATTAGCAAGCA ACA... Date Added: 2009-08-10 19:56:00 |
| ece406spr09_20_2up.pdf Path: N.C. State >> ECE >> 406 Fall, 2008 Description: ECE 406 Design of Complex Digital Systems Lecture 20: Cache Design Spring 2009 W. Rhett Davis NC State University ECE 406 with significant material from Paul Franzon, Bill Allen, & Xun Liu W. Rhett Davis NC State University Spring 2009 Slide 1 Ann... Date Added: 2009-08-10 19:56:09 |
| qsolution19~.pdf Path: Solano Community College >> MATH >> 102 Fall, 2008 Description: ... Date Added: 2009-08-10 19:58:14 |
| Options.doc Path: Bethel VA >> NS >> 302700 Fall, 2009 Description: Nate Schisler Adam Ciroli Adam Gard Daniel Bennett Jim Stroup Options: We have chosen to purchase long-term (LEAP) long call options to hedge against some of our more volatile stocks. Latest Quotes DEC 2004 CALL 20 DQILD Last Sale Net Change Open Bid... Date Added: 2009-08-10 19:58:51 |
| N270L2.pdf Path: Delaware Tech >> EGR >> 270 Fall, 2009 Description: EGR 270 Fundamentals of Computer Engineering File: N270L2 Lab # 2 Logic Gate Characteristics A. Objectives The objectives of this laboratory are: To become familiar with data sheets for logic gates To investigate various logic gate character... Date Added: 2009-08-10 20:01:24 |
| foot.pdf Path: University of Illinois, Urbana Champaign >> FY >> 5000 Fall, 2009 Description: Print Zoom Find Prev Page Next Page Tables Home Footnotes Fiscal Year 2000-2001 Footnotes to the data file are chosen primarily on the basis of a library\'s self-reported anomalies. By grouping the footnotes into categories and listing those li... Date Added: 2009-08-10 20:01:34 |
| Asg6_1.pdf Path: SUNY Albany >> CSI >> 102 Fall, 2009 Description: Overview Create slide shows with PowerPoint CSI 102 Summer 2003 <your name here> Assignment 6 Due June 26, 2003 Better than transparencies or slides Changes made easily Especially at the last minute Rich colors displayed 35 mm slides very ... Date Added: 2009-08-10 20:01:59 |
| YDR510C-A.t2k.alpha-logo.pdf Path: UCSC >> YDR >> 510 Fall, 2009 Description: YDR510C-A.t2k ALPHA 1 H X G G E H H F I F I I I B X X X X XHXIXXXIIIHX X X X X X X XXX H H H H H H HHHHHHH 10 DDS D CSH H B F C S B H X T C C H S H E A E H H B H H H H XXXX X X X X XX E H X X B E S C XXXXX E H E B 1 20 H D S ... Date Added: 2009-08-10 20:03:02 |
| p1S05125.pdf Path: SUNY Stony Brook >> MATH >> 125 Fall, 2009 Description: d } w |wm w } {WaWv ~ n E q B m wu n e x!e iq {z &v(aGUwy{8Ue q d z } h } -3 -2 d ~ f qf } ` w } ~{a#vW ~ n E q B vxd wu m ~ d qf wvvFd m w f f f w } ~{a ... Date Added: 2009-08-10 20:03:47 |
| hw05.ps Path: Duke >> STA >> 205 Spring, 2008 Description: %!PS-Adobe-2.0 %Creator: dvips(k) 5.95a Copyright 2005 Radical Eye Software %Title: hw05.dvi %Pages: 2 %PageOrder: Ascend %BoundingBox: 0 0 612 792 %DocumentFonts: CMBX12 CMBX10 CMR10 CMSY10 CMMI10 CMMI8 MSBM10 CMSS10 %+ CMEX10 CMR8 CMTI10 CMSY8 CMR6... Date Added: 2009-08-10 20:04:27 |
| 20051028_r07o_0500882.pdf Path: Stanford >> LDIS >> 1033 Fall, 2009 Description: 1 2 3 4 5 6 7 8 9 10 11 12 13 GIBSON , DUNN & CRUTCHER LLP JONATHAN C . DICKEY, SBN 088226 KEVIN S . ROSEN, SBN 133304 MICHAEL B. SMITH , SBN 235764 1881 Page Mill Road Palo Alto , Califo rnia 94304 Telephone : (650) 849-5300 Facsimile : (650) 849-5... Date Added: 2009-08-10 20:06:01 |
| l11.pdf Path: University of Illinois, Urbana Champaign >> CS >> 3211 Fall, 2009 Description: CS-3211 Lesson 11: Image processing G Stefanescu - National University of Singapore Parallel Concurrent Programming / G Stefanescu Generalities Generalities: an image is repre... Date Added: 2009-08-10 20:07:02 |
|
|
Get Started With Course Hero Today!
Get study guides, join study groups, and more!
Sign up in seconds with your Facebook account!
Course Hero is a Facebook Application Partner.
Click below to sign-up for FREE.
Our Social Learning Network was built to provide students and key learning partners like professors a platform to share, meet and collaborate while accelerating their comprehension of course-related theories and concepts. We are committed to providing you immediate access to a growing wealth of study materials and an unparalleled academic network of students, professors and other key partners. Why do you care? Because you want the best grade possible and at times need a 24/7 resource that’s responsive to your needs. |
|
What People Are Saying About Course Hero
|
|||
|
|||
|
Explore the benefits of joining Course Hero's social learning network.
|
|||
 |
Get millions of study materials now!Need lecture notes for a missed class or want insightful explanation of the theories and concepts you learn in class? Look no further, Course Hero’s Study Materials empowers you to find a broad and deep set of materials that can help you right now!
Click below to sign-up for FREE.
|
||
 |
Get over 200,000 textbook solutions now!Having difficulty with your homework and need documents that are relevant for your Textbook? Don't be frustrated. Course Hero's Textbook Help presents you study materials from many college courses.
Click below to sign-up for FREE.
|
||
 |
Meet over 300,000 students and your fellow classmates now!Want to meet your current classmates or those that took the class last year? Don’t worry or have anxiety. Course Hero’s Study Groups gives you the seamless opportunity to develop both anonymous or direct relationships with those classmates whom you want to meet and get help from right now!
Click below to sign-up for FREE.
|
||
