Course Solutions And Notes - H6_degrels 29
| No24_Desposato.pdf - Part 5 Path: Berkeley >> IGOV >> 2 Fall, 2008 Description: ts legislators move signi cantly toward their new party. These patterns persist even when controlling for presidential... Date Added: 2009-02-17 17:58:50 |
| RMC78.pdf - Part 5 Path: UC Irvine >> CORNINFO >> 78 Fall, 2008 Description: ls. The concentration of all complementary DNA samples used in this experiment was 2 M. ability to detect 20 fmol of... Date Added: 2009-02-06 19:01:28 |
| kludged-3-1-07.pdf - Part 5 Path: Maryland >> ECON >> 3 Fall, 2008 Description: organism whose precision is equal to its effective precision. Furthermore, the tness of a positive organism with e... Date Added: 2009-02-06 19:27:18 |
| crsc-tr05-05.pdf - Part 5 Path: N.C. State >> CRSC >> 05 Fall, 2008 Description: y y Y h0 h (iii) 0 r,h (y) y wk,h (t, y) y vh (y)dy Y... Date Added: 2009-02-04 14:41:25 |
| ft-stellner.pdf - Part 5 Path: Rutgers >> ECE >> 572 Fall, 2008 Description: art of the state of the network. Then, all processes can independently of each other create a single process checkpoint.... Date Added: 2009-02-04 14:51:16 |
| MOT2003-P-260.doc - Part 5 Path: CSU Long Beach >> E T >> 260 Fall, 2008 Description: for submission. Zahavi, Ron and Linthicum, David. (1999). Enterprise Application Integration with CORBA Component and We... Date Added: 2009-02-02 13:50:29 |
| Alex8.pdf - Part 5 Path: S.F. State >> NEURO >> 8 Fall, 2008 Description: end of the protein. We observed a substantial decrease in Rm when the antibody was applied to the ROMK1-coated tip. This... Date Added: 2009-02-17 19:07:34 |
| Alex8.pdf - Part 5 Path: FSU >> NEURO >> 8 Fall, 2008 Description: end of the protein. We observed a substantial decrease in Rm when the antibody was applied to the ROMK1-coated tip. This... Date Added: 2009-02-17 19:07:34 |
| CSE-TR-545-08.pdf - Part 5 Path: Michigan >> EECS >> 545 Fall, 2008 Description: re not a particular strain on modern devices. 8 Fig. 6. Update speeds for Product-of-Sum trees with RSA at the leaf le... Date Added: 2009-02-02 19:42:09 |
| acc03distfusion.pdf - Part 5 Path: Colorado >> ECE >> 03 Fall, 2008 Description: 1863 1868, 1986. [5] O. E. Drummond. Feedback in Track Fusion Without Process Noise, SPIE Signal and Data Proces... Date Added: 2009-02-06 20:45:39 |
| CHI07-Brumby.pdf - Part 5 Path: Drexel >> CHI >> 07 Fall, 2008 Description: operator in a given strategy all permutations of duration 150, 300, 450, 600, 750, 900, 1050, 1200, 1350, 1500 ms were e... Date Added: 2009-02-06 20:38:07 |
| vis2003app2.pdf - Part 6 Path: UC Davis >> CS >> 2003 Fall, 2008 Description: a new metaphor for visualizing events. We have shown how the simple and compact gures in EventShrubs are able to conv... Date Added: 2009-02-06 18:07:54 |
| Cagney_poverty03.pdf - Part 6 Path: Concordia Chicago >> HEALTH >> 2 Fall, 2008 Description: s of health and well-being including an assessment of self-rated health. The response rate for the MCIC-MS was approxima... Date Added: 2009-02-17 22:50:05 |
| Cagney_poverty03.pdf - Part 6 Path: UChicago >> HEALTH >> 2 Fall, 2008 Description: s of health and well-being including an assessment of self-rated health. The response rate for the MCIC-MS was approxima... Date Added: 2009-02-17 22:50:05 |
| MP_kfw5_a_200709.pdf - Part 6 Path: Duke >> LAW >> 399 Spring, 2008 Description: ssociation, habitat management for piping plovers benefits seabeach amaranth, and vice versa (US Fish and Wildlife Servi... Date Added: 2009-02-02 14:07:55 |
| Chapter6-helmy-4.ppt - Part 6 Path: UF >> CEN >> 4500c Fall, 2008 Description: y how (mechanism) handoff initiated by old BSS 6: Wireless and Mobile Networks 6-100 GSM: handoff with common MSC... Date Added: 2009-01-10 03:40:12 |
| ShertzerHypothesesJAE02.pdf - Part 6 Path: Cornell >> EEB >> 02 Fall, 2008 Description: ion model. Similar analyses of cycles from other data sets show the same pattern (not plotted here), and so unless there... Date Added: 2009-02-17 21:42:43 |
| Hui7.pdf - Part 6 Path: Cornell >> CMS >> 7 Fall, 2008 Description: nd others 9 M M F (c) L (x) dx H (x + dx) rigid substrate dx Figure 9. (a) Schematic of a 180 peel tes... Date Added: 2009-02-17 21:46:05 |
| Reinhardt2004a.pdf - Part 6 Path: UCLA >> PHILOS >> 259 Winter, 2008 Description: at of either of its components. Fig. 7. Sensitivity versus selectivity plots for the length of the shorter sequence of... Date Added: 2009-01-11 20:32:53 |
| Reinhardt2004a.pdf - Part 6 Path: UCLA >> PHILOS >> 299 Spring, 2008 Description: at of either of its components. Fig. 7. Sensitivity versus selectivity plots for the length of the shorter sequence of... Date Added: 2009-01-11 20:32:53 |
| Reinhardt2004a.pdf - Part 6 Path: UCLA >> PHILOS >> 175 Fall, 2008 Description: at of either of its components. Fig. 7. Sensitivity versus selectivity plots for the length of the shorter sequence of... Date Added: 2009-01-11 20:32:53 |
| Reinhardt2004a.pdf - Part 6 Path: UCLA >> PHILOS >> 220 Fall, 2008 Description: at of either of its components. Fig. 7. Sensitivity versus selectivity plots for the length of the shorter sequence of... Date Added: 2009-01-11 20:32:53 |
| Reinhardt2004a.pdf - Part 6 Path: UCLA >> PHILOS >> 291 Fall, 2008 Description: at of either of its components. Fig. 7. Sensitivity versus selectivity plots for the length of the shorter sequence of... Date Added: 2009-01-11 20:32:53 |
| Reinhardt2004a.pdf - Part 6 Path: UCLA >> PHILOS >> C109 Fall, 2008 Description: at of either of its components. Fig. 7. Sensitivity versus selectivity plots for the length of the shorter sequence of... Date Added: 2009-01-11 20:32:53 |
| Reinhardt2004a.pdf - Part 6 Path: UCLA >> PHILOS >> 166 Winter, 2008 Description: at of either of its components. Fig. 7. Sensitivity versus selectivity plots for the length of the shorter sequence of... Date Added: 2009-01-11 20:32:53 |
| Reinhardt2004a.pdf - Part 6 Path: UCLA >> PHILOS >> 191 Fall, 2008 Description: at of either of its components. Fig. 7. Sensitivity versus selectivity plots for the length of the shorter sequence of... Date Added: 2009-01-11 20:32:53 |
| Reinhardt2004a.pdf - Part 6 Path: UCLA >> PHILOS >> 275 Fall, 2008 Description: at of either of its components. Fig. 7. Sensitivity versus selectivity plots for the length of the shorter sequence of... Date Added: 2009-01-11 20:32:53 |
| Reinhardt2004a.pdf - Part 6 Path: UCLA >> PHILOS >> 375 Fall, 2008 Description: at of either of its components. Fig. 7. Sensitivity versus selectivity plots for the length of the shorter sequence of... Date Added: 2009-01-11 20:32:53 |
| Reinhardt2004a.pdf - Part 6 Path: UCLA >> PHILOS >> 154 Fall, 2008 Description: at of either of its components. Fig. 7. Sensitivity versus selectivity plots for the length of the shorter sequence of... Date Added: 2009-01-11 20:32:53 |
| Reinhardt2004a.pdf - Part 6 Path: UCLA >> PHILOS >> 176 Fall, 2008 Description: at of either of its components. Fig. 7. Sensitivity versus selectivity plots for the length of the shorter sequence of... Date Added: 2009-01-11 20:32:53 |
| CP02-Port_Euroskepticism.pdf - Part 6 Path: Berkeley >> CP >> 02 Fall, 2009 Description: the national parliament, the government, and the political parties. Theories of political trust have typically focused o... Date Added: 2009-04-16 02:06:41 |
| 31295017224196.pdf - Part 6 Path: Texas Tech >> ETD >> 07312008 Fall, 2009 Description: ebec, Inc., 9201 boul. Centre Hospitaller, Chamy, Quebec, G6X 1L5. Canada). A sample (306.0 g) of the wood was extracted... Date Added: 2009-04-15 20:33:30 |
| Frey_Eichenberger_1997.pdf - Part 6 Path: N.C. State >> WWW4 >> 4 Fall, 2007 Description: sion factors were calculated using average annual fuel economy estimates in combination with emissions data taken over 0... Date Added: 2009-02-17 22:57:29 |
| FunMath4.pdf - Part 6 Path: Kent State >> MATH >> 10034 Fall, 2008 Description: 2)2 (b) (7t + 5)2 (c) (x 3y)2 2. (a) x2 (x + 10)2 (b) 2v(u 1)2 4. (a) x 3. (a) (5 7x)(5 + 7x) (b) y3 (y... Date Added: 2009-01-11 16:27:07 |
| proposedcancellationssciences.pdf - Part 6 Path: Colorado >> UCBLIBRARI >> 2005 Fall, 2008 Description: and Technology Proceedings / U.S. Symposium on Rock Mechanics Proceedings of the ... convention / International Associat... Date Added: 2009-02-06 20:55:05 |
| proposedcancellationssciences.pdf - Part 6 Path: Colorado >> WWW-LIBRAR >> 2005 Fall, 2008 Description: and Technology Proceedings / U.S. Symposium on Rock Mechanics Proceedings of the ... convention / International Associat... Date Added: 2009-02-06 20:55:07 |
| Professional Hope.pdf - Part 6 Path: Western Michigan >> ECON >> 6660 Fall, 2008 Description: nal Hope 41 vidual client advocates to use community development skills to address linkages between barriers within nu... Date Added: 2009-02-03 14:38:47 |
| Cingranelli_ Richards_Quantitative_Study_of_Human_Rights_Violations.pdf - Part 6 Path: U. Memphis >> ECON >> 3320 Spring, 2008 Description: the role government respect for civil/political rights and physical integrity rights plays in determining a state s el... Date Added: 2009-02-02 19:34:51 |
| Ch04 - Part 6 Path: SUNY Stony Brook >> MAT >> 123 Spring, 2004 Description: 1 X2 X3 1 0 0 2 0 1 0 -1 0 0 1 3 The optimal solution is Z=2, X1=2, X2=X3=0. 6. The initial Phase I tableau is as follow... Date Added: 2008-06-18 17:08:57 |
| Ch04 - Part 6 Path: Berkeley >> IEOR >> 160 Fall, 2007 Description: 1 X2 X3 1 0 0 2 0 1 0 -1 0 0 1 3 The optimal solution is Z=2, X1=2, X2=X3=0. 6. The initial Phase I tableau is as follow... Date Added: 2008-04-02 21:47:22 |
| Ch04 - Part 6 Path: UF >> ISE >> esi 4313 Spring, 2008 Description: 1 X2 X3 1 0 0 2 0 1 0 -1 0 0 1 3 The optimal solution is Z=2, X1=2, X2=X3=0. 6. The initial Phase I tableau is as follow... Date Added: 2008-07-23 11:59:08 |
| MIT-CSAIL-TR-2008-010.pdf?sequence=1 - Part 6 Path: DeAnza College >> ENGR >> 010 Winter, 2008 Description: the period of time within which systems, applications, or functions must be recovered after an outage. [25] Many disas... Date Added: 2009-02-02 14:03:58 |
| No24_Desposato.pdf - Part 6 Path: Berkeley >> IGOV >> 2 Fall, 2008 Description: , S. R. and E. Scheiner (2002). Electoral Incentives and Policy Preferences: Mixed Motives Behind Party Defections in Ja... Date Added: 2009-02-17 17:58:50 |
| kludged-3-1-07.pdf - Part 6 Path: Maryland >> ECON >> 3 Fall, 2008 Description: k+3 k+1 k+2 k 1 + j , k+2 2 k 1 + 2 k+1 k+2 2 j k+2 2 k 1 + 2 k+1 k+2 k 1 + 1 (k +... Date Added: 2009-02-06 19:27:18 |
| crsc-tr05-05.pdf - Part 6 Path: N.C. State >> CRSC >> 05 Fall, 2008 Description: h (iii) (C TE ) (t) = ATE (y) y wk,h (t, y) dy CTE (t, y) ek + h wk,h (y) dy + A k y 11,h 11,h 11,h... Date Added: 2009-02-04 14:41:25 |
| CHI07-Brumby.pdf - Part 6 Path: Drexel >> CHI >> 07 Fall, 2008 Description: fastest strategy completes the dial task in a single contiguous block without once returning attention to driving. The p... Date Added: 2009-02-06 20:38:07 |
| Cagney_poverty03.pdf - Part 7 Path: UChicago >> HEALTH >> 2 Fall, 2008 Description: 000 population between 1991 and 1993 was included to tap crime exposure within the neighborhood. Homicide is one of the... Date Added: 2009-02-17 22:50:05 |
| Cagney_poverty03.pdf - Part 7 Path: Concordia Chicago >> HEALTH >> 2 Fall, 2008 Description: 000 population between 1991 and 1993 was included to tap crime exposure within the neighborhood. Homicide is one of the... Date Added: 2009-02-17 22:50:05 |
| MP_kfw5_a_200709.pdf - Part 7 Path: Duke >> LAW >> 399 Spring, 2008 Description: sites. Both gulls are attracted to human garbage, and it has been observed that gull numbers increase as the summer seas... Date Added: 2009-02-02 14:07:55 |
| ShertzerHypothesesJAE02.pdf - Part 7 Path: Cornell >> EEB >> 02 Fall, 2008 Description: , evolutionary dynamics have a destabilizing effect over a wide range of dilution rates. Cycles are generated by an evol... Date Added: 2009-02-17 21:42:43 |
| Hui7.pdf - Part 7 Path: Cornell >> CMS >> 7 Fall, 2008 Description: ne when the brils came into intimate contact. Once contact was achieved, the sample was pulled o and the maximum t... Date Added: 2009-02-17 21:46:05 |
| Reinhardt2004a.pdf - Part 7 Path: UCLA >> PHILOS >> 154 Fall, 2008 Description: within a given RMSD from the structural superposition. The solid black fraction represents those alignments that were wi... Date Added: 2009-01-11 20:32:53 |
| Reinhardt2004a.pdf - Part 7 Path: UCLA >> PHILOS >> 176 Fall, 2008 Description: within a given RMSD from the structural superposition. The solid black fraction represents those alignments that were wi... Date Added: 2009-01-11 20:32:53 |
| Reinhardt2004a.pdf - Part 7 Path: UCLA >> PHILOS >> 259 Winter, 2008 Description: within a given RMSD from the structural superposition. The solid black fraction represents those alignments that were wi... Date Added: 2009-01-11 20:32:53 |
| Reinhardt2004a.pdf - Part 7 Path: UCLA >> PHILOS >> 299 Spring, 2008 Description: within a given RMSD from the structural superposition. The solid black fraction represents those alignments that were wi... Date Added: 2009-01-11 20:32:53 |
| Reinhardt2004a.pdf - Part 7 Path: UCLA >> PHILOS >> 175 Fall, 2008 Description: within a given RMSD from the structural superposition. The solid black fraction represents those alignments that were wi... Date Added: 2009-01-11 20:32:53 |
| Reinhardt2004a.pdf - Part 7 Path: UCLA >> PHILOS >> 220 Fall, 2008 Description: within a given RMSD from the structural superposition. The solid black fraction represents those alignments that were wi... Date Added: 2009-01-11 20:32:53 |
| Reinhardt2004a.pdf - Part 7 Path: UCLA >> PHILOS >> 291 Fall, 2008 Description: within a given RMSD from the structural superposition. The solid black fraction represents those alignments that were wi... Date Added: 2009-01-11 20:32:53 |
| Reinhardt2004a.pdf - Part 7 Path: UCLA >> PHILOS >> C109 Fall, 2008 Description: within a given RMSD from the structural superposition. The solid black fraction represents those alignments that were wi... Date Added: 2009-01-11 20:32:53 |
| Reinhardt2004a.pdf - Part 7 Path: UCLA >> PHILOS >> 166 Winter, 2008 Description: within a given RMSD from the structural superposition. The solid black fraction represents those alignments that were wi... Date Added: 2009-01-11 20:32:53 |
| Reinhardt2004a.pdf - Part 7 Path: UCLA >> PHILOS >> 191 Fall, 2008 Description: within a given RMSD from the structural superposition. The solid black fraction represents those alignments that were wi... Date Added: 2009-01-11 20:32:53 |
| Reinhardt2004a.pdf - Part 7 Path: UCLA >> PHILOS >> 275 Fall, 2008 Description: within a given RMSD from the structural superposition. The solid black fraction represents those alignments that were wi... Date Added: 2009-01-11 20:32:53 |
| Reinhardt2004a.pdf - Part 7 Path: UCLA >> PHILOS >> 375 Fall, 2008 Description: within a given RMSD from the structural superposition. The solid black fraction represents those alignments that were wi... Date Added: 2009-01-11 20:32:53 |
| CP02-Port_Euroskepticism.pdf - Part 7 Path: Berkeley >> CP >> 02 Fall, 2009 Description: us from making any definitive longitudinal assessments about the political and attitudinal effects of the depoliticizati... Date Added: 2009-04-16 02:06:41 |
| 31295017224196.pdf - Part 7 Path: Texas Tech >> ETD >> 07312008 Fall, 2009 Description: then dried over anhydrous MgS04, and concentrated by rotary evaporator.^^ *HNMR (500 MHz): 85.139 (d, 1= 2.5 Hz, IH), 8... Date Added: 2009-04-15 20:33:30 |
| Frey_Eichenberger_1997.pdf - Part 7 Path: N.C. State >> WWW4 >> 4 Fall, 2007 Description: onditions at RDU is successful, then applications of the new speed-acceleration measurement capabilities to school buses... Date Added: 2009-02-17 22:57:29 |
| FunMath4.pdf - Part 7 Path: Kent State >> MATH >> 10034 Fall, 2008 Description: + 6 = 10 1.4. FACTORING TRINOMIALS 35 This is a complete list of all pairs of positive integers whose product is 24.... Date Added: 2009-01-11 16:27:07 |
| proposedcancellationssciences.pdf - Part 7 Path: Colorado >> UCBLIBRARI >> 2005 Fall, 2008 Description: ging United States pharmacopeia Uspekhi matematicheskikh nauk / Vsesoiuznaia matematicheskaia assotsiatsiia Utilitas mat... Date Added: 2009-02-06 20:55:05 |
| proposedcancellationssciences.pdf - Part 7 Path: Colorado >> WWW-LIBRAR >> 2005 Fall, 2008 Description: ging United States pharmacopeia Uspekhi matematicheskikh nauk / Vsesoiuznaia matematicheskaia assotsiatsiia Utilitas mat... Date Added: 2009-02-06 20:55:07 |
| Professional Hope.pdf - Part 7 Path: Western Michigan >> ECON >> 6660 Fall, 2008 Description: onal approach to casework practice, In R. W. Roberts & R. H. Nee (Eds.). Theories of social casework (pp. 79-128), Chica... Date Added: 2009-02-03 14:38:47 |
| Ch04 - Part 7 Path: UF >> ISE >> esi 4313 Spring, 2008 Description: unmet by 5 million. 1b. Only point satisfying the HIM constraint, the budget line, and the LIP constraint, is the point... Date Added: 2008-07-23 11:59:08 |
| Ch04 - Part 7 Path: SUNY Stony Brook >> MAT >> 123 Spring, 2004 Description: unmet by 5 million. 1b. Only point satisfying the HIM constraint, the budget line, and the LIP constraint, is the point... Date Added: 2008-06-18 17:08:57 |
| Ch04 - Part 7 Path: Berkeley >> IEOR >> 160 Fall, 2007 Description: unmet by 5 million. 1b. Only point satisfying the HIM constraint, the budget line, and the LIP constraint, is the point... Date Added: 2008-04-02 21:47:22 |
| MIT-CSAIL-TR-2008-010.pdf?sequence=1 - Part 7 Path: DeAnza College >> ENGR >> 010 Winter, 2008 Description: cation channels primarily affect the availability metrics. Chapter 3 investigates the resilience of various medical reco... Date Added: 2009-02-02 14:03:58 |
| kludged-3-1-07.pdf - Part 7 Path: Maryland >> ECON >> 3 Fall, 2008 Description: ate at which this probability declines. Proof of Theorem 1 The remainder of the paper lls in the details of the proof... Date Added: 2009-02-06 19:27:18 |
| crsc-tr05-05.pdf - Part 7 Path: N.C. State >> CRSC >> 05 Fall, 2008 Description: AT E )d , of the homogenized matrix A11 as well as the lower and upper 11 TE) TE) o -diagonal entries (A11 lod and (A1... Date Added: 2009-02-04 14:41:25 |
| CHI07-Brumby.pdf - Part 7 Path: Drexel >> CHI >> 07 Fall, 2008 Description: uivalent dialing task, and that their average lateral deviation was 0.49 m (SD = 0.10 m) during secondary-task performan... Date Added: 2009-02-06 20:38:07 |
| Cagney_poverty03.pdf - Part 8 Path: UChicago >> HEALTH >> 2 Fall, 2008 Description: hanisms that may link neighborhood economic conditions with individual self-rated health. Results Table 4 reports the r... Date Added: 2009-02-17 22:50:05 |
| Cagney_poverty03.pdf - Part 8 Path: Concordia Chicago >> HEALTH >> 2 Fall, 2008 Description: hanisms that may link neighborhood economic conditions with individual self-rated health. Results Table 4 reports the r... Date Added: 2009-02-17 22:50:05 |
| MP_kfw5_a_200709.pdf - Part 8 Path: Duke >> LAW >> 399 Spring, 2008 Description: on North Carolina offers free weekly tours to the public of this undeveloped barrier island spit. These tours educate th... Date Added: 2009-02-02 14:07:55 |
| ShertzerHypothesesJAE02.pdf - Part 8 Path: Cornell >> EEB >> 02 Fall, 2008 Description: Associates, Inc, Sunderland, MA. Monod, J. (1950) La technique de culture continue; theorie et applications. Annals de l... Date Added: 2009-02-17 21:42:43 |
| Hui7.pdf - Part 8 Path: Cornell >> CMS >> 7 Fall, 2008 Description: f adhesion Wf /Wad 1 m fibrillar polyimide on PDMS substrate 1.0 0.8 0.6 1 0.4 0.2 1 flat control samples fibrillar... Date Added: 2009-02-17 21:46:05 |
| Reinhardt2004a.pdf - Part 8 Path: UCLA >> PHILOS >> 191 Fall, 2008 Description: is possible that the T-pairs doing well in this experiment might in fact be also related on the H-level, but no structur... Date Added: 2009-01-11 20:32:53 |
| Reinhardt2004a.pdf - Part 8 Path: UCLA >> PHILOS >> 275 Fall, 2008 Description: is possible that the T-pairs doing well in this experiment might in fact be also related on the H-level, but no structur... Date Added: 2009-01-11 20:32:53 |
| Reinhardt2004a.pdf - Part 8 Path: UCLA >> PHILOS >> 375 Fall, 2008 Description: is possible that the T-pairs doing well in this experiment might in fact be also related on the H-level, but no structur... Date Added: 2009-01-11 20:32:53 |
| Reinhardt2004a.pdf - Part 8 Path: UCLA >> PHILOS >> 154 Fall, 2008 Description: is possible that the T-pairs doing well in this experiment might in fact be also related on the H-level, but no structur... Date Added: 2009-01-11 20:32:53 |
| Reinhardt2004a.pdf - Part 8 Path: UCLA >> PHILOS >> 176 Fall, 2008 Description: is possible that the T-pairs doing well in this experiment might in fact be also related on the H-level, but no structur... Date Added: 2009-01-11 20:32:53 |
| Reinhardt2004a.pdf - Part 8 Path: UCLA >> PHILOS >> 259 Winter, 2008 Description: is possible that the T-pairs doing well in this experiment might in fact be also related on the H-level, but no structur... Date Added: 2009-01-11 20:32:53 |
| Reinhardt2004a.pdf - Part 8 Path: UCLA >> PHILOS >> 299 Spring, 2008 Description: is possible that the T-pairs doing well in this experiment might in fact be also related on the H-level, but no structur... Date Added: 2009-01-11 20:32:53 |
| Reinhardt2004a.pdf - Part 8 Path: UCLA >> PHILOS >> 175 Fall, 2008 Description: is possible that the T-pairs doing well in this experiment might in fact be also related on the H-level, but no structur... Date Added: 2009-01-11 20:32:53 |
| Reinhardt2004a.pdf - Part 8 Path: UCLA >> PHILOS >> 220 Fall, 2008 Description: is possible that the T-pairs doing well in this experiment might in fact be also related on the H-level, but no structur... Date Added: 2009-01-11 20:32:53 |
| Reinhardt2004a.pdf - Part 8 Path: UCLA >> PHILOS >> 291 Fall, 2008 Description: is possible that the T-pairs doing well in this experiment might in fact be also related on the H-level, but no structur... Date Added: 2009-01-11 20:32:53 |
| Reinhardt2004a.pdf - Part 8 Path: UCLA >> PHILOS >> C109 Fall, 2008 Description: is possible that the T-pairs doing well in this experiment might in fact be also related on the H-level, but no structur... Date Added: 2009-01-11 20:32:53 |
| Reinhardt2004a.pdf - Part 8 Path: UCLA >> PHILOS >> 166 Winter, 2008 Description: is possible that the T-pairs doing well in this experiment might in fact be also related on the H-level, but no structur... Date Added: 2009-01-11 20:32:53 |
| CP02-Port_Euroskepticism.pdf - Part 8 Path: Berkeley >> CP >> 02 Fall, 2009 Description: de Portugal [electoral platform, 2002 elections]. Lisbon: CDS-PP. Citrin, J. & Green, D. P. (1986). Presidential Leaders... Date Added: 2009-04-16 02:06:41 |
| Frey_Eichenberger_1997.pdf - Part 8 Path: N.C. State >> WWW4 >> 4 Fall, 2007 Description: nts may be extended to attainment areas within 85 percent of the NAAQS. To demonstrate conformity, a transportation plan... Date Added: 2009-02-17 22:57:29 |
| FunMath4.pdf - Part 8 Path: Kent State >> MATH >> 10034 Fall, 2008 Description: de, we obtain: 16 t2 + t 6 = 0 16(t + 3)(t 2) = 0 So the solutions to this equation are precisely the val... Date Added: 2009-01-11 16:27:07 |
| Ch04 - Part 8 Path: UF >> ISE >> esi 4313 Spring, 2008 Description: Out-of-state non-nerds with 600 SAT, OS5 = Out-of-state nerds with 500 SAT, OS6 = Out-of-state non-nerds with 500 SAT. T... Date Added: 2008-07-23 11:59:08 |
| Ch04 - Part 8 Path: SUNY Stony Brook >> MAT >> 123 Spring, 2004 Description: Out-of-state non-nerds with 600 SAT, OS5 = Out-of-state nerds with 500 SAT, OS6 = Out-of-state non-nerds with 500 SAT. T... Date Added: 2008-06-18 17:08:57 |
| Ch04 - Part 8 Path: Berkeley >> IEOR >> 160 Fall, 2007 Description: Out-of-state non-nerds with 600 SAT, OS5 = Out-of-state nerds with 500 SAT, OS6 = Out-of-state non-nerds with 500 SAT. T... Date Added: 2008-04-02 21:47:22 |
| MIT-CSAIL-TR-2008-010.pdf?sequence=1 - Part 8 Path: DeAnza College >> ENGR >> 010 Winter, 2008 Description: many healthcare organizations, especially small providers. Some companies offer remote storage services at a premium pri... Date Added: 2009-02-02 14:03:58 |
| kludged-3-1-07.pdf - Part 8 Path: Maryland >> ECON >> 3 Fall, 2008 Description: unit upward. By comparison, each type 2 step moves three steps to the right. Because of the relative slopes of the two l... Date Added: 2009-02-06 19:27:18 |
| crsc-tr05-05.pdf - Part 8 Path: N.C. State >> CRSC >> 05 Fall, 2008 Description: 10 9 1011 Hz (frequencies are considered low here if the corresponding angular frequency < 1/ ). In Figure 11 w... Date Added: 2009-02-04 14:41:25 |
| CHI07-Brumby.pdf - Part 8 Path: Drexel >> CHI >> 07 Fall, 2008 Description: d dialing can consume more time than manual dialing but result in no significant degradation in performance [13]. The mo... Date Added: 2009-02-06 20:38:07 |
| Cagney_poverty03.pdf - Part 9 Path: Concordia Chicago >> HEALTH >> 2 Fall, 2008 Description: ted poverty Income inequality (Gini) Concentrated af uence Aggregated education a Neighborhood level N 275; Individ... Date Added: 2009-02-17 22:50:05 |
| Cagney_poverty03.pdf - Part 9 Path: UChicago >> HEALTH >> 2 Fall, 2008 Description: ted poverty Income inequality (Gini) Concentrated af uence Aggregated education a Neighborhood level N 275; Individ... Date Added: 2009-02-17 22:50:05 |
| MP_kfw5_a_200709.pdf - Part 9 Path: Duke >> LAW >> 399 Spring, 2008 Description: ildlife Species. Retrieved July 27, 2006, from http://www.ncwildlife.org/pg07_WildlifeSpeciesCon/protected_species.pdf N... Date Added: 2009-02-02 14:07:55 |
| Hui7.pdf - Part 9 Path: Cornell >> CMS >> 7 Fall, 2008 Description: s emphasized by showing its relation to the wavelength of sinusoidal perturbations that give rise to instabilities in ad... Date Added: 2009-02-17 21:46:05 |
| Reinhardt2004a.pdf - Part 9 Path: UCLA >> PHILOS >> C109 Fall, 2008 Description: ture Struct Biol 1995;2:171 178. 5. Reese MG, Hartzell G, Harris NL, Ohler U, Abril JF, Lewis SE. Genome annotation as... Date Added: 2009-01-11 20:32:53 |
| Reinhardt2004a.pdf - Part 9 Path: UCLA >> PHILOS >> 166 Winter, 2008 Description: ture Struct Biol 1995;2:171 178. 5. Reese MG, Hartzell G, Harris NL, Ohler U, Abril JF, Lewis SE. Genome annotation as... Date Added: 2009-01-11 20:32:53 |
| Reinhardt2004a.pdf - Part 9 Path: UCLA >> PHILOS >> 191 Fall, 2008 Description: ture Struct Biol 1995;2:171 178. 5. Reese MG, Hartzell G, Harris NL, Ohler U, Abril JF, Lewis SE. Genome annotation as... Date Added: 2009-01-11 20:32:53 |
| Reinhardt2004a.pdf - Part 9 Path: UCLA >> PHILOS >> 275 Fall, 2008 Description: ture Struct Biol 1995;2:171 178. 5. Reese MG, Hartzell G, Harris NL, Ohler U, Abril JF, Lewis SE. Genome annotation as... Date Added: 2009-01-11 20:32:53 |
| Reinhardt2004a.pdf - Part 9 Path: UCLA >> PHILOS >> 375 Fall, 2008 Description: ture Struct Biol 1995;2:171 178. 5. Reese MG, Hartzell G, Harris NL, Ohler U, Abril JF, Lewis SE. Genome annotation as... Date Added: 2009-01-11 20:32:53 |
| Reinhardt2004a.pdf - Part 9 Path: UCLA >> PHILOS >> 154 Fall, 2008 Description: ture Struct Biol 1995;2:171 178. 5. Reese MG, Hartzell G, Harris NL, Ohler U, Abril JF, Lewis SE. Genome annotation as... Date Added: 2009-01-11 20:32:53 |
| Reinhardt2004a.pdf - Part 9 Path: UCLA >> PHILOS >> 176 Fall, 2008 Description: ture Struct Biol 1995;2:171 178. 5. Reese MG, Hartzell G, Harris NL, Ohler U, Abril JF, Lewis SE. Genome annotation as... Date Added: 2009-01-11 20:32:53 |
| Reinhardt2004a.pdf - Part 9 Path: UCLA >> PHILOS >> 259 Winter, 2008 Description: ture Struct Biol 1995;2:171 178. 5. Reese MG, Hartzell G, Harris NL, Ohler U, Abril JF, Lewis SE. Genome annotation as... Date Added: 2009-01-11 20:32:53 |
| Reinhardt2004a.pdf - Part 9 Path: UCLA >> PHILOS >> 299 Spring, 2008 Description: ture Struct Biol 1995;2:171 178. 5. Reese MG, Hartzell G, Harris NL, Ohler U, Abril JF, Lewis SE. Genome annotation as... Date Added: 2009-01-11 20:32:53 |
| Reinhardt2004a.pdf - Part 9 Path: UCLA >> PHILOS >> 175 Fall, 2008 Description: ture Struct Biol 1995;2:171 178. 5. Reese MG, Hartzell G, Harris NL, Ohler U, Abril JF, Lewis SE. Genome annotation as... Date Added: 2009-01-11 20:32:53 |
| Reinhardt2004a.pdf - Part 9 Path: UCLA >> PHILOS >> 220 Fall, 2008 Description: ture Struct Biol 1995;2:171 178. 5. Reese MG, Hartzell G, Harris NL, Ohler U, Abril JF, Lewis SE. Genome annotation as... Date Added: 2009-01-11 20:32:53 |
| Reinhardt2004a.pdf - Part 9 Path: UCLA >> PHILOS >> 291 Fall, 2008 Description: ture Struct Biol 1995;2:171 178. 5. Reese MG, Hartzell G, Harris NL, Ohler U, Abril JF, Lewis SE. Genome annotation as... Date Added: 2009-01-11 20:32:53 |
| CP02-Port_Euroskepticism.pdf - Part 9 Path: Berkeley >> CP >> 02 Fall, 2009 Description: d, M. S. (1992). Measuring Political Legitimacy. American Political Science Review 86: 149-66. 29... Date Added: 2009-04-16 02:06:41 |
| Frey_Eichenberger_1997.pdf - Part 9 Path: N.C. State >> WWW4 >> 4 Fall, 2007 Description: idely used is Mobile5a, which is a U.S. Environmental Protection Agency model. The California Air Resources Board (CARB)... Date Added: 2009-02-17 22:57:29 |
| FunMath4.pdf - Part 9 Path: Kent State >> MATH >> 10034 Fall, 2008 Description: (If this is not apparent, the reader can test values of x from each interval in the linear factor.) Thus, we ll in th... Date Added: 2009-01-11 16:27:07 |
| Ch04 - Part 9 Path: UF >> ISE >> esi 4313 Spring, 2008 Description: 1 AT 12, .0000 TWIN= -.1000E+31 111 SET S5 TO >= 1 AT 13, .0000 TWIN= -.1000E+31 112 DELETE T5 AT LEVEL 14 DELETE S5 AT... Date Added: 2008-07-23 11:59:08 |
| Ch04 - Part 9 Path: SUNY Stony Brook >> MAT >> 123 Spring, 2004 Description: 1 AT 12, .0000 TWIN= -.1000E+31 111 SET S5 TO >= 1 AT 13, .0000 TWIN= -.1000E+31 112 DELETE T5 AT LEVEL 14 DELETE S5 AT... Date Added: 2008-06-18 17:08:57 |
| Ch04 - Part 9 Path: Berkeley >> IEOR >> 160 Fall, 2007 Description: 1 AT 12, .0000 TWIN= -.1000E+31 111 SET S5 TO >= 1 AT 13, .0000 TWIN= -.1000E+31 112 DELETE T5 AT LEVEL 14 DELETE S5 AT... Date Added: 2008-04-02 21:47:22 |
| MIT-CSAIL-TR-2008-010.pdf?sequence=1 - Part 9 Path: DeAnza College >> ENGR >> 010 Winter, 2008 Description: with some of the important properties of medical record technical architectures, the next step will be to give some conc... Date Added: 2009-02-02 14:03:58 |
| crsc-tr05-05.pdf - Part 9 Path: N.C. State >> CRSC >> 05 Fall, 2008 Description: lves an ordinary di erential equation for the hysteretic part of the polarization term. This approach should facilitat... Date Added: 2009-02-04 14:41:25 |
| Cagney_poverty03.pdf - Part 10 Path: Concordia Chicago >> HEALTH >> 2 Fall, 2008 Description: n the other hand, it is important to note that individual-level income has a considerably greater effect on individual s... Date Added: 2009-02-17 22:50:05 |
| Cagney_poverty03.pdf - Part 10 Path: UChicago >> HEALTH >> 2 Fall, 2008 Description: n the other hand, it is important to note that individual-level income has a considerably greater effect on individual s... Date Added: 2009-02-17 22:50:05 |
| MP_kfw5_a_200709.pdf - Part 10 Path: Duke >> LAW >> 399 Spring, 2008 Description: ;Z:\\\\MP8_11\\\\MasterP\\\\scratch\\\\RasterT_Reclass2.shp #;Z:\\\\MP8_11\\\\MasterP\\\\scratch\\\\RasterT_Reclass3.shp #;Z:\\\\MP8_11\\\\M... Date Added: 2009-02-02 14:07:55 |
| Frey_Eichenberger_1997.pdf - Part 10 Path: N.C. State >> WWW4 >> 4 Fall, 2007 Description: es. Besides serving as an effective I/M tool, remote sensing of vehicle exhaust emissions would also help improve our un... Date Added: 2009-02-17 22:57:29 |
| FunMath4.pdf - Part 10 Path: Kent State >> MATH >> 10034 Fall, 2008 Description: that choice, we will express the length of each of the other two sides of the triangle in terms of x. Since the long leg... Date Added: 2009-01-11 16:27:07 |
| Ch04 - Part 10 Path: UF >> ISE >> esi 4313 Spring, 2008 Description: X5 0.100000 X6 0.150000 X7 0.100000 S2M 0.000000 S1M 0.000000 S1P 0.000000 S2P 0.3000000 VALUE 1.000000 1.000000 0.00000... Date Added: 2008-07-23 11:59:08 |
| Ch04 - Part 10 Path: SUNY Stony Brook >> MAT >> 123 Spring, 2004 Description: X5 0.100000 X6 0.150000 X7 0.100000 S2M 0.000000 S1M 0.000000 S1P 0.000000 S2P 0.3000000 VALUE 1.000000 1.000000 0.00000... Date Added: 2008-06-18 17:08:57 |
| Ch04 - Part 10 Path: Berkeley >> IEOR >> 160 Fall, 2007 Description: X5 0.100000 X6 0.150000 X7 0.100000 S2M 0.000000 S1M 0.000000 S1P 0.000000 S2P 0.3000000 VALUE 1.000000 1.000000 0.00000... Date Added: 2008-04-02 21:47:22 |
| MIT-CSAIL-TR-2008-010.pdf?sequence=1 - Part 10 Path: DeAnza College >> ENGR >> 010 Winter, 2008 Description: his setup will yield high recoverability. It will also give very high RPO because the hot backup can be performed while... Date Added: 2009-02-02 14:03:58 |
| Cagney_poverty03.pdf - Part 11 Path: Concordia Chicago >> HEALTH >> 2 Fall, 2008 Description: ability to capture neighborhood dynamics and determine causation. Lacking a measure for individual stock of social capit... Date Added: 2009-02-17 22:50:05 |
| Cagney_poverty03.pdf - Part 11 Path: UChicago >> HEALTH >> 2 Fall, 2008 Description: ability to capture neighborhood dynamics and determine causation. Lacking a measure for individual stock of social capit... Date Added: 2009-02-17 22:50:05 |
| MP_kfw5_a_200709.pdf - Part 11 Path: Duke >> LAW >> 399 Spring, 2008 Description: MP8_11\\\\MasterP\\\\scratch\\\\full2005\") # Process: Single Output Map Algebra (7)... gp.SingleOutputMapAlgebra_sa(\"asl2005-a... Date Added: 2009-02-02 14:07:55 |
| Frey_Eichenberger_1997.pdf - Part 11 Path: N.C. State >> WWW4 >> 4 Fall, 2007 Description: h of the infrared signal is also displayed on the computer console as a voltage. RSD equipment provides the user with an... Date Added: 2009-02-17 22:57:29 |
| FunMath4.pdf - Part 11 Path: Kent State >> MATH >> 10034 Fall, 2008 Description: uare is 12 more than the number. 2. Find all numbers whose square is 8 more than twice the number. 3. Find all numbers w... Date Added: 2009-01-11 16:27:07 |
| MIT-CSAIL-TR-2008-010.pdf?sequence=1 - Part 11 Path: DeAnza College >> ENGR >> 010 Winter, 2008 Description: r image files, saved to CD and then carried or mailed to the destination healthcare provider. In disaster situations, wh... Date Added: 2009-02-02 14:03:58 |
| Cagney_poverty03.pdf - Part 12 Path: UChicago >> HEALTH >> 2 Fall, 2008 Description: Cunradi, C. B., Caetano, R., Clark, C., & Schafer, J. (2000). Neighborhood poverty as a predictor of intimate partner vi... Date Added: 2009-02-17 22:50:05 |
| Cagney_poverty03.pdf - Part 12 Path: Concordia Chicago >> HEALTH >> 2 Fall, 2008 Description: Cunradi, C. B., Caetano, R., Clark, C., & Schafer, J. (2000). Neighborhood poverty as a predictor of intimate partner vi... Date Added: 2009-02-17 22:50:05 |
| Frey_Eichenberger_1997.pdf - Part 12 Path: N.C. State >> WWW4 >> 4 Fall, 2007 Description: is broken, and 0.6 seconds during which the beam is reestablished and passes through the exhaust plume). When a vehicle... Date Added: 2009-02-17 22:57:29 |
| FunMath4.pdf - Part 12 Path: Kent State >> MATH >> 10034 Fall, 2008 Description: etermine which of the following are rational expressions. (Answers on page 66.) 3 x 1 a. x2 + 2 b. x2 + 2xy + y2... Date Added: 2009-01-11 16:27:07 |
| MIT-CSAIL-TR-2008-010.pdf?sequence=1 - Part 12 Path: DeAnza College >> ENGR >> 010 Winter, 2008 Description: e, recognized the resilience advantages of PHRs and automatically added 18,000 affected members from the region hit by H... Date Added: 2009-02-02 14:03:58 |
| Cagney_poverty03.pdf - Part 13 Path: UChicago >> HEALTH >> 2 Fall, 2008 Description: Social Science, 51(2), S96 S104. Wilkinson, R. G. (1992). Income distribution and life expectancy. British Medical Jou... Date Added: 2009-02-17 22:50:05 |
| Cagney_poverty03.pdf - Part 13 Path: Concordia Chicago >> HEALTH >> 2 Fall, 2008 Description: Social Science, 51(2), S96 S104. Wilkinson, R. G. (1992). Income distribution and life expectancy. British Medical Jou... Date Added: 2009-02-17 22:50:05 |
| Frey_Eichenberger_1997.pdf - Part 13 Path: N.C. State >> WWW4 >> 4 Fall, 2007 Description: r vehicles with exhaust pollutant ratios similar to that of the calibration gas. 2.5 Remote Sensor Accuracy The accurac... Date Added: 2009-02-17 22:57:29 |
| FunMath4.pdf - Part 13 Path: Kent State >> MATH >> 10034 Fall, 2008 Description: ined functions that can be written as a product of two linear polynomials. We discovered the connection between the line... Date Added: 2009-01-11 16:27:07 |
| MIT-CSAIL-TR-2008-010.pdf?sequence=1 - Part 13 Path: DeAnza College >> ENGR >> 010 Winter, 2008 Description: nant form of backup for medical records is the complete lack of a backup system because the vast majority of medical rec... Date Added: 2009-02-02 14:03:58 |
| Frey_Eichenberger_1997.pdf - Part 14 Path: N.C. State >> WWW4 >> 4 Fall, 2007 Description: ocate receiver on the four mounting studs provided on the receiver tripod and secure with wingnuts (included on tripod).... Date Added: 2009-02-17 22:57:29 |
| FunMath4.pdf - Part 14 Path: Kent State >> MATH >> 10034 Fall, 2008 Description: is 2y. 1+ x x 1+ 2y 2y 2y = x 1 2y x 1 y y 2y 1 + x 2y x 1 y = 2y 2y x 2y = 2y (x 1) y 2y... Date Added: 2009-01-11 16:27:07 |
| MIT-CSAIL-TR-2008-010.pdf?sequence=1 - Part 14 Path: DeAnza College >> ENGR >> 010 Winter, 2008 Description: k externality. Payers and patients would benefit from HIE because patients would receive fewer redundant tests and more... Date Added: 2009-02-02 14:03:58 |
| Frey_Eichenberger_1997.pdf - Part 15 Path: N.C. State >> WWW4 >> 4 Fall, 2007 Description: school bus statistics. The Mecklenburg County school bus fleet has by far the largest number of buses of any of the 100... Date Added: 2009-02-17 22:57:29 |
| FunMath4.pdf - Part 15 Path: Kent State >> MATH >> 10034 Fall, 2008 Description: 7) 32 5 = (a 7) 32 86 CHAPTER 2. RATIONAL EXPRESSIONS AND FUNCTIONS 6t + 2 9t2 1 25 10 2x2 + 3x 5 x2... Date Added: 2009-01-11 16:27:07 |
| MIT-CSAIL-TR-2008-010.pdf?sequence=1 - Part 15 Path: DeAnza College >> ENGR >> 010 Winter, 2008 Description: atives to new public policy options for regulating an increase in resilience above current requirements and the factors... Date Added: 2009-02-02 14:03:58 |
| Frey_Eichenberger_1997.pdf - Part 16 Path: N.C. State >> WWW4 >> 4 Fall, 2007 Description: As an approximation, we assume for the sake of calculation that the diesel portion of the fleet accounts for mileage tot... Date Added: 2009-02-17 22:57:29 |
| FunMath4.pdf - Part 16 Path: Kent State >> MATH >> 10034 Fall, 2008 Description: 5 x+5 x(x + 5) = (x 5)(x + 5) and 3 3 x 5 = x+5 x+5 x 5 = 3(x 5) . (x 5)(x + 5) b. We must rst... Date Added: 2009-01-11 16:27:07 |
| MIT-CSAIL-TR-2008-010.pdf?sequence=1 - Part 16 Path: DeAnza College >> ENGR >> 010 Winter, 2008 Description: may serve as a model for other regions. A key component of this business model is that patients would have access to the... Date Added: 2009-02-02 14:03:58 |
| Frey_Eichenberger_1997.pdf - Part 17 Path: N.C. State >> WWW4 >> 4 Fall, 2007 Description: l as the long vehicle length impaired the ability of the RSD equipment to record useful data. Data collection was furthe... Date Added: 2009-02-17 22:57:29 |
| FunMath4.pdf - Part 17 Path: Kent State >> MATH >> 10034 Fall, 2008 Description: both expressions on the same side of the equation, combining them is a simple matter, since they have the same denominat... Date Added: 2009-01-11 16:27:07 |
| MIT-CSAIL-TR-2008-010.pdf?sequence=1 - Part 17 Path: DeAnza College >> ENGR >> 010 Winter, 2008 Description: two for the price of one deal. Fourth, RHIOs could ostensibly solve an information asymmetry problem among providers... Date Added: 2009-02-02 14:03:58 |
| Frey_Eichenberger_1997.pdf - Part 18 Path: N.C. State >> WWW4 >> 4 Fall, 2007 Description: . For example, the implementation of magnet schooling in Wake County has dramatically affected school bus routing. It is... Date Added: 2009-02-17 22:57:29 |
| FunMath4.pdf - Part 18 Path: Kent State >> MATH >> 10034 Fall, 2008 Description: 1) (x + 1)(x 1) 3 = (x + 1)(x 1) x+1 x 1 x 1 3 x = (x + 1)(x 1) (x + 1)(x 1)... Date Added: 2009-01-11 16:27:07 |
| MIT-CSAIL-TR-2008-010.pdf?sequence=1 - Part 18 Path: DeAnza College >> ENGR >> 010 Winter, 2008 Description: l and harder to manage than a centralized approach because of its increased complexity and the requirement of every prov... Date Added: 2009-02-02 14:03:58 |
| Frey_Eichenberger_1997.pdf - Part 19 Path: N.C. State >> WWW4 >> 4 Fall, 2007 Description: d by a large grassy median. This stretch of roadway was very suitable for RSD measurements due to its limited access and... Date Added: 2009-02-17 22:57:29 |
| FunMath4.pdf - Part 19 Path: Kent State >> MATH >> 10034 Fall, 2008 Description: ND INEQUALITIES 115 ANSWERS TO PRACTICE PROBLEMS 1. y = 4 2. t = 7 3. (a) no real solutions 2 (b) ( , 0) 0... Date Added: 2009-01-11 16:27:07 |
| MIT-CSAIL-TR-2008-010.pdf?sequence=1 - Part 19 Path: DeAnza College >> ENGR >> 010 Winter, 2008 Description: project Indivo, described previously, was selected to test DHT performance. Indivo is one architecture that would be one... Date Added: 2009-02-02 14:03:58 |
| Frey_Eichenberger_1997.pdf - Part 20 Path: N.C. State >> WWW4 >> 4 Fall, 2007 Description: rating conditions must be considered if vehicle emission factors are to be derived from the RSD measurements. It is nece... Date Added: 2009-02-17 22:57:29 |
| FunMath4.pdf - Part 20 Path: Kent State >> MATH >> 10034 Fall, 2008 Description: ven as a unit rate. However, it is customary to express interest rates as percentages rather than as unit rates. The ter... Date Added: 2009-01-11 16:27:07 |
| MIT-CSAIL-TR-2008-010.pdf?sequence=1 - Part 20 Path: DeAnza College >> ENGR >> 010 Winter, 2008 Description: server ran out of memory. For the DHash operations, the experiment was performed with 5 nodes and with 18 nodes. Replica... Date Added: 2009-02-02 14:03:58 |
| Frey_Eichenberger_1997.pdf - Part 21 Path: N.C. State >> WWW4 >> 4 Fall, 2007 Description: ists of many thousands of different 48 hydrocarbons. Each of the constituent hydrocarbons that make up the crude oil... Date Added: 2009-02-17 22:57:29 |
| FunMath4.pdf - Part 21 Path: Kent State >> MATH >> 10034 Fall, 2008 Description: know that rate is de ned to be the distance traveled over the time elapsed. In symbols, d r= . t We can solve this for... Date Added: 2009-01-11 16:27:07 |
| MIT-CSAIL-TR-2008-010.pdf?sequence=1 - Part 21 Path: DeAnza College >> ENGR >> 010 Winter, 2008 Description: hat smaller files containing text information could be still be retrieved without the entire patient record. Also, the w... Date Added: 2009-02-02 14:03:58 |
| Frey_Eichenberger_1997.pdf - Part 22 Path: N.C. State >> WWW4 >> 4 Fall, 2007 Description: s that gasoline must possess a minimum ([RON] + [MON])/2 of 87 (Ref. 40 CFR, Part 80), although exceptions are made for... Date Added: 2009-02-17 22:57:29 |
| FunMath4.pdf - Part 22 Path: Kent State >> MATH >> 10034 Fall, 2008 Description: g would it take Todd alone? 34. Maggie can mow the school lawn in 4 hours. Seth can mow the same lawn in 3 hours. How lo... Date Added: 2009-01-11 16:27:07 |
| MIT-CSAIL-TR-2008-010.pdf?sequence=1 - Part 22 Path: DeAnza College >> ENGR >> 010 Winter, 2008 Description: iform rules and therefore will inevitably have some negative consequences. The goal should be, of course, for the positi... Date Added: 2009-02-02 14:03:58 |
| Frey_Eichenberger_1997.pdf - Part 23 Path: N.C. State >> WWW4 >> 4 Fall, 2007 Description: ane cis-2-Butene 3-Methyl-1-butene Isopentane 1-Pentane Pentane 2-Methyl-1-butene 5-Methylnonane 4-Methylnonane trans-2-... Date Added: 2009-02-17 22:57:29 |
| FunMath4.pdf - Part 23 Path: Kent State >> MATH >> 10034 Fall, 2008 Description: ational expression 7. NOT a rational expression 9. rational expression 11. 5 ? = 105, so ? = 21 13. 0 ? = 81; no solut... Date Added: 2009-01-11 16:27:07 |
| MIT-CSAIL-TR-2008-010.pdf?sequence=1 - Part 23 Path: DeAnza College >> ENGR >> 010 Winter, 2008 Description: nce; the recommendations are the means for implementing those goals. As the recommendations are further shown to be feas... Date Added: 2009-02-02 14:03:58 |
| Frey_Eichenberger_1997.pdf - Part 24 Path: N.C. State >> WWW4 >> 4 Fall, 2007 Description: pipelines and other transport methods. Antioxidants are added to increase the storage life. Corrosion inhibitors, anti-i... Date Added: 2009-02-17 22:57:29 |
| MIT-CSAIL-TR-2008-010.pdf?sequence=1 - Part 24 Path: DeAnza College >> ENGR >> 010 Winter, 2008 Description: 46. 47. 48. 49. 50. 51. 52. 53. 54. 55. 56. 57. Tang, P.C., et al., Personal Health Records: Definitions, Benefits,... Date Added: 2009-02-02 14:03:58 |
| Frey_Eichenberger_1997.pdf - Part 25 Path: N.C. State >> WWW4 >> 4 Fall, 2007 Description: . 4-DA diesel is a lower quality blend of distillates, compared to 1-DA and 2-DA diesel, which is used for low speed eng... Date Added: 2009-02-17 22:57:29 |
| MIT-CSAIL-TR-2008-010.pdf?sequence=1 - Part 25 Path: DeAnza College >> ENGR >> 010 Winter, 2008 Description: t of a disruption, which processes are automated and which are manual? (Circle manual OR automated for each.) 1) Applica... Date Added: 2009-02-02 14:03:58 |
| Frey_Eichenberger_1997.pdf - Part 26 Path: N.C. State >> WWW4 >> 4 Fall, 2007 Description: nt fuel Weight 100 lb of fuel Carbon 86 12 7.17 Hydrogen 14 1 14.00 lbmole per lbmole C 1.00 1.95 In general, we assume... Date Added: 2009-02-17 22:57:29 |
| MIT-CSAIL-TR-2008-010.pdf?sequence=1 - Part 26 Path: DeAnza College >> ENGR >> 010 Winter, 2008 Description: VARIABLEPREFIX(BLOCKSIZE); } //finish up the last write int remainingBytes = databyteArlength % VARIABLEPREFIX(BLOCKSIZE... Date Added: 2009-02-02 14:03:58 |
| Frey_Eichenberger_1997.pdf - Part 27 Path: N.C. State >> WWW4 >> 4 Fall, 2007 Description: or conservation of carbon and hydrogen atoms must be modified to account for the undetected hydrocarbons: Element Carbon... Date Added: 2009-02-17 22:57:29 |
| MIT-CSAIL-TR-2008-010.pdf?sequence=1 - Part 27 Path: DeAnza College >> ENGR >> 010 Winter, 2008 Description: chordByteAr, 0); char * chordChars = (char *) chordBytes; char * strChordID = getChordIDstr(chordChars); //extract char\'... Date Added: 2009-02-02 14:03:58 |
| Frey_Eichenberger_1997.pdf - Part 28 Path: N.C. State >> WWW4 >> 4 Fall, 2007 Description: l Bus Emissions Estimates The emissions data were analyzed several different ways to provide insights regarding variabi... Date Added: 2009-02-17 22:57:29 |
| Frey_Eichenberger_1997.pdf - Part 29 Path: N.C. State >> WWW4 >> 4 Fall, 2007 Description: ed the grams per mile emission factors is illustrated in Figure 6-1. These data clearly indicate that, on average, diese... Date Added: 2009-02-17 22:57:29 |
| Frey_Eichenberger_1997.pdf - Part 30 Path: N.C. State >> WWW4 >> 4 Fall, 2007 Description: rvals with that of Bus No. 2802. As the overlap becomes greater, the significance level of the t-test increases. For exa... Date Added: 2009-02-17 22:57:29 |
| Frey_Eichenberger_1997.pdf - Part 31 Path: N.C. State >> WWW4 >> 4 Fall, 2007 Description: ile) Bus No. 83 Bus No. 86 Bus No. 89 Bus No. 98 Bus No. 119 Bus No. 235 Bus No. 266 Bus No. 381 Bus No. 523 Bus No. 594... Date Added: 2009-02-17 22:57:29 |
| Frey_Eichenberger_1997.pdf - Part 32 Path: N.C. State >> WWW4 >> 4 Fall, 2007 Description: Chasis Year 92 93 94 95 96 97 Figure 6-13. Scatter Plot of Estimated Propane-Equivalent Hydrocarbon Emissions Versus Ch... Date Added: 2009-02-17 22:57:29 |
| Frey_Eichenberger_1997.pdf - Part 33 Path: N.C. State >> WWW4 >> 4 Fall, 2007 Description: ions for inbound and outbound diesel school buses assembled by Ford are shown in Figure 6-23 for CO and Figure 6-24 for... Date Added: 2009-02-17 22:57:29 |
| Frey_Eichenberger_1997.pdf - Part 34 Path: N.C. State >> WWW4 >> 4 Fall, 2007 Description: erval of approximately 25 to 100 g/gal. The sampling distribution for the mean based upon bootstrap simulation of a logn... Date Added: 2009-02-17 22:57:29 |
| Frey_Eichenberger_1997.pdf - Part 35 Path: N.C. State >> WWW4 >> 4 Fall, 2007 Description: example, the average CO emissions are uncertain by plus or minus 44 percent, and the average propane-equivalent hydrocar... Date Added: 2009-02-17 22:57:29 |
| Frey_Eichenberger_1997.pdf - Part 36 Path: N.C. State >> WWW4 >> 4 Fall, 2007 Description: for Calculated CO Emissions for Diesel Buses at the Garner site (n=5). 1.0 Cumulative Probability 0.8 0.6 0.4 0.2 0.0 0... Date Added: 2009-02-17 22:57:29 |
| Frey_Eichenberger_1997.pdf - Part 37 Path: N.C. State >> WWW4 >> 4 Fall, 2007 Description: to the TTA buses. The average emissions of the old RDU buses appear to be higher than for the TTA buses. However, a dire... Date Added: 2009-02-17 22:57:29 |
| Frey_Eichenberger_1997.pdf - Part 38 Path: N.C. State >> WWW4 >> 4 Fall, 2007 Description: d Fleet Average Uncertainty for Calculated Propane-Equivalent Hydrocarbon Emissions for Diesel TTA Buses (All Sites, n=3... Date Added: 2009-02-17 22:57:29 |
| Frey_Eichenberger_1997.pdf - Part 39 Path: N.C. State >> WWW4 >> 4 Fall, 2007 Description: 0.8 0.6 0.4 0.2 0.0 0 2 4 6 Calculated Propane-Equivalent Hydrocarbon Emissions (g/mi) 8 All New RDU Diesel Bus Measurem... Date Added: 2009-02-17 22:57:29 |
| Frey_Eichenberger_1997.pdf - Part 40 Path: N.C. State >> WWW4 >> 4 Fall, 2007 Description: nt data to satisfy statistical significance tests. Objectives (1) and (2) have motivated the bulk of the effort in this... Date Added: 2009-02-17 22:57:29 |
| Frey_Eichenberger_1997.pdf - Part 41 Path: N.C. State >> WWW4 >> 4 Fall, 2007 Description: med to be 4.5 miles per gallon, while the average fuel economy of diesel buses is assumed to be 7.6 miles per gallon. Fr... Date Added: 2009-02-17 22:57:29 |
| Frey_Eichenberger_1997.pdf - Part 42 Path: N.C. State >> WWW4 >> 4 Fall, 2007 Description: ts of data points for individual buses, and the Rock Quarry Road site also can yield information regarding approximately... Date Added: 2009-02-17 22:57:29 |
| Frey_Eichenberger_1997.pdf - Part 43 Path: N.C. State >> WWW4 >> 4 Fall, 2007 Description: arrendale, PA, pp. 72-82, 1993. Sargeant, K.A. (1994), \"Transportation Conformity Final Rule: Summary of Provisions and... Date Added: 2009-02-17 22:57:29 |
| lecture6handout.pdf Path: George Mason >> PHYS >> 103 Fall, 2008 Description: PHYSICS 103: Lecture 6 Agenda for Today: Explaining Motion Newtons 3 Laws Applications of Laws Inertia Question: If I throw a ball in the air, what causes it to keep moving? A Few Questions. Why does stamping your feet clean the snow off your ... Date Added: 2009-04-16 13:39:19 |
| lecture21.pdf Path: Berkeley >> CS >> 182 Spring, 2006 Description: Bayesian Networks a.k.a. belief nets, bayes nets CS182/CogSci110/Ling109 Spring 2007 Leon Barrett lbarrett@eecs.berkeley.edu Bayes Nets Representation of probabilistic information reasoning with uncertainty Example tasks Diagnose a disease fr... Date Added: 2009-04-16 13:39:26 |
| HSPICE.pdf Path: Berkeley >> EE >> 245 Fall, 2009 Description: HSPICE Solution for Linear Network Iteration for Nonlinear Network HSPICE Data Flow Netlist Structure Element Names Units and Scale Factors Node Naming Conventions .SUBCKT Statement Example: Sources Transient Sources - PULSE Transient Sou... Date Added: 2009-04-16 13:39:46 |
| lecture2.pdf Path: Berkeley >> EECS >> 170 Fall, 2006 Description: 7 24 c q B 80 C @ C 3E B 2 @ i 44E T H 0 q T c 8 @C 8 T H 3E Ph%rEpPHU%g%9GE UG)v v d3 9gdDmRFd3 2og4 daDFC n9AaoB 4 8 3 C 8 H 4E @4 v C 3 2 4E 2 c B 8 T B c 3 @4 CE ~ B @ 2 8 E @4 q c 7 2 H qC 84 0 3 44 8 dbPGUm9d8 9ar0r2q... Date Added: 2009-04-16 13:40:19 |
| EarlyChildoodDevelopPrg_LR.pdf Path: UNC Wilmington >> EDN >> 500 Fall, 2009 Description: The Effectiveness of Early Childhood Development Programs A Systematic Review Laurie M. Anderson, PhD, MPH, Carolynne Shinn, MS, Mindy T. Fullilove, MD, Susan C. Scrimshaw, PhD, Jonathan E. Fielding, MD, MPH, MBA, Jacques Normand, PhD, Vilma G. Caran... Date Added: 2009-04-16 13:41:56 |
| EarlyChildoodDevelopPrg_LR.pdf - Part 2 Path: UNC Wilmington >> EDN >> 500 Fall, 2009 Description: al for children who are at high developmental risk due to poverty. (CDC) provides core staff support to the Task Force... Date Added: 2009-04-16 13:41:56 |
| EarlyChildoodDevelopPrg_LR.pdf - Part 3 Path: UNC Wilmington >> EDN >> 500 Fall, 2009 Description: school programs designed to increase social competence in children, aged 3 to 5 years, at risk because of family poverty... Date Added: 2009-04-16 13:41:56 |
| EarlyChildoodDevelopPrg_LR.pdf - Part 4 Path: UNC Wilmington >> EDN >> 500 Fall, 2009 Description: readiness. All three studies demonstrated increases in school readiness for students enrolled in an early childhood deve... Date Added: 2009-04-16 13:41:56 |
| EarlyChildoodDevelopPrg_LR.pdf - Part 5 Path: UNC Wilmington >> EDN >> 500 Fall, 2009 Description: ations of disadvantaged preschool children. Other Positive or Negative Effects Neither the systematic review developmen... Date Added: 2009-04-16 13:41:56 |
| EarlyChildoodDevelopPrg_LR.pdf - Part 6 Path: UNC Wilmington >> EDN >> 500 Fall, 2009 Description: ional Institutes of Health has called for integrated sociobehavioral and biomedical research,57 and an example of this k... Date Added: 2009-04-16 13:41:56 |
| EarlyChildoodDevelopPrg_LR.pdf - Part 7 Path: UNC Wilmington >> EDN >> 500 Fall, 2009 Description: in, MD, MBA, Bayou La Batre Rural Health Clinic, Bayou La Batre, Alabama; David Chavis, PhD, Association for the Study a... Date Added: 2009-04-16 13:41:56 |
| EarlyChildoodDevelopPrg_LR.pdf - Part 8 Path: UNC Wilmington >> EDN >> 500 Fall, 2009 Description: f Head Start in the Philadelphia school district. Washington, DC: U.S. Department of Health and Human Services; Of ce... Date Added: 2009-04-16 13:41:56 |
| c2e3s02.pdf Path: UNC Wilmington >> CHM >> 102 Fall, 2009 Description: CHM-102 Name Exam III Spring 2002 Raw Score T-Score You will have one hour to complete the exam. There is one best answer to each question and all questions are worth the same number of points. Sign your name on the answer sheet above the G... Date Added: 2009-04-16 13:42:12 |
| isec_resistance_renewal.pdf Path: Berkeley >> EPS >> 80 Spring, 2008 Description: Building Local Food Systems, Globally Effective action involves both RESISTANCE and RENEWAL. Addressing todays most pressing problems requires two different kinds of actions: those that resist the process of globalization, and those that help renew l... Date Added: 2009-04-16 13:42:22 |
| isec_resistance_renewal.pdf - Part 2 Path: Berkeley >> EPS >> 80 Spring, 2008 Description: hat is laced with toxic chemicals, raised in monocultures, and injected with engineered hormones. If you want to avoid t... Date Added: 2009-04-16 13:42:22 |
| Section3-8.pdf Path: UNC Wilmington >> MAT >> 161 Spring, 2009 Description: A Modular Presentation System for the Calculus Sequence 3.8 Derivatives of Logarithmic Functions Yaw Chang Michael Freeze Mathematics and Statistics UNC-Wilmington 3.8 Derivatives of Logarithmic Functions - p. 1/9 Derivatives of Log Functions Deri... Date Added: 2009-04-16 13:42:26 |
| lauer78.pdf Path: Berkeley >> CS >> 262 Fall, 2008 Description: Because the original of the following paper by Lauer and Needham is not widely available, we are reprinting it here. If the paper is referenced in published work, the citation should read: \"Lauer, H.C., Needham, R.M., \"On the Duality of Operating Sys... Date Added: 2009-04-16 13:42:31 |
| lauer78.pdf - Part 2 Path: Berkeley >> CS >> 262 Fall, 2008 Description: ponds to one of the models, and which are coupled by explicit interface mechanisms. Most of the remaining systems are so... Date Added: 2009-04-16 13:42:31 |
| lauer78.pdf - Part 3 Path: Berkeley >> CS >> 262 Fall, 2008 Description: o forever; [m, i, p] - WaitForMessage[s]; case p of poitl =>...; -algorithm for poitl port2 =>... if resourceExhausted... Date Added: 2009-04-16 13:42:31 |
| lauer78.pdf - Part 4 Path: Berkeley >> CS >> 262 Fall, 2008 Description: n the queue associated with that condition variable. SIGNAL condition Variable -- This causes a process which has previo... Date Added: 2009-04-16 13:42:31 |
| lauer78.pdf - Part 5 Path: Berkeley >> CS >> 262 Fall, 2008 Description: or synchronization facilities which are very different from those of our canonical model, then the transformation must b... Date Added: 2009-04-16 13:42:31 |
| lauer78.pdf - Part 6 Path: Berkeley >> CS >> 262 Fall, 2008 Description: or a pre-emption due to an external event, then the other model can do exactly the same in response to the dual circumst... Date Added: 2009-04-16 13:42:31 |
| lauer78.pdf - Part 7 Path: Berkeley >> CS >> 262 Fall, 2008 Description: us he normally faced with having to build the most reasonable set of primitives he can without incurring large computati... Date Added: 2009-04-16 13:42:31 |
| BVPs.pdf Path: UNC Wilmington >> MAT >> 463 Fall, 2009 Description: 4 Boundary Value Problems 4.1 Introduction Until this point we have solved initial value problems. For an initial value problem one has to solve a dierential equation subject to conditions on the unknown function and its derivatives at one value of ... Date Added: 2009-04-16 13:42:35 |
| ch7figtran.pdf Path: UNC Wilmington >> CSC >> 221 Fall, 2009 Description: A n I n t r o d u c t i o n t o O O P w i t h J a v a Chapter 7 Repetition Statements OBJECTIVES After you have read and studied this chapter, you should be able to Implement repetition control in a program using while statements. Implement r... Date Added: 2009-04-16 13:42:38 |
| midterm97.pdf Path: Berkeley >> EE >> 121 Fall, 2009 Description: Name: _ UNIVERSITY OF CALIFORNIA College of Engineering Department of Electrical Engineering and Computer Sciences Professor David Tse 11 March 1997 EECS 121 MIDTERM Problem 1 (10 points) True or False Scoring= +2 for correct answer with explan... Date Added: 2009-04-16 13:43:26 |
| infant-see_grants_2009.pdf Path: Berkeley >> AWARDS >> 2009 Fall, 2009 Description: $5,000 STUDENT GRANT & $2,500 STUDENT GRANT 2009 InfantSEE Scholarship Grant Sponsored by Vision West, Inc. Administered by the Optometrys CharityTM The AOA Foundation Vision West, Inc. (VWI), a leading national ophthalmic product buying group, and... Date Added: 2009-04-16 13:43:59 |
| IPO_FundManagement_vFINAL.pdf Path: Berkeley >> SS >> 2012 Fall, 2009 Description: Student Systems 2012 FUND MANAGMENT Input Process Output PACKAGING Award Review (part of the simulations process) 1. 2. 3. 4. 5. 6. Download award budgets and summary expenditures Create reports by award type and funds (FAO Annual Reports) Compare a... Date Added: 2009-04-16 13:44:21 |
| lecture02.pdf Path: Berkeley >> CS >> 278 Fall, 2008 Description: U.C. Berkeley CS278: Computational Complexity Professor Luca Trevisan Handout N2 1/24/2008 Notes for Lecture 2 This lecture is on boolean circuit complexity. We rst dene circuits and the function they compute. Then we consider families of circuits... Date Added: 2009-04-16 13:44:34 |
| hw10solutions.pdf Path: Berkeley >> MATH >> 121 Fall, 2009 Description: Math 121b - Mathematical Tools for the Physical Sciences Instructor: J. Metcalfe Due: March 6, 2007 Assignment 10 1. Find the solution of the heat conduction problem u 1 u 1 r = , r r r k t 0 < r < a, 0 < t, u(a, t) = T0 , u(r, 0) = T1 . The bounda... Date Added: 2009-04-16 13:45:30 |
| lec02-structures.pdf Path: Berkeley >> CS >> 162 Fall, 2008 Description: Review: What does an Operating System do? CS162 Operating Systems and Systems Programming Lecture 2 History of the World Parts 15 Operating Systems Structures January 23, 2006 Prof. Anthony D. Joseph http:/inst.eecs.berkeley.edu/~cs162 Silerschatz... Date Added: 2009-04-16 13:46:27 |
| Econ182_2005_Spring_MT_Obstfeld.pdf Path: Berkeley >> ECON >> 182 Fall, 2008 Description: ... Date Added: 2009-04-16 13:49:38 |
| resh7.pdf Path: Berkeley >> BIO >> 1 Fall, 2000 Description: Biology 1B, Ecology Lecture 7, Page 1 *Assigned readings, 5th Edition pp. 1118-1126 6th Edition pp. 1186-1195 Communities Outline of Lecture 7 A. Views of communities B. Coevolution C. If there are so many herbivores why are there any plants left? D.... Date Added: 2009-04-16 13:51:02 |
| Lab10.pdf Path: Berkeley >> EE >> 105 Fall, 2009 Description: UNIVERSITY OF CALIFORNIA AT BERKELEY College of Engineering Department of Electrical Engineering and Computer Sciences EE105 Lab Experiments Experiment 10: Dierential Ampliers 1 Objective Dierential ampliers are designed to amplify the dierence be... Date Added: 2009-04-16 13:52:26 |
| features04_diseases.pdf Path: Berkeley >> ISSUE >> 15 Fall, 2009 Description: Neglected No More: Image courtesy of Laboratoire de Biologie Parasitaire, Paris Tropical disease research at UC Berkeley by Niranjana Nagarajan An early drawing of trypanosomes by French microbiologist (and Nobel Prize-winner) Alphonse Laveran. YO... Date Added: 2009-04-16 13:55:30 |
| BA102A_2004_Fall_MT3_na.pdf Path: Berkeley >> BA >> 102 Fall, 2009 Description: ... Date Added: 2009-04-16 13:56:33 |
| Jung2002_Power_Control_MACAdhoc.pdf Path: UCF >> EEL >> 5937 Fall, 2008 Description: B W B q BW D B T S 9 D B T SW A P A P I B 8 B t A v r b ` i I A ` 5 ` veGyE0s!GHhepEyuQsA 5 l B 6 P I7 B D B 6 T t I7 ... Date Added: 2009-04-16 13:58:09 |
| ch3.pdf Path: UCF >> UI >> 54 Fall, 2009 Description: 1 Fall, 2000 Name: 22C:54, section 2 Programming Language Concepts Test on EOPL Chapter 3 This test has 5 questions and pages numbered 1 through 7. Reminders For this test, you can use one (1) page (8.5 by 11 inches, one (1) side, no less than ... Date Added: 2009-04-16 13:59:31 |
| stat210a_lecture_04.pdf Path: Berkeley >> STAT >> 210 Fall, 2009 Description: STAT 210A: Theoretical Statistics Fall 2006 Lecture 4 September 7 Lecturer: Martin Wainwright Scribe: Robert Gibbons Warning: These scribe notes have only been mildly proofread. 4.1 Minimal Suciency A given problem can admit many sucient stati... Date Added: 2009-04-16 14:04:26 |
| CS263-6.2.pdf Path: Berkeley >> CS >> 263 Fall, 2009 Description: CS263|Spring 2008 Topic 2: Type Theory Section 6.2: Type Semantics III Dana S. Scott Hillman University Professor (Emeritus) School of Computer Science Carnegie Mellon University = Visiting Professor EECS Visiting Scientist Logic & Methodology Progra... Date Added: 2009-04-16 14:05:21 |
| H5.pdf Path: Berkeley >> ECON >> 161 Fall, 2008 Description: Economics 202a, Fall 1998 Lecture 7: Government in the Ramsey Model Adding government to the model: Assume that the government buys output at rate G per unit of effective labor. Assume that government purchases do not affect utility from private con... Date Added: 2009-04-16 14:07:05 |
| Lab1-Requirements-Fall08.ppt Path: UCF >> COP >> 4331 Fall, 2009 Description: Lab1 C+ Warmup with Pet Applicatioin Cop 4331 and EEL4884 Dr. David A. Workman School of EE and Computer Science University of Central Florida September 5, 2008 Problem Statement Write a C+ application for modeling \"pets\" those furry animals call... Date Added: 2009-04-16 14:08:56 |
| Lab1-Requirements-Fall08.ppt - Part 2 Path: UCF >> COP >> 4331 Fall, 2009 Description: b1 Deliverables 1. 2. 3. Source files for the Pet Application (PetError.h, PetError.cpp, PetApp.cpp, Pet.h, Pet.cpp, Cat... Date Added: 2009-04-16 14:08:56 |
| SM1_solar-powered-system.pdf Path: UCF >> K >> 12 Fall, 2009 Description: Solar Matters I Solar Powered System Student Objective The student: understands that light energy from the Sun can be turned into electricity with a photovoltaic (solar) cell. knows variables such as clouds, shading and direction of panel tilt, tha... Date Added: 2009-04-16 14:11:48 |
| FM1_STEU_Trend_IDPUTVac1.pdf Path: Berkeley >> FM >> 1 Fall, 2009 Description: STE-U FM1 Performance Trend Test Pulser STE-U Temp 22 Premap Temp IDPU Temp 27.4 ISTEUCur (mA) 19 Door Open (sec) Door Close (sec) Offset Gain Curv. Thresh. (keV) (keV/Bin) (1/keV) 8 -0.02 0.3847 1.32E-04 9 -0.03 0.3841 1.46E-04 8 -0.02 0.3837 1.48E-... Date Added: 2009-04-16 14:12:19 |
| FM1_STEU_Trend_IDPUTVac1.pdf Path: Berkeley >> FM >> 3 Fall, 2009 Description: STE-U FM1 Performance Trend Test Pulser STE-U Temp 22 Premap Temp IDPU Temp 27.4 ISTEUCur (mA) 19 Door Open (sec) Door Close (sec) Offset Gain Curv. Thresh. (keV) (keV/Bin) (1/keV) 8 -0.02 0.3847 1.32E-04 9 -0.03 0.3841 1.46E-04 8 -0.02 0.3837 1.48E-... Date Added: 2009-04-16 14:12:19 |
| 0500409.pdf Path: Berkeley >> ICIP >> 2007 Fall, 2009 Description: Coding Artifacts Robust Resolution Up-conversion Ling Shao, Hao Hu, Gerard de Haan Philips Research Europe, High Tech Campus 36, Eindhoven, The Netherlands ABSTRACT In this paper, an integrated resolution up-conversion and compression artifacts remov... Date Added: 2009-04-16 14:13:08 |
| 0500409.pdf - Part 2 Path: Berkeley >> ICIP >> 2007 Fall, 2009 Description: to a specific class and their corresponding pixels in the reference images are accumulated, and the optimal coefficients... Date Added: 2009-04-16 14:13:08 |
| 0500409.pdf - Part 3 Path: Berkeley >> ICIP >> 2007 Fall, 2009 Description: ails, which cannot be recovered by the up-scaling step. 5. CONCLUSION In this paper, an integrated coding artifact reduc... Date Added: 2009-04-16 14:13:08 |
| ISF100eHumRights.pdf Path: Berkeley >> ISF >> 100 Fall, 2008 Description: Freedom in Practice - Human Rights in War and Peace International human rights is the worlds first universal ideology. (Weissbrodt/OToole, 17) IHR have natural law origins: a law higher than the positive laws of states (W/OT, 17); See Terry Nardin... Date Added: 2009-04-16 14:13:15 |
| 13-MidtermReviewx2.pdf Path: Berkeley >> EE >> 122 Spring, 2006 Description: EECS 122: Midterm Review Computer Science Division Department of Electrical Engineering and Computer Sciences University of California, Berkeley Berkeley, CA 94720-1776 EECS F05 Outline Layering and End-to-End Argument Little Theorem Routing: ... Date Added: 2009-04-16 14:14:34 |
| assignment4_overview.pdf Path: Berkeley >> I >> 202 Fall, 2009 Description: SIMS 202 TEACHING TEAM SIMS 202 PHONE PROJECT ASSIGNMENT 4 Photo Metadata Design September 25, 2003 0. DOCUMENT SUMMARY 1. INTRODUCTION 2. PART 1 METADATA DESIGN 3. PART 2 METDATA REVISION 4. PART 3 PHOTO ANNOTATION 1. INTRODUCTION Assignment ... Date Added: 2009-04-16 14:14:50 |
| Ex1-06.pdf Path: Berkeley >> IB >> 245 Fall, 2009 Description: ... Date Added: 2009-04-16 14:17:03 |
| assignment6.pdf Path: Berkeley >> I >> 202 Fall, 2009 Description: Please place a hardcopy of your assignment in Prof. Hearst\'s mailbox in the oce on the rst oor, or else bring a hardcopy to class on Tuesday November 25th. There are four questions in total. Due Wednesday November 26 SIMS 202 Assignment 6 Practice... Date Added: 2009-04-16 14:18:58 |
| lect17-3x2.pdf Path: Berkeley >> CS >> 61 Fall, 2004 Description: CS61B Lecture #17 Administrative: Simple Banking I: Accounts Problem: Want a simple banking system. Can look up accounts by name or number, deposit or withdraw, print. Account Structure class Account { Account (String name, String number, int init) ... Date Added: 2009-04-16 14:19:44 |
| handout090121.pdf Path: Berkeley >> EE >> 239 Spring, 2009 Description: THE MICROELECTRONICS REVOLUTION 1 Transistors/chip doubling every 1 2 2 years since 1959 500,000-fold decrease in cost for the same performance In 20 years one computer as powerful as all those in Silicon Valley today CMOS transistors with 4 nm ... Date Added: 2009-04-16 14:20:23 |
| rec1405p6.pdf Path: MTSU >> REC >> 1405 Fall, 2009 Description: Kennon Sports Hall of Fame lauded Architects bestow design honor, citing complexity and vibrancy by Gina K. Logue he Tennessee Chapter of the American Institute of Architects has bestowed its highest honor, the Award of Excellence, on Tuck Hinton Arc... Date Added: 2009-04-16 14:20:44 |
| 2010_L4-L5_Examples.pdf Path: MTSU >> PHYS >> 2010 Summer, 2008 Description: ... Date Added: 2009-04-16 14:21:00 |
| Exam_2_Review_F06.pdf Path: MTSU >> MTSU >> 32 Fall, 2009 Description: Biology 1110 Exam 2 Review Sheet Numerical Data Know the difference between Numerical Data (measuring) and Categorical Data (counting) Be able to define/describe the following terms: Mean numerical average of a set of numbers Median middle val... Date Added: 2009-04-16 14:21:54 |
| 04_01_2008_math239.pdf Path: Berkeley >> MATH >> 239 Spring, 2008 Description: Math 239: Discrete Mathematics for the Life Sciences Spring 2008 Lecture 17 April 01 Lecturer: Anne Shiu Scribe/ Editor: Shaowei Lin/ Maria Cueto 17.1 Toric Dynamical Systems I Todays lecture is the rst in a series of two lectures by Anne Shiu ... Date Added: 2009-04-16 14:22:03 |
| rec1705_p7.pdf Path: MTSU >> REC >> 1705 Fall, 2009 Description: Jazz Age exhibit celebrates grand opening this month by Lisa L Rollins E ntering the Modern Era: Murfreesboros Jazz Age, an expanded exhibit, is now on display at the Heritage Center of Murfreesboro and Rutherford County. Supported by the Center fo... Date Added: 2009-04-16 14:22:34 |
| standev.pdf Path: MTSU >> MTSU >> 32 Fall, 2009 Description: MC 6110 Understanding mean, variance, and standard deviation By Kenneth R. Blake, Ph.D. Means, variances, and standard deviations are all statistics used to describe distributions of interval- or ratio-level data. SPSS for Windows will automatically ... Date Added: 2009-04-16 14:22:46 |
| standev.pdf Path: MTSU >> MTSU >> 611 Fall, 2009 Description: MC 6110 Understanding mean, variance, and standard deviation By Kenneth R. Blake, Ph.D. Means, variances, and standard deviations are all statistics used to describe distributions of interval- or ratio-level data. SPSS for Windows will automatically ... Date Added: 2009-04-16 14:22:46 |
| enroll.pdf Path: MTSU >> PROFILES >> 07 Fall, 2009 Description: Fall 2007 Enrollment of Full-Time and Part-Time Students by Classification and Gender Full-Time Students Male Student Classification Freshmen Sophomores Juniors Seniors Undergraduate Special Sub-Total Undergraduate Graduate Special Master\'s Education... Date Added: 2009-04-16 14:23:15 |
| rec1623_p7.pdf Path: MTSU >> REC >> 1623 Fall, 2009 Description: McNair Scholars June 12 blastoff launches research by Randy Weiler he McNair Scholars Program will blast off toward its July 3031 summer destination with the McNair Blastoff, which will be held from 1 to 3 p.m. Thursday, June 12, in the James Union B... Date Added: 2009-04-16 14:23:21 |
| odyssey.pdf Path: Berkeley >> IPN >> 3 Fall, 2009 Description: The Astrophysical Journal Supplement Series, 164:124129, 2006 May # 2006. The American Astronomical Society. All rights reserved. Printed in U.S.A. MARS ODYSSEY JOINS THE THIRD INTERPLANETARY NETWORK K. Hurley University of California, Berkeley, Spa... Date Added: 2009-04-16 14:23:27 |
| Errata.pdf Path: University of Illinois, Urbana Champaign >> CS >> 446 Fall, 2008 Description: CS446: Pattern Recognition and Machine Learning Spring 2006 StatPrimer Errata Handed Out: February 8, 2006 This document details errata for parts (5) and (6) of StatPrimer Version 6.2 by B. Burt Gerstman at http:/www2.sjsu.edu/faculty/gerstman/Stat... Date Added: 2009-04-16 14:24:20 |
| SNoW.pdf Path: University of Illinois, Urbana Champaign >> L >> 2 Fall, 2009 Description: SNoW: Sparse Network of Winnows Presented by Nick Rizzolo Cognitive Computations Software Tutorial 8/25/05 Page 1 Introduction Multi-class classification Infinite attribute domain User configurable linear threshold unit networks Variety of updat... Date Added: 2009-04-16 14:24:29 |
| Ashnai2005_MeDeScBa2002.pdf Path: University of Illinois, Urbana Champaign >> CS >> 598 Fall, 2008 Description: Discrete DifferentialGeometry Operators for Triangulated 2-Manifolds Mark Meyer, Mathieu Desbrun, Peter Schroder, and Alan H. Barr Presented by Shadi Ashnai Overview Motivation Definitions Derive differential geometry operators Accuracy analysis Gen... Date Added: 2009-04-16 14:26:38 |
| hw1_2005.pdf Path: University of Illinois, Urbana Champaign >> CS >> 598 Fall, 2008 Description: CS 598 ANH - Calculus on Meshes Department of Computer Science, University of Illinois at Urbana-Champaign Fall 2005, Instructor : Anil N. Hirani Homework 1 Due : Tuesday, September 20, 2005 by end of class time. Problem 1: (Analysis) Consider R a... Date Added: 2009-04-16 14:26:39 |
| 20-MoreTextureMapping.pdf Path: University of Illinois, Urbana Champaign >> CS >> 418 Fall, 2008 Description: Texture Aliasing Recall the simple texture application method we discussed at each pixel we interpolate the correct texture coordinate and we retrieve the corresponding texel can lead to nasty aliasing Why is this? Consider mapping of pixel to tex... Date Added: 2009-04-16 14:27:20 |
| mp4.pdf Path: University of Illinois, Urbana Champaign >> CS >> 4 Fall, 2009 Description: MP 4 User Dened Datatypes and Recursion CS 421 Fall 2008 Revision 1.0 Assigned September 23, 2008 Due September 30, 2008 23:59 Extension 48 hours (20% penalty) 1 Change Log 1.1 Problem 13 example xed, problem 11 brackets now visible 1.0 Initial ... Date Added: 2009-04-16 14:28:44 |
| mp4.pdf Path: University of Illinois, Urbana Champaign >> CS >> 421 Spring, 2008 Description: MP 4 User Dened Datatypes and Recursion CS 421 Fall 2008 Revision 1.0 Assigned September 23, 2008 Due September 30, 2008 23:59 Extension 48 hours (20% penalty) 1 Change Log 1.1 Problem 13 example xed, problem 11 brackets now visible 1.0 Initial ... Date Added: 2009-04-16 14:28:45 |
| xapp463.pdf Path: University of Illinois, Urbana Champaign >> ECE >> 412 Spring, 2008 Description: Application Note: Spartan-3 FPGA Family R Using Block RAM in Spartan-3 FPGAs XAPP463 (v1.1.2) July 23, 2003 Summary For applications requiring large, on-chip memories, Spartan-3 FPGAs provides plentiful, efficient SelectRAM memory blocks. Using va... Date Added: 2009-04-16 14:30:28 |
| lecture17.pdf Path: University of Illinois, Urbana Champaign >> ECE >> 390 Fall, 2008 Description: Lecture 17 Fun with Graphics Dr. Dimitrios S. Nikolopoulos CSL/UIUC Lecture outline Bresenhams Line Drawing Algorithm Bresenhams Circle Drawing Algorithm Alpha blending ECE291 Lecture 17 2 Drawing Lines Basic Algorithm We want to draw line Y=m... Date Added: 2009-04-16 14:31:09 |
| lecture14_6pps.pdf Path: University of Illinois, Urbana Champaign >> ECE >> 390 Fall, 2008 Description: Outline Color theory Video Hardware Mode 13h Graphics File Formats Lecture 14 Graphics Dr. Dimitrios S. Nikolopoulos CSL/UIUC ECE291 Lecture 14 2 Color theory TVs, Computer Monitors, Projectors Its all Red, Green, Blue Why RGB? These are th... Date Added: 2009-04-16 14:31:16 |
| PS06.pdf Path: University of Illinois, Urbana Champaign >> ECE >> 313 Fall, 2008 Description: University Problem Set #6 ECE 313 of Illinois Page 1 of 3 Summer 2003 Assigned: Thursday, July 17 Due: Thursday, July 24 Reading: Ross Chapters 5.1-5.7, 9.1 Problems: 1. Let the random variable ID denote the indicator function of an event D, that is,... Date Added: 2009-04-16 14:31:29 |
| PS13.pdf Path: University of Illinois, Urbana Champaign >> ECE >> 313 Fall, 2008 Description: University of Illinois Spring 2008 ECE 313: Problem Set 13 Functions of Random Variables, Conditional Densities, Correlation and Covariance, Minimum-Mean-Square-Error Estimation This Problem Set contains ve problems Due: Reading: Noncredit exercise... Date Added: 2009-04-16 14:31:29 |
| DSAdatasheet.pdf Path: University of Illinois, Urbana Champaign >> ECE >> 486 Spring, 2008 Description: Agilent Technologies 35670A Dynamic Signal Analyzer Technical Specifications Versatile two- or four-channel high-performance FFT-based spectrum/network analyzer 122 Hz to 102.4 hHz 16-bit ADC Key Specifications Frequency Range Dynamic Range Accura... Date Added: 2009-04-16 14:31:38 |
| intro.pdf Path: University of Illinois, Urbana Champaign >> ECE >> 512 Fall, 2008 Description: UIUC ECE 512 Course Introduction Wen-mei Hwu ECE University of Illinois, Urbana-Champaign UIUC ECE 512 Computer Microarchitecture: Hardware and Software 2005, Wen-mei W. Hwu, All Rights Reserved. IMPACT Outline Syllabus www.crhc.uiuc.edu/ece411 ... Date Added: 2009-04-16 14:31:43 |
| syllabus.pdf Path: University of Illinois, Urbana Champaign >> CI >> 436 Fall, 2008 Description: CI 401 M: Computer and Mathematics Education (The Role of Technology in the Secondary Mathematics Classroom) Fall Semester, 2008 Wednesdays 12-2:50pm Location: 505 E. Green Street Room 201 Instructor: Adam Poetzel Office: Education 309 Office hours: ... Date Added: 2009-04-16 14:32:23 |
| example-T13.pdf Path: University of Illinois, Urbana Champaign >> MATH >> 348 Fall, 2008 Description: Latex Example 1.1 - Math 348 Karen Mortensen and revised by GF November 13, 2007 Abstract Twas brillig and the slithy toves did gyre and gymble in the wabe all mimsy were the burogoves and the mome raths outgrabe. Theorem. For all real numbers x and... Date Added: 2009-04-16 14:33:19 |
| h19.pdf Path: University of Illinois, Urbana Champaign >> ECE >> 359 Fall, 2009 Description: ECE 359 Handout # 19 HOMEWORK ASSIGNMENT 10 Reading: Handouts 18, 20 Due Date: May 6, 2003 (in class) Spring 2003 April 24, 2003 1. Let s(t) and r(t) be two signals that are both non-zero only on the interval [0, T ]. Suppose we correlate these two... Date Added: 2009-04-16 14:33:54 |
| S19.pdf Path: University of Illinois, Urbana Champaign >> CS >> 232 Fall, 2008 Description: Introduction to I/O Where does the data for our CPU and memory come from or go to? Computers communicate with the outside world via I/O devices. Input devices supply computers with data to operate on. Results of computations can be sent to output... Date Added: 2009-04-16 14:34:23 |
| F25a.pdf Path: University of Illinois, Urbana Champaign >> CS >> 232 Fall, 2008 Description: (Easily) Exposing Thread-level Parallelism Previously, we introduced Multi-Core Processors and the (atomic) instructions necessary to handle data races Today, a simple approach to exploiting one kind of parallelism. Data vs. Control Parallelism ... Date Added: 2009-04-16 14:34:41 |
| ThurstonDeborahUCS06.pdf Path: University of Illinois, Urbana Champaign >> UCS >> 2006 Fall, 2009 Description: Department of Industrial and Enterprise Systems Engineering Complex System Workshop May 18, 2006 Deborah L. Thurston Interim Department Head, Industrial and Enterprise systems Engineering Co-Director, Hoeft Technology and Management Program Universi... Date Added: 2009-04-16 14:35:36 |
| Week6solns.pdf Path: University of Illinois, Urbana Champaign >> PHYS >> 100 Fall, 2008 Description: PHYS 100 Discussion Session 6 Newtons Second & Third Laws Week 07 The Plan This week we use Newtons Third Law ( FA on B = FB on A ) to relate the forces between two different objects. We can use this principle, along with Newtons Second Law ( Fnet... Date Added: 2009-04-16 14:38:14 |
| Assignment2_activation.pdf Path: University of Illinois, Urbana Champaign >> PSYC >> 331 Fall, 2008 Description: Assignment 2 Name:_ ID:_ Grade:_/10_ Part 1 (4 points): Build a three-node network in which each node has a connection strength of 1.0 to and from every other node except itself. Use the following input and activation functions: Nit = jwijAjt Ait = ... Date Added: 2009-04-16 14:38:46 |
| gendergap.pdf Path: University of Illinois, Urbana Champaign >> ECON >> 303 Fall, 2008 Description: Fact Where\'s My 26 Cents?\": Choices Explain Gender Wage Gap June, 1998, Published by Employment Policy Foundation The gender wage gap has come under periodic public scrutiny since the women\'s movement first gained momentum in the 1960s. M... Date Added: 2009-04-16 14:39:14 |
| gendergap.pdf - Part 2 Path: University of Illinois, Urbana Champaign >> ECON >> 303 Fall, 2008 Description: to 5 percent for men.10 In fact, the median annual earnings of men and women age 25 to 34 with bachelor\'s degrees in the... Date Added: 2009-04-16 14:39:14 |
| charm2008tut_BigSim.pdf Path: University of Illinois, Urbana Champaign >> CHARMWORKS >> 2008 Fall, 2009 Description: BigSim Tutorial Presented by Eric Bohm Charm+ Workshop 2008 Parallel Programming Laboratory University of Illinois at Urbana-Champaign Charm+ Workshop 2008 Outline Overview BigSim Emulator Charm+ on the Emulator Simulation framework Post-mortem simu... Date Added: 2009-04-16 14:45:02 |
| h5stat-spec.pdf Path: University of Illinois, Urbana Champaign >> HDF >> 5 Fall, 2009 Description: RFC: h5stat tool Elena Pourmal, Quincey Koziol, John Mainzer June 4, 2006 Version 0.3 1. Purpose of this document This is a proposal for a tool to report different statistics on an HDF5 file and on objects in the file. 2. Motivation While working on... Date Added: 2009-04-16 14:45:36 |
| rec1620_p3.pdf Path: MTSU >> REC >> 1620 Fall, 2009 Description: April 26 ceremony honors 7 educators exemplary efforts by Lisa L. Rollins T he Tennessee Teachers Hall of Fame will induct seven new members during its annual induction ceremony and banquet beginning at 5:30 p.m. Saturday, April 26, in the Tennesse... Date Added: 2009-04-16 14:46:08 |
| GoldshlackLetter.pdf Path: University of Illinois, Urbana Champaign >> CBRAUER >> 1 Fall, 2009 Description: ... Date Added: 2009-04-16 14:46:36 |
| GoldshlackLetter.pdf Path: University of Illinois, Urbana Champaign >> CBRAUER >> 2 Fall, 2009 Description: ... Date Added: 2009-04-16 14:46:36 |
| project10_design_review.pdf Path: University of Illinois, Urbana Champaign >> ECE >> 445 Spring, 2008 Description: Wireless Energy Measurement Sensors Design Review ECE 445 Senior Design Spring 2007 Steven Choi Ehsan Safavinejad I Introduction This project is the basic requirements for a device that will be integrated into the Attested Metering Project curre... Date Added: 2009-04-16 14:47:08 |
| hw2.pdf Path: University of Illinois, Urbana Champaign >> CS >> 173 Fall, 2008 Description: CS 173, Spring 2009 Homework 2 Due in class on Friday, February 13th, 2009 (Total point value: 50 points.) 1. [8 points] Primes (a) Express the numbers 350, 105, and 64 as products of primes. (b) Compute GCD(350, 105), GCD(105, 64), and LCM(350, 64).... Date Added: 2009-04-16 14:47:16 |
| hw12-solutions.pdf Path: University of Illinois, Urbana Champaign >> CS >> 12 Fall, 2009 Description: CS 173: Discrete Mathematical Structures, Fall 2008 Homework 12 Solutions 1. [10 points] Planar graphs (a) Show that this graph is planar by redrawing it without crossings: E Solution: A C A C E D B D B (b) Suppose that G is an undirected conn... Date Added: 2009-04-16 14:47:46 |
| hw12-solutions.pdf Path: University of Illinois, Urbana Champaign >> CS >> 173 Fall, 2008 Description: CS 173: Discrete Mathematical Structures, Fall 2008 Homework 12 Solutions 1. [10 points] Planar graphs (a) Show that this graph is planar by redrawing it without crossings: E Solution: A C A C E D B D B (b) Suppose that G is an undirected conn... Date Added: 2009-04-16 14:47:46 |
| comp444_aug04.pdf Path: University of Illinois, Urbana Champaign >> AUG >> 04 Fall, 2009 Description: ... Date Added: 2009-04-16 14:52:29 |
| hw5.pdf Path: University of Illinois, Urbana Champaign >> ASTRO >> 100 Fall, 2009 Description: WebCT Quiz Page 1 of 7 WebCT Quiz Page 2 of 7 Homework #5 Name: Leslie Looney (Preview) Number of Questions: 20 Finish Help Save answer Question 4: (5 points) The surface of the Sun near its edge appears dimmer and cooler than at the center of ... Date Added: 2009-04-16 14:55:07 |
| photojournal.pdf Path: University of Illinois, Urbana Champaign >> UP >> 260 Fall, 2008 Description: East St. Louis A Photographic Account Friday 18th October 2002 On the way down to East St. Louis we discussed what we were expecting the city to look like, and what we would be doing over the weekend. The general opinion amongst the group was that t... Date Added: 2009-04-16 14:55:19 |
| lect4-images.pdf Path: University of Illinois, Urbana Champaign >> CS >> 414 Fall, 2008 Description: CS 414 Multimedia Systems Design Lecture 4 Digital Image Representation Klara Nahrstedt Spring 2008 CS 414 - Spring 2008 Administrative Ad i i t ti Group Directories will be established by Friday, 1/25 y, MP1 will be out on 1/25 CS 414 - Spring ... Date Added: 2009-04-16 14:56:38 |
| S17.pdf Path: University of Illinois, Urbana Champaign >> CS >> 232 Fall, 2008 Description: How big is the cache? For a byte-addressable machine with 16-bit addresses with a cache with the following characteristics: It is direct-mapped (as discussed last time) Each block holds one byte The cache index is the four least significant bits T... Date Added: 2009-04-16 14:56:39 |
| S17.pdf - Part 2 Path: University of Illinois, Urbana Champaign >> CS >> 232 Fall, 2008 Description: 13 in a 4-block, 2-byte per block cache. The block address is 13 / 2 = 6, so the index is then 6 mod 4 = 2.... Date Added: 2009-04-16 14:56:39 |
| S17.pdf - Part 3 Path: University of Illinois, Urbana Champaign >> CS >> 232 Fall, 2008 Description: ecently used block, just like before. For highly associative caches, it s expensive to keep track of what s r... Date Added: 2009-04-16 14:56:39 |
| Surveillance-Infocom2006.pdf Path: University of Illinois, Urbana Champaign >> LLUO >> 2 Fall, 2009 Description: Achieving Long-Term Surveillance in VigilNet Tian He , Pascal Vicaire, Ting Yan, Qing Cao , Gang Zhou, Lin Gu, Liqian Luo , Radu Stoleru, John A. Stankovic, Tarek F. Abdelzaher Department of Computer Science University of Virginia, Charlottesville 22... Date Added: 2009-04-16 14:56:52 |
| PATH560_MR_Error.pdf Path: University of Illinois, Urbana Champaign >> VP >> 560 Fall, 2009 Description: Error and Data Security in Spatial Data and Analysis Presentation overview Error terms and concepts Accuracy and precision Positional and attribute error Relative and absolute error Examples Scale and spatial data issues MAUP Ecological fallacy Ac... Date Added: 2009-04-16 14:59:55 |
| exam2sol.pdf Path: University of Illinois, Urbana Champaign >> ECE >> 567 Fall, 2008 Description: Solutions to ECE 567 Exam 2 Fall 2006 1. (5 points) Consider the continuous-time Markov process with the transition rate diagram shown. Identify all possible values of (a, b, c) R3 which make the process reversible. + 1 1 a b 1 3 c 1 2 SOLUTION T... Date Added: 2009-04-16 15:02:30 |
| Overview-Summary-of-MA.pdf Path: University of Illinois, Urbana Champaign >> EDPSY >> 494 Fall, 2009 Description: Edpsych/Soc 584 & Psych 594 C.J.Anderson Overview/Summary of Multivariate Procedures: PCA = principal components analysis, CCA = canonical correlation analysis, MANOVA = multivariate analysis of variances, and DA = (linear) discriminant analysis. Mul... Date Added: 2009-04-16 15:05:20 |
| comp580_jan05.pdf Path: University of Illinois, Urbana Champaign >> JAN >> 05 Fall, 2009 Description: ... Date Added: 2009-04-16 15:05:49 |
| 15-maxflow.pdf Path: University of Illinois, Urbana Champaign >> CS >> 473 Fall, 2008 Description: CS 473G Lecture 15: Maximum Flows and Minimum Cuts Fall 2005 15 Maximum FlowsRoss [1955]: Schematic Figure 2of the Cuts (November 10) and Minimum railway network of the Western SoFrom Harris and diagram viet Union and Eastern European countries, ... Date Added: 2009-04-16 15:07:09 |
| Lab2_TTL_Logic.pdf Path: University of Illinois, Urbana Champaign >> PHYS >> 405 Fall, 2009 Description: University of Illinois at Urbana-Champaign Digital Electronics Laboratory Physics Department Physics 405 Laboratory Experiment 2: TTL Digital Logic Contents 1. Introduction -2. Introduction to Discrete Logic Circuits -3. TTL Integrated Circuits -... Date Added: 2009-04-16 15:08:32 |
| 6713_dsk_techref.pdf Path: University of Illinois, Urbana Champaign >> GE >> 423 Spring, 2008 Description: TMS320C6713 DSK Technical Reference 2003 DSP Development Systems TMS320C6713 DSK Technical Reference 506735-0001 Rev. A May 2003 SPECTRUM DIGITAL, INC. 12502 Exchange Drive, Suite 440 Stafford, TX. 77477 Tel: 281.494.4505 Fax: 281.494.5310 sales... Date Added: 2009-04-16 15:09:01 |
| 6713_dsk_techref.pdf Path: University of Illinois, Urbana Champaign >> GE >> 6713 Fall, 2009 Description: TMS320C6713 DSK Technical Reference 2003 DSP Development Systems TMS320C6713 DSK Technical Reference 506735-0001 Rev. A May 2003 SPECTRUM DIGITAL, INC. 12502 Exchange Drive, Suite 440 Stafford, TX. 77477 Tel: 281.494.4505 Fax: 281.494.5310 sales... Date Added: 2009-04-16 15:09:01 |
| swickcorn.pdf Path: Cincinnati >> ACTIVITIES >> 2007 Fall, 2009 Description: SWICK CORN Grows Fast Reduces food shortage around the world by decreasing the amount of time it takes to grow and increasing the corn production thus making more. Corn grows faster helping farmers make more money. Reduces crops being damaged in bad... Date Added: 2009-04-16 15:09:42 |
| project22_final_paper.pdf Path: University of Illinois, Urbana Champaign >> ECE >> 445 Spring, 2008 Description: Voice-Isolating Wireless Communication Design By Alexander Joo Ryo Kondo Frank Lam ECE 445, SENIOR DESIGN PROJECT SPRING 2008 TA: Anthony Mangogni April 29, 2008 Project No. 22 ABSTRACT Unwanted manmade noises that impede voice communication a... Date Added: 2009-04-16 15:09:59 |
| CSIMM_Supplement.pdf Path: Cincinnati >> EH >> 3 Fall, 2009 Description: Supplemental Information Bayesian context-specific infinite mixture model for clustering of gene expression profiles across diverse microarray datasets Xiangdong Liu, Siva Sivaganesan, Ka Yee Yeung, Junhai Guo, Roger Bumgarner, Mario Medvedovic* *Mar... Date Added: 2009-04-16 15:10:20 |
| E2up.ICIBlockade.Complete.BrInsensitive_BarPlot.pdf Path: Cincinnati >> EH >> 3 Fall, 2009 Description: Prss8 8 0 2 4 6 1 Control 2 E2 3 ICI 4 Br Krt28 0 2 4 6 8 10 1 Control 2 E2 3 ICI 4 Br Slc18a1 0 1 2 3 4 5 6 7 1 Control 2 E2 3 ICI 4 Br Pkig 0 2 4 6 8 1 Control 2 E2 3 ICI 4 Br Psen1 0 2 4 6 1 Control 2 E... Date Added: 2009-04-16 15:10:27 |
| Li07_AGUmono.pdf Path: University of Illinois, Urbana Champaign >> GEO >> 593 Fall, 2009 Description: GM01018_CH11.qxd 6/8/07 9:10 PM Page 1 Electronic Transitions and Spin States in the Lower Mantle Jie Li Department of Geology, University of Illinois, Urbana, Illinois The spin state of iron in the predominant lower mantle phases perovskite, it... Date Added: 2009-04-16 15:11:27 |
| p306.pdf Path: University of Illinois, Urbana Champaign >> CS >> 04 Fall, 2009 Description: Research Track Paper Probabilistic Author-Topic Models for Information Discovery Department of Cognitive Sciences University of California, Irvine Irvine, CA 92697-5100, USA Mark Steyvers msteyver@uci.edu Department of Computer Science University... Date Added: 2009-04-16 15:12:36 |
| p306.pdf Path: University of Illinois, Urbana Champaign >> CS >> 591 Fall, 2008 Description: Research Track Paper Probabilistic Author-Topic Models for Information Discovery Department of Cognitive Sciences University of California, Irvine Irvine, CA 92697-5100, USA Mark Steyvers msteyver@uci.edu Department of Computer Science University... Date Added: 2009-04-16 15:12:36 |
| Mathematica5.2LicenseUpdate.pdf Path: Cincinnati >> V >> 5 Fall, 2009 Description: UCit Instructional and Research Computing, Software Distribution Office, 303B Zimmer Hall, Cincinnati, OH 45221-0088. Phone: (513) 556 9068 Email: Software@uc.edu Mathematica 5.2 For Single-Machine License Platform: Windows Instruction Guide for Up... Date Added: 2009-04-16 15:16:14 |
| lecture9_math103.pdf Path: University of Illinois, Urbana Champaign >> M >> 103 Fall, 2009 Description: Math 103 Lecture 9 notes page 1 Math 103 Lecture 9 class notes Statistics from the Latin staticus out of state is the study of methods of collecting, organizing, presenting, analyzing, and drawing conclusions about data, commonly in numerical form... Date Added: 2009-04-16 15:17:49 |
| Atmos348Lecture17.pdf Path: University of Illinois, Urbana Champaign >> ATMOS >> 348 Fall, 2009 Description: ATMOS 348 Atmospheric Chemistry Lecture 17: Issues in Air Quality Don Wuebbles Mayurakshi Dutta Department of Atmospheric Sciences University of Illinois, Urbana-Champaign March 3, 2004 What are the major issues in Air Quality? Urban Air Pollution ... Date Added: 2009-04-16 15:18:05 |
| Lect25.pdf Path: University of Illinois, Urbana Champaign >> PHYS >> 212 Fall, 2008 Description: Physics 212 Lecture 25 Images & Mirrors Physics 212 Lecture 25, Slide 1 Music Who is the Artist? A) B) C) D) E) Ian Tyson Neil Young David Crosby Nils Lofgren Jack Nitzsche Physics 212 Lecture 25, Slide 2 Your thoughts: o cool! were actually doi... Date Added: 2009-04-16 15:19:11 |
| p296.pdf Path: University of Illinois, Urbana Champaign >> CS >> 04 Fall, 2009 Description: Research Track Paper Support Envelopes: A Technique for Exploring the Structure of Association Patterns Michael Steinbach Dept. of Comp. Sci. Eng. Michigan State University Vipin K... Date Added: 2009-04-16 15:19:58 |
| p296.pdf Path: University of Illinois, Urbana Champaign >> CS >> 591 Fall, 2008 Description: Research Track Paper Support Envelopes: A Technique for Exploring the Structure of Association Patterns Michael Steinbach Dept. of Comp. Sci. Eng. Michigan State University Vipin K... Date Added: 2009-04-16 15:19:58 |
| Kreja.pdf Path: University of Illinois, Urbana Champaign >> FISHERFORU >> 2004 Fall, 2009 Description: Changes in Spatial Patterns of Urban Consumption in Post-Socialist Cities: New Large-Scale Retail Development in Warsaw Karina Kreja School of Architecture Edinburgh College of Art United Kingdom Grassmarket Campus EH1 2HJ, Edinburgh tel.: (+44) 131... Date Added: 2009-04-16 15:21:07 |
| =PCB50003REVC_SCHEM.pdf Path: University of Illinois, Urbana Champaign >> ECE >> 114 Fall, 2009 Description: POWER BRD. TO SIGNAL COND. HEADER_2X10_MALE 1 ILSENSE+ ILSENSE- 2 3 VCSENSE+ 4 VCSENSE5 VINSENSE+ VINSENSE- 6 8 10 12 14 16 18 20 7 9 11 13 15 17 19 U1 R5 500 3 6 1 SIGNAL COND. TO DSP R42 600 +12V HEADER_2X10_MALE ILSENSE C45 0.01 C18 5 ADCINA0 A... Date Added: 2009-04-16 15:22:17 |
| guestcs3234.pdf Path: University of Illinois, Urbana Champaign >> CS >> 3234 Fall, 2009 Description: Page 1 Types and Logic (CS3234 Guest Lecture) Martin Sulzmann Page 2 Outline You are familiar with logic. What about types? Types systems are nothing else than a particular kind of formal system. Types are really great! Page 3 Recall: Formal Sy... Date Added: 2009-04-16 15:24:16 |
| work2.pdf Path: University of Illinois, Urbana Champaign >> MATH >> 347 Fall, 2008 Description: Worksheet 2, Math 347, Friday, February 15, 2008 Prof. Eugene Lerman 1 Which of the following relations are equivalence relations? Justify your answer. That is, check the three conditions. a. Fix an integer n = 0. Dene a relation on Z by x y if a... Date Added: 2009-04-16 15:25:32 |
| ML04_Outlines.pdf Path: Wichita State >> ML >> 04 Fall, 2009 Description: CS 898O : Machine Learning Course Outlines Instructor: Name: Email: Office: Telephone: Office Hours: Dr. Sattiraju Prabhakar prabhakar@cs.wichita.edu Jabara Hall, Room 241 (316)978-3928 WTh: 3:30PM 4:30PM, Other times by prior appointment Graduate ... Date Added: 2009-04-16 15:30:55 |
| HW4SP03sol.pdf Path: University of Illinois, Urbana Champaign >> ECE >> 475 Fall, 2008 Description: ECE 375 / Bioen 375 Modeling of Biological Systems Homework #4 Solutions Spring 2003 Prof. Wheeler A. The Vestibular Response Use Robinson\'s first order transfer function to model the output of the vestibular (semi-circular canal) sTc R apparatus.... Date Added: 2009-04-16 15:31:02 |
| PHYSICS_598PB_Syllabus.pdf Path: University of Illinois, Urbana Champaign >> PHYS >> 598 Fall, 2008 Description: PHYSICS 598 PB Physical Biology: From Single Molecules to Systems Biology Spring Semester 2006 Time: TuTh, 9:00-10:20 AM Call Number: Physics 36792 Room: 158 Loomis Office Hour: Thursday 10:30 AM-Noon at 133 Loomis. Professor Taekjip Ha (tjha@uiuc.... Date Added: 2009-04-16 15:32:23 |
| lecture04.pdf Path: University of Illinois, Urbana Champaign >> AE >> 526 Fall, 2008 Description: ... Date Added: 2009-04-16 15:32:43 |
| CP4.pdf Path: Wichita State >> P >> 2 Fall, 2009 Description: D GS CP4 PSEUDORIEMANNIAN 2-STEP NILPOTENT LIE GROUPS Luis A. Cordero1 Dept. Xeometr e Topolox a a Facultade de Matemticas a Universidade de Santiago 15706 Santiago de Compostela Spain cordero@zmat.usc.es Phillip E. Parker2 Mathematics Department W... Date Added: 2009-04-16 15:33:37 |
| 19-midterm-study.pdf Path: University of Illinois, Urbana Champaign >> CS >> 418 Fall, 2008 Description: CS 318: Midterm Study Guide Fall 2003 1 Lectures The following is the list of lectures covered by this midterm. See the class Web page http:/www-courses.cs.uiuc. edu/ cs318/lectures.html for copies of the lecture notes. Aug-27 Introduction Aug-29 Gr... Date Added: 2009-04-16 15:35:12 |
| week-4.pdf Path: Washington >> COM >> 546 Fall, 2009 Description: Overview Media, Computers and Society Kathy E. Gill 25 October 2005 Proposals (in brief) Discussion More diffusion theory Economics! Proposals Papers Reminder Remember - the three papers must include at least 15 academic citations Papers are evalu... Date Added: 2009-04-16 15:37:27 |
| hw4.pdf Path: Washington >> STAT >> 423 Winter, 2008 Description: STAT 423 Homework 4 Due Friday, January 30 This homework covers section 5.1 and 5.2 of your text. The first problem concerns an important theoretical property about simple linear regression. This will be reviewed in next weeks lab session. For the se... Date Added: 2009-04-16 15:38:18 |
| gravel.pdf Path: Washington >> OCEAN >> 542 Fall, 2009 Description: Gravel transport The addition of gravel tends to armor, or pave, the bed. That is, the upper surface of a bed takes on increasingly coarser particles. Experiments also confirm the hiding influence of coarse grains. That is, sand in flow is less mobil... Date Added: 2009-04-16 15:38:46 |
| HW05Solutions.pdf Path: Washington >> ATMS >> 101 Fall, 2009 Description: Name:_ Atmospheric Sciences 101 Homework #5 Due 7/29/2008 Possible Points: 27 1. Air Pressure In class, I performed the can crushing experiment. Describe how I was able to crush the can. (3 pts) When I boiled the water in the can, I effectively repl... Date Added: 2009-04-16 15:40:47 |
| supplement01.pdf Path: Washington >> B >> 540 Fall, 2009 Description: Regression Coecients Yanez, Spring 2004 1 Supplementary Notes I Linear Regression Model: Yi = 0 + 1xi + i , V [Yi | xi] = 2 i (0, 2) E[Yi | xi] = (xi) = 0 + 1xi Dene the linear predictor, i, to be i = 0 + 1xi . For the linear model, th... Date Added: 2009-04-16 15:41:21 |
| lecture-1.pdf Path: Washington >> MEBI >> 531 Fall, 2008 Description: MEDED 531: What we will learn In this class you will learn how to write and debug computer programs; how to organize data and knowledge into computable form. Why learn programming? Why learn programming, when all I want to do is run other peo... Date Added: 2009-04-16 15:42:44 |
| w08.prop.21.ppt Path: Washington >> A >> 503 Fall, 2009 Description: PROPERTY I: Lecture 21: Additions to Land Winter/Spring 2008 Professor Tom Andrews University of Washington School of Law 1 Board of Trustees v. Sand Key Assocs Who owns \"accretions\" to Sand Key caused by construction of a public jetty? Why? Is th... Date Added: 2009-04-16 15:43:56 |
| data_unsorted.txt Path: Washington >> CS >> 0708 Fall, 2009 Description: 23.081 254.41 60.45 187.35 97.785 45.224 1423.8 105.12 846.65 397.14 50.467 0 1140.6 87.169 366.82 89.309 836.69 753.49 789.9 303.39 275.78 115 19.92 57.641 366.82 847.42 113.22 464.95 1753.9 95.887 90.836 461.66 226 218.53 447.88 397.14 370.02 298.1... Date Added: 2009-04-16 15:44:08 |
| Lecture04W08.ppt Path: Washington >> BIOL >> 356 Fall, 2008 Description: Biology 356 Announcements: 1) 1) 3) Homework #3 is due today. Field Class #1 is due tomorrow. Homework #4 will be posted tonight and due next Tuesday. All sections meet at the Medicinal Herb Garden ( by bus shelter on Stevens Way) this Wednesday. 4)... Date Added: 2009-04-16 15:44:14 |
| mastin.ppt Path: Washington >> KELSO >> 06 Fall, 2009 Description: Watershed and River Management Program (WaRSMP) Description of Yakima River Basin and Yakima Storage Project MMS and Yakima River Basin models Global Climate-Change assumptions Comparison of Watershed simulationspresent versus GCC scenarios Mark Mast... Date Added: 2009-04-16 15:45:12 |
| 1140_weds_garfin.pdf Path: Washington >> CPASW >> 07 Fall, 2009 Description: CPAS Workshop March, 2007 Gregg Garfin CLIMAS/ISPE University of Arizona Arizona is developing climate services for drought through Multi-agency drought monitoring Engagement with resource management agencies Capacity building with the public De... Date Added: 2009-04-16 15:45:19 |
| 1140_weds_garfin.pdf Path: Washington >> CPASW >> 2 Fall, 2009 Description: CPAS Workshop March, 2007 Gregg Garfin CLIMAS/ISPE University of Arizona Arizona is developing climate services for drought through Multi-agency drought monitoring Engagement with resource management agencies Capacity building with the public De... Date Added: 2009-04-16 15:45:19 |
| bib.doc Path: Washington >> HST >> 498 Fall, 2009 Description: Selected Bibliography-Weimar Germany The literature on Weimar is vast and ever growing; below are some of the more often cited English language sources, though the list is by no means comprehensive. Peukert\'s The Weimar Republic, The Weimar Republic ... Date Added: 2009-04-16 15:46:09 |
| sp06_exam2_key.pdf Path: Washington >> MSIS >> 531 Fall, 2009 Description: MSIS 531 Spring 2006 MSIS 531 Final Spring 2006 Name: _ Exam notes: 1. Please put your name and student number above. 2. Please read the questions carefully. Point values for each problem are shown in parentheses. The exam has a total of 100 poin... Date Added: 2009-04-16 15:46:56 |
| sp06_exam2_key.pdf - Part 2 Path: Washington >> MSIS >> 531 Fall, 2009 Description: interferes with integrations? Briefly discuss how this problem is reduced with web services. Corporate firewalls can mak... Date Added: 2009-04-16 15:46:56 |
| ex_set2.pdf Path: Washington >> MSIS >> 531 Fall, 2009 Description: MSIS 531 Spring 2006 Exercise Set 2 This exercise set offers an opportunity to explore the MyPetstore project in NetBeans and MySQL. Setup: Ensure that both MySQL and NetBeans are started, then run the MyPetstore project and ensure that the start... Date Added: 2009-04-16 15:46:57 |
| paper3example.doc Path: Washington >> HIST >> 225 Fall, 2009 Description: The coming of Islam to the silk road overturned the old political institutions of the region and in the process facilitated the transmission of ideas from all corners of their empire and beyond. While many old ideas and institutions were discarded, o... Date Added: 2009-04-16 15:47:26 |
| git-prune-packed.txt Path: Washington >> GIT >> 1 Fall, 2009 Description: git-prune-packed(1) = NAME - git-prune-packed - Remove extra objects that are already in pack files SYNOPSIS - \'git-prune-packed\' [-n] [-q] DESCRIPTION - This program searches the `$GIT_OBJECT_DIR` for all objects that currently exist in a pack ... Date Added: 2009-04-16 15:48:03 |
| log.txt Path: Washington >> D >> 32 Fall, 2009 Description: = | COUPSM called with option 1: | | New MadEvent default \"G_mu scheme\" | = EW Params Input Output -- GF (10^-5*GeV^-2) 1.1664 * 1.1664 1/alpha 128.9000 132.5070 ... Date Added: 2009-04-16 15:48:31 |
| week06b_presentation.ppt Path: Washington >> MAT >> 084 Fall, 2009 Description: MAT 084 Week 6: 2nd Lecture More Problem Solving: Mixtures Chapter 3: Problem Solving 3.1 Further Problem Solving (#1) Mixtures (Type 1) Words of Wisdom Multiply across Add down Example #2 (GW 2a) You need 325 mL of a 50% chemical solution. On ... Date Added: 2009-04-16 15:49:36 |
| 8B_dictionaries.pdf Path: Washington >> GS >> 559 Winter, 2009 Description: One minute responses Not really sure how the loop, for, while, and zip work. I just need more practice problems to work on. More practice problems please! Comparing the dierent loops claried how they work. Is my love aair with while loops a da... Date Added: 2009-04-16 15:50:24 |
| large.txt Path: Washington >> GS >> 559 Winter, 2009 Description: >104K_THEPA 104 KD MICRONEME-RHOPTRY ANTIGEN MKFLILLFNILCLFPVLAADNHGVGPQGASGVDPITFDINSNQTGPAFLTAVEMAGVKYLQVQHGSNVNI HRLVEGNVVIWENASTPLYTGAIVTNNDGPYMAYVEVLGDPNLQFFIKSGDAWVTLSEHEYLAKLQEIRQ AVHIESVFSLNMAFQLENNKYEVETHAKNGANMVTFIPRNGHICKMVYHKNVRIYKATGNDTV... Date Added: 2009-04-16 15:50:24 |
| large.txt - Part 2 Path: Washington >> GS >> 559 Winter, 2009 Description: SRLIPSAASGDSKVFYLKMKGDYHRYLAE FKTGAERKEAAESTLSAYKAAQDIANAELAPTHPIRLGLALNFSVFYYEILNSPDRACNLANEAFDEAIA ELDTLEEESYKDSTLIMQL... Date Added: 2009-04-16 15:50:24 |
| large.txt - Part 3 Path: Washington >> GS >> 559 Winter, 2009 Description: 5\'REGION MTQDELYMKEAIKEAKKAEEKGEVPIGAVLVINGEIIARAHNLRETEQRSIAHAEMLVIDEACKALGTWR LEGATLYVTLEPCPMCAGAVVLSRVEKVVFGAFDPKGGCS... Date Added: 2009-04-16 15:50:24 |
| large.txt - Part 4 Path: Washington >> GS >> 559 Winter, 2009 Description: CDVGSDGRFLRGYRQD AYDGKDYIALNEDLRSWTAADMAAQITKRKWEAAHAAEQRRAYLEGTCVEWLRRYLENGKETLQRTDPPK THMTHHPISDHEATLRCWALGFYPAEITLTWQ... Date Added: 2009-04-16 15:50:24 |
| large.txt - Part 5 Path: Washington >> GS >> 559 Winter, 2009 Description: EVVGIKCLKNNAGLFCWMDLRPLLRESTFDSEMSLWRVIINDVKLNVSLGSSFECQEPGWFRVCFANMDD GTVDIALARIRRFVGVEKSGDKSSSMEKKQQWKKNNLRLSFSKRMYDES... Date Added: 2009-04-16 15:50:24 |
| large.txt - Part 6 Path: Washington >> GS >> 559 Winter, 2009 Description: VKINVSPGSSFHCTEPGWFRVCYANMD DMAVQIALQRIRNFVLQNKEIMVPNKKHCWHSNLRLSLKTRRFDDIMMSPHSPIPQSPLVKATI >1A1D_PSESP 1-AMINOCYCLOPR... Date Added: 2009-04-16 15:50:24 |
| large.txt - Part 7 Path: Washington >> GS >> 559 Winter, 2009 Description: ) A6601 ALPHA CHAIN PRECURSOR MAVMAPRTLVLLLSGALALTQTWAGSHSMRYFYTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRME PRAPWIEQEGPEYWDRNTR... Date Added: 2009-04-16 15:50:24 |
| large.txt - Part 8 Path: Washington >> GS >> 559 Winter, 2009 Description: STOCOMPATIBILITY ANTIGEN, B-14 B1401 ALPHA CHAIN PRECURSOR MLVMAPRTVLLLLSAALALTETWAGSHSMRYFYTSVSRPGRGEPRFISVGYVDDTQFVRFD... Date Added: 2009-04-16 15:50:24 |
| rob_winter_07_final_ans.doc Path: Washington >> FIN >> 350 Fall, 2008 Description: FINANCE 350, WINTER 2007 BUSINESS FINANCE Final Exam Name Formulas: r FV = PV 1 + m n*m INSTRUCTOR: ROBERT SCHONLAU LEWIS 212 VL = VU + PV (TS ) Costs PV (TS ) = rD D rD CF1 CF 2 CFt + + . + 2 (1 + r ) (1 + r ) (1 + r )t 1 1 PV (ordinary _ a... Date Added: 2009-04-16 15:50:49 |
| ch12.ppt Path: Washington >> ACCTG >> 302 Fall, 2008 Description: Intangible Assets Chapter 12 Intangible Assets: Concepts Definition Lack physical existence Not financial in nature At cost if purchased, often in a basket purchase Internally developed usually expensed Unless under contract for resale Dir... Date Added: 2009-04-16 15:53:20 |
| Division.doc Path: Washington >> GK >> 12 Fall, 2009 Description: Division: (It\'s All About) Grouping Name: _ Period: _ Date: _ NOTE: You MUST show all your work. Please write your work NEATLY. You may NOT use calculators to solve the following problems. Problem 1: Count the number of hearts. a) How many are there... Date Added: 2009-04-16 15:54:37 |
| CRS-EnvLaws.pdf Path: Washington >> ENVIR >> 497 Fall, 2008 Description: Order Code RL30798 CRS Report for Congress Received through the CRS Web Environmental Laws: Summaries of Statutes Administered by the Environmental Protection Agency Note: Does not address OPA Updated March 31, 2005 Susan Fletcher, Coordinator Sp... Date Added: 2009-04-16 15:55:08 |
| rev.pdf Path: Washington >> C >> 142 Fall, 2009 Description: ... Date Added: 2009-04-16 15:55:15 |
| Internet_Freedom_and_Innovation_at_Risk.pdf Path: Washington >> LIS >> 549 Fall, 2008 Description: American Civil Liberties Union : Internet Freedom and Innovation at Risk: Why Congres. Page 1 of 2 URL: http:/www.aclu.org/freespeech/internet/26829res20060922.html Internet Freedom and Innovation at Risk: Why Congress Must Restore Strong Net Neutr... Date Added: 2009-04-16 15:55:30 |
| Franklin6.pdf Path: Washington >> OCEAN >> 260 Fall, 2008 Description: ... Date Added: 2009-04-16 15:55:47 |
| prepOct03.pdf Path: Washington >> GS >> 55106 Fall, 2009 Description: GS351 Fall 2006 Prepartory Questions for Tuesday October 3rd Assigned readings: Jacob, F and J Monod (1961) Genetic Regulatory Mechanisms in the Synthesis of Proteins. J Mol Biol 3:318-356. Optional background readings: Alberts, 4th edition, Molecula... Date Added: 2009-04-16 15:56:45 |
| LaserTankProposal.pdf Path: Washington >> CSSIE >> 2001 Fall, 2009 Description: Proposal For LaserTank Game Chris Johnson CSS 450 Project Proposal Overview In this game the player controls a tank (LaserTank) in a struggle against invading robotic insects called RoboBugs. The player perspective is from directly overhead. The go... Date Added: 2009-04-16 15:57:46 |
| LaserTankProposal.pdf Path: Washington >> CSSIE >> 450 Fall, 2009 Description: Proposal For LaserTank Game Chris Johnson CSS 450 Project Proposal Overview In this game the player controls a tank (LaserTank) in a struggle against invading robotic insects called RoboBugs. The player perspective is from directly overhead. The go... Date Added: 2009-04-16 15:57:46 |
| P3182006HW3.pdf Path: Washington >> P >> 317 Fall, 2009 Description: Chapter 12 1 c) SSR = 360, dfI = 1 dfR = 1, MSI = 40 d) MSR = 360, F-Score = 3.6, F(1,36) = 4.113 e) SSC =160, df=1 MSC = 160 F-Score = 1.6 F(1,36) = 4.113 f) SSI = SSB SSR SSC = 560 360 160=40 = dfI = dfB dfR dfC = 3 -1-1 = 1 MSI = 40/1 = 40 F... Date Added: 2009-04-16 15:58:55 |
| Lecture7.pdf Path: Washington >> M >> 407 Fall, 2009 Description: ... Date Added: 2009-04-16 15:59:19 |
| HW2sec1_5no57.pdf Path: Washington >> M >> 308 Fall, 2009 Description: PROBLEM 57 OF 1.5 In this problem we are given a matrix P The assertion in the text is that if X is a vector whose entries are the 3 subscription numbers for Newspaper A, Newspaper B, and None, then the product P X will be the vector of subscription... Date Added: 2009-04-16 16:00:37 |
| intro.pdf Path: Washington >> MATH >> 111 Fall, 2008 Description: Introduction Course Overview Math 111: Algebra with Applications Mong Kon Mo June 18, 2007 Course Website: http:/www.math.washington.edu/mkmo/math111/ Math 111 Introduction to the Course Introduction Course Overview Instructor Mong Kon Mo mkm... Date Added: 2009-04-16 16:01:38 |
| intro.pdf - Part 2 Path: Washington >> MATH >> 111 Fall, 2008 Description: erview Testing Policies These apply to quizzes, midterms, and the final exam (except where indicated). You may use a s... Date Added: 2009-04-16 16:01:38 |
| Economic_impacts_WA.ppt Path: Washington >> ENVIR >> 100 Fall, 2008 Description: Most of the economic impacts in WA are caused by 1. Changes in the water cycle. 2. Heat waves. 3. Carbon fertilization of the atmosphere. 4. Invasive species and other pests. 0% 0% 0% 0% Heat waves. Changes in the water. Carbon fertilization of. a... Date Added: 2009-04-16 16:02:13 |
| 121soln_ch5.doc Path: Washington >> HW >> 121 Fall, 2009 Description: Chapter 5 Solutions Physics 121 5.1. Model: We can assume that the ring is a single massless particle in static equilibrium. Visualize: Solve: Written in component form, Newtons first law is ( Fnet ) x = Fx = T1x + T2 x + T3x = 0 N T1x = T1 T1y = ... Date Added: 2009-04-16 16:03:19 |
| simulink_tutorial.pdf Path: Washington >> AA >> 516 Fall, 2009 Description: Christopher Lum Autonomous Flight Systems Laboratory Updated: 11/01/06 Simulink Tutorial Introduction This document is designed to act as a tutorial for an individual who has had no prior experience with Simulink. It is assumed that the reader has a... Date Added: 2009-04-16 16:03:41 |
| lecture22june25.pdf Path: Washington >> MATH >> 135 Fall, 2008 Description: Outline: Lecture 22 (June 25) Sourav Sen Gupta Sections Covered We covered (partially / completely) the following sections from the text book. 3.6 7.4 Lecture topics in brief Extended CRT Review Recall: Extended CRT Statement How does it work ... Date Added: 2009-04-16 16:06:37 |
| StarkandRoberts.pdf Path: Washington >> SOC >> 316 Fall, 2008 Description: ... Date Added: 2009-04-16 16:06:47 |
| notes_Lecture01_05.ppt Path: Washington >> CHEM >> 152 Fall, 2008 Description: Lecture 1: Energy Reading: Zumdahl 9.1 Outline Energy: Kinetic and Potential System vs. Surroundings Heat, Work, and Energy Energy: Kinetic vs. Potential m Potential Energy (PE) Energy due to position or composition. Equals (mgh) in examp... Date Added: 2009-04-16 16:07:16 |
| NorthCreek_2008.pdf Path: Washington >> ESS >> 42608 Fall, 2009 Description: FIELD EXERCISE 2: EVOLUTION OF A MEANDER BEND Field Trip Date: 4 May 2008 Final Report Due: 27 May 2006 The objective of this exercise is to analyze the evolution of a meander bend. Meander bends are a common feature of channels formed by flowing wat... Date Added: 2009-04-16 16:07:34 |
| Meiklejohn_Litigation_Procedures.PPT Path: Washington >> B >> 599 Fall, 2009 Description: LITIGATION PROCEDURES IN THE UNITED STATES Transnational IP Program February 21, 2008 2.22.2008 | Transnational IP Program KEY ISSUES Jury Declaratory Judgment Jurisdiction Discovery Markman Hearing Trial Appeal 2.22.2008 | Transnational I... Date Added: 2009-04-16 16:08:58 |
| CH4sec6 Path: Georgia Tech >> ECE >> 2040 Spring, 2009 Description: Section 4-6 Mesh Current Analysis with Voltage and Current Sources P4.6-1 1 A 2 mesh 2: 75 i2 + 10 + 25 i2 = 0 mesh 1: i1 = i2 = - 0.1 A ib = i1 - i2 = 0.6 A (checked using LNAP 8/14/02) P4.6-2 mesh a: ia = - 0.25 A mesh b: ib = - 0.4 A vc = 100(i... Date Added: 2009-04-16 16:10:58 |
| lecture2_math103.pdf Path: University of Illinois, Urbana Champaign >> M >> 103 Fall, 2009 Description: Math 103 Lecture #2 notes The depressing thing about arithmetic badly taught is that it destroys a childs intellect and, to some extent his/her integrity. Before they are taught arithmetic, children will not give their assent to utter nonsense; after... Date Added: 2009-04-16 16:11:51 |
| 14Cancer.pdf Path: University of Illinois, Urbana Champaign >> IB >> 385 Fall, 2009 Description: Immunophenotype of B-cell chronic lymphocytic leukemia (B-CLL) and lymphomas that resemble it. Antigen slg CD5 CD19 CD20 CD22 CD23 CD79b FMC7 CD10 240 subtypes of leukemia B-CLL Weak + + + Weak or + Weak or low-grade Mantle Cell + + + + + + + aggress... Date Added: 2009-04-16 16:13:53 |
| 3.Cholesterol.pdf Path: Washington >> BIOC >> 441 Winter, 2008 Description: 3. Cholesterol rafts... Date Added: 2009-04-16 16:14:36 |
| Week9_HANDOUT-Crypsis-Marbles.doc Path: Washington >> BIO >> 480 Fall, 2009 Description: BIOL 480 Spring 2008 PREDATORS AND PREY: LOSING YOUR \"MARBLES\" Gaining resources is a part of every organism\'s life, and in predation one organism eats another. Among biotic interactions, predation is fundamental to understanding the distribution an... Date Added: 2009-04-16 16:15:45 |
| lec4.pdf Path: Washington >> CS >> 08 Fall, 2009 Description: CSE 525 Randomized Algorithms & Probabilistic Analysis Winter 2008 Lecture 4: January 16, 2008 Lecturer: James R. Lee Scribe: Bao-Nguyen Nguyen and Widad Machmouchi Disclaimer: These notes have not been subjected to the usual scrutiny reserved for... Date Added: 2009-04-16 16:15:58 |
| lec4.pdf Path: Washington >> CS >> 525 Fall, 2009 Description: CSE 525 Randomized Algorithms & Probabilistic Analysis Winter 2008 Lecture 4: January 16, 2008 Lecturer: James R. Lee Scribe: Bao-Nguyen Nguyen and Widad Machmouchi Disclaimer: These notes have not been subjected to the usual scrutiny reserved for... Date Added: 2009-04-16 16:15:59 |
| geyscase.pdf Path: Washington >> STAT >> 321 Winter, 2008 Description: ... Date Added: 2009-04-16 16:19:07 |
| solutionmidterm1.pdf Path: Washington >> M >> 124 Fall, 2009 Description: w u y kk q s qp u s \' d~ \'d 4 d 4 f 7 d 4 ) yp !l0(6~e#5$e6 k d~ 7 47 \"d \' d \' 7 gq 5\'!~g\'t0$ed#5$4f7ed64 \' d f 1 4 0 y10 14 12 16 18 20 2 6 8 s ( p d d | s... Date Added: 2009-04-16 16:20:58 |
| solutionmidterm1.pdf Path: Washington >> M >> 4 Fall, 2009 Description: w u y kk q s qp u s \' d~ \'d 4 d 4 f 7 d 4 ) yp !l0(6~e#5$e6 k d~ 7 47 \"d \' d \' 7 gq 5\'!~g\'t0$ed#5$4f7ed64 \' d f 1 4 0 y10 14 12 16 18 20 2 6 8 s ( p d d | s... Date Added: 2009-04-16 16:20:58 |
| giulio_seattle.ppt Path: Washington >> DMQC >> 3 Fall, 2009 Description: Delay-mode quality control of Argo float salinity data in the Tyrrhenian Sea Giulio Notarstefano OGS Trieste - Italy Third Argo Delay-Mode Quality Control Workshop (DMQC-3) University of Washington Seattle, Washington USA - September 10-12, 2008 ... Date Added: 2009-04-16 16:21:40 |
| hw2explanation.pdf Path: University of Illinois, Urbana Champaign >> BAILLIO >> 2 Fall, 2009 Description: BradBaillio PotentialFieldsHomework Introduction. Inthishomeworkassignmentweimplementedasearchalgorithmbasedonpotentialfields.Thisidea isanalogousto3dterrain.Obstaclesbecomepeaksandridgeswhilethegoalbecomesavalley.The robotthereforefollowsthedescendi... Date Added: 2009-04-16 16:23:02 |
| PasterisKelso.ppt Path: Washington >> KELSO >> 2001 Fall, 2009 Description: Tracking an Uncertain Climate for Water Supply Phillip Pasteris Natural Resources Conservation Service National Water and Climate Center Portland, Oregon www.wcc.nrcs.usda.gov Long-range Forecasting of Climate and Water Resources in the Pacific Nort... Date Added: 2009-04-16 16:23:03 |
| devore_chapter2.pdf Path: Washington >> SOC >> 504 Fall, 2008 Description: ... Date Added: 2009-04-16 16:25:16 |
| Titlepgs.pdf Path: University of Illinois, Urbana Champaign >> EPPLAN >> 05 Fall, 2009 Description: 2005 Emerson Park Neighborhood Revitalization Plan A collaborative effort between: The Emerson Park Development Corporation The East St. Louis Action Research Project Department of Urban and Regional Planning College of Fine and Applied Arts Univers... Date Added: 2009-04-16 16:28:19 |
| prob3_7.pdf Path: Washington >> MATH >> 120 Fall, 2008 Description: A yQ WbSP ` X cy c ` rS cQ q qS r W r BbP W X rPH h X WQH H r WQ Pb h ` X cP RpP)dipaxmud%a7)du)aaCmwafvRitwaaipPutdwS)Vkup)aadpyaauie BRitwX)#diwStfaER)pQ~RitduaaCpti)RxtwXxupcitkg)dipRadxT bP Wb F c U h P rH Pb Hb W BbP r S cQ q q S H XPQ... Date Added: 2009-04-16 16:30:31 |
| woodside-pmccs3.pdf Path: University of Illinois, Urbana Champaign >> PMCCS >> 3 Fall, 2009 Description: Performability Modeling for Multi-layered Service Systems C. M. Woodside Dept. of Systems and Computer Engineering Carleton University email:cmw@sce.carleton.ca Multi-layered Service Systems Distributed software is usually structured in layers, with... Date Added: 2009-04-16 16:31:33 |
| 10-03-03-lecture.pdf Path: Washington >> MATH >> 252 Fall, 2009 Description: 24 3. Modular SymbolsThese are 10/01/03 notes for Math 252 by William Stein. 3.3 Hecke Operators In this section we will only consider the modular curve X0 (N ) associated to the subgroup 0 (N ) of SL2 (Z) of matrices that are upper triangular modu... Date Added: 2009-04-16 16:32:54 |
| lecture20x4.pdf Path: University of Illinois, Urbana Champaign >> ASTRO >> 100 Fall, 2009 Description: Life Depends on the Sun Wind and weather Astronomy 100 Section 2 As Presented by Paul Ricker This class: The Sun II: Interior Liquid water Photosynthesis Human Cultural Acknowledgment of the Sun\'s Role Helioseismology Trapped sound waves refrac... Date Added: 2009-04-16 16:33:40 |
| book.taylorcreek.pdf Path: Washington >> OPEN >> 2100 Fall, 2009 Description: TAYLOR CREEK URBAN TAPESTRY Team Leader: Kent Scott Student Team Leader: Nicole Mikesh Team Members: Anita Lehmann, Dan Bertolet, Don Vehige, Iain Roberston, Ken Pirie, Michael McMasters, Micheal Lentz, Mieko DePippo, Nina Albert, Wilma Stordahl. ... Date Added: 2009-04-16 16:34:50 |
| aem547-a08-hw8.pdf Path: Washington >> AEM >> 547 Fall, 2009 Description: AA/EE/ME 547: Linear Systems Theory Homework #8 Due: Tuesday November 25, 11:30am 1. (5 pts) Determine the uncontrollable modes of each pair (A, B) given below by reducing (A, B) using a similarity transformation. 0 1 0 1 0 0 0 A = 0 -1 0 , B = ... Date Added: 2009-04-16 16:35:11 |
| SYLLF03_BE.doc Path: Washington >> BE >> 500 Fall, 2009 Description: UNIVERSITY OF WASHINGTON Graduate School of Business Administration BE 500 Office: Mackenzie 338, 543-4480 Email: erice@u.washington.edu Edward M. Rice Fall 2003 Office Hours: M 5-6 and by appt. Website :http:/www.faculty.washington.edu/erice Micro... Date Added: 2009-04-16 16:35:16 |
| Week6_Handout-Crabs.pdf Path: Washington >> BIO >> 480 Fall, 2009 Description: Bio 480 Spring 2008 HANDOUT: YELLOW SHORE CRABS Along the intertidal gradient, biological and physical forces determine where animals are located (Connell 1961). Some organisms have adapted to the harsh conditions of the upper intertidal where they ... Date Added: 2009-04-16 16:35:17 |
| day13-week7-Monday.ppt Path: Washington >> TC >> 310 Fall, 2009 Description: TC 310 The Computer in Technical Communication Dr. Jennifer Turns Week 7, Day 1 (5/12) Day 13 By the end of class, students should be able to: Identify lessons from the Robohelp assignment Explain the basic functionality provided by InDesign C... Date Added: 2009-04-16 16:35:55 |
| researchgrading.pdf Path: University of Illinois, Urbana Champaign >> ECE >> 316 Spring, 2008 Description: ECE/Philosophy 316 Final Research Paper [1] Thesis and Structure Thesis Statement and Outline 3: Strong introduction, with a clear thesis statement and a well-crafted outline. 2: Thesis stated, with a basic outline to guide the reader. 1: Inadequate ... Date Added: 2009-04-16 16:37:14 |
| vontobel.txt Path: University of Illinois, Urbana Champaign >> ALLERTON >> 05 Fall, 2009 Description: For assessing the performance of linear programming decoding it is necessary to know the minimal pseudo-codewords. In this talk we study the minimal pseudo-codewords of some Tanner graphs derived from projective planes and give estimates on their pse... Date Added: 2009-04-16 16:38:27 |
| Lecture3-2.pdf Path: University of Illinois, Urbana Champaign >> GEO >> 432 Fall, 2009 Description: Geol432 Mineralogy & Mineral Optics 3-2 Lecture 9/7/06 Compositional Variations in Minerals Objectives Polymorphs and isostructure Solid solutions Polymorphs and isostructure Depending on the pressure and temperature conditions, minerals with t... Date Added: 2009-04-16 16:39:25 |
| DataAcquisition_edited.pdf Path: Washington >> GEOG >> 463 Fall, 2008 Description: SEATTLE\'S CHANGING INCOME LANDSCAPE Data Acquisition Report Sarah Bengtson Jonathan Djajadi Jenny Lo Susan Louie Steven Mar Chris Praetorius Geography 463 Sections AA and AB 5 May 2006 1. Introduction Our team\'s data acquisition report is produced... Date Added: 2009-04-16 16:40:55 |
| State_National_v_Yates.pdf Path: Washington >> B >> 500 Fall, 2009 Description: Page 1 391 F.3d 577, *; 2004 U.S. App. LEXIS 23785, *; 59 Fed. R. Serv. 3d (Callaghan) 1264 STATE NATIONAL INSURANCE COMPANY INC, Plaintiff-Appellant, versus CALVIN YATES, Defendant-Appellee. No. 04-60157 UNITED STATES COURT OF APPEALS FOR THE FIFTH ... Date Added: 2009-04-16 16:43:16 |
| hypercover.pdf Path: University of Illinois, Urbana Champaign >> MATH >> 0528 Fall, 2009 Description: HYPERCOVERS IN TOPOLOGY DANIEL DUGGER AND DANIEL C. ISAKSEN Abstract. We show that if U is a hypercover of a topological space X then the natural map hocolim U X is a weak equivalence. This fact is used to construct topological realization functors ... Date Added: 2009-04-16 16:43:22 |
| lab_handout_glucose_acetylation_procedure.pdf Path: Washington >> CHEM >> 347 Fall, 2008 Description: ACETYLATION of D-(+)-GLUCOSE Safety. Do NOT handle iodine outside of the hood. I2 sublimes quickly and is toxic by inhalation. Only dispense iodine in a hood and remember to recap the container when finished. Procedure. Equip a 3 mL conical vial with... Date Added: 2009-04-16 16:44:17 |
| 14-fft.pdf Path: University of Illinois, Urbana Champaign >> CS >> 373 Fall, 2008 Description: CS 373 Lecture 14: Fast Fourier Transforms Fall 2002 Blech! Ack! Oop! THPPFFT! Bill the Cat, Bloom County (1980) 14 14.1 Fast Fourier Transforms (November 7) Polynomials In this lecture well talk about algorithms for manipulating polynomials: ... Date Added: 2009-04-16 16:44:26 |
| L8.ppt Path: University of Illinois, Urbana Champaign >> CS >> 232 Fall, 2008 Description: The compilation process To produce assembly code: gcc S test.c - produces test.s To produce object code: gcc c test.c - produces test.o To produce executable code: gcc test.c - produces a.out 1 The purpose of a linker The linker is a pr... Date Added: 2009-04-16 16:46:20 |
| 4_King_Co_v_Boeing_Co.pdf Path: Washington >> A >> 503 Fall, 2009 Description: 4/3/2008 King County v. Boeing Company 62 Wash.2d 545 (1963) Cindy Lin Property A503A April 3, 2008 Background Parties Plaintiff - King County Defendants 1) Boeing Co. ) saacso o o s 2) Isaacson Iron Works The Slip No. 5 Abandoned portion of river... Date Added: 2009-04-16 16:47:03 |
| lawson.ppt Path: Washington >> PORTLAND >> 2004 Fall, 2009 Description: Prediction OPI Area hatchery coho Jack to Adult regression Oregon Coastal Natural (OCN) coho Environmental Sea Surface Temperature Upwelling Year (?) Lower Columbia River coho Not predicted Time Series of OPI Area Hatchery Coho Adults/Jac... Date Added: 2009-04-16 16:49:07 |
| page6_1.pdf Path: Washington >> PAGE >> 2 Fall, 2009 Description: Dow Jones Reprints: This copy is for your personal, non-commercial use only. To order presentation-ready copies for distribution to your colleagues, clients or customers, use the Order Reprints tool at the bottom of any article or visit www.djreprint... Date Added: 2009-04-16 16:49:11 |
| page6_1.pdf Path: Washington >> PAGE >> 6 Fall, 2009 Description: Dow Jones Reprints: This copy is for your personal, non-commercial use only. To order presentation-ready copies for distribution to your colleagues, clients or customers, use the Order Reprints tool at the bottom of any article or visit www.djreprint... Date Added: 2009-04-16 16:49:11 |
| B_124.pdf Path: University of Illinois, Urbana Champaign >> EDPSY >> 490 Fall, 2009 Description: ... Date Added: 2009-04-16 16:49:56 |
| America.ppt Path: Washington >> GEOG >> 271 Fall, 2008 Description: George McGovern said in 1972, \"To admit the existence of hunger in America is to confess that we have failed in meeting the most sensitive and painful of human needs. To admit the existence of widespread hunger is to cast doubt on the efficacy of ou... Date Added: 2009-04-16 16:52:04 |
| hw7.pdf Path: Washington >> MATH >> 324 Fall, 2008 Description: B. Solomyak . Math 324 A & B Advanced Multivariable Calculus Autumn 2003 HOMEWORK 7 DUE ON WEDNESDAY, NOVEMBER 26 Reading: 16.5, 16.6 Practice only (do not turn in): 16.5: 1, 3, 5, 911, 13, 17, 19 16.6: 14, 1116, 17, 19, 23, 31, 35, 37, 43, 45... Date Added: 2009-04-16 16:52:29 |
| Lect20.pdf Path: University of Illinois, Urbana Champaign >> PHYS >> 211 Fall, 2008 Description: Physics 211: Lecture 20 Today\'s Agenda Torque due to gravity Rotation Recap Statics Car on a Hill Static Equilibrium Equations Examples: Suspended beam Hanging lamp Ladder Physics 211: Lecture 20, Pg 1 Lecture 20, Act 1 Rotations A ball and box ha... Date Added: 2009-04-16 16:52:50 |
| lec21.pdf Path: University of Illinois, Urbana Champaign >> CS >> 473 Fall, 2008 Description: CS 473ug: Algorithms Mahesh Viswanathan vmahesh@cs.uiuc.edu 3232 Siebel Center University of Illinois, Urbana-Champaign Spring 2007 Viswanathan CS473ug Pricing Method Primal-Dual Method LP Rounding Part I Vertex Cover Viswanathan CS473ug Pric... Date Added: 2009-04-16 16:53:40 |
| handout_Lecture_10.pdf Path: Washington >> CHEM >> 162 Fall, 2008 Description: For Q2-4, The follow ing d ata w ere collected in tw o stud ies of the reaction below . A + 2B C+D Experim ent #1 Time (s) [A] (M) x 10-2 0 10.0 20 6.67 40 5.00 60 4.00 80 3.33 100 2.86 120 2.50 In experim ent #1, [B] 0 = 5.0 M In experim ent #2, [B]... Date Added: 2009-04-16 16:54:03 |
| PCR.ppt Path: Washington >> FISH >> 543 Fall, 2009 Description: PCR FISH 543 / OCEAN 575 Molecular Techniques DNA Replication in the Tube PCR Polymerase Chain Reaction Most important recent discovery (1985) Patented all PCR reactions pay royalty Repeated replication of specific DNA sections Small quantiti... Date Added: 2009-04-16 16:54:22 |
| DischargePlanCase.doc Path: Washington >> CURRICULUM >> 3 Fall, 2009 Description: Discharge Planning and Social Work Values Northwestern State University Mrs. Jackson is a 72-year-old white widowed female. She is currently living in Shady Oaks Senior Care Home. She was referred to Shady Oaks by her family one year ago after a brie... Date Added: 2009-04-16 16:54:34 |
| ta_session17.pdf Path: Washington >> ECON >> 201 Fall, 2008 Description: Econ 201 AC/AM Winter 2007 Edwin Wong Symbolic Representation of Money Demand To wrap up money demand, we need to relate it to the real economy. We do this using the quantity theory of money and its symbolic representation. 1. Write down the equati... Date Added: 2009-04-16 16:54:39 |
| shot-list.pdf Path: University of Illinois, Urbana Champaign >> JHERTEL >> 2 Fall, 2009 Description: Intro Sunrise Time Lapse Blinds Shadow Blinds Low Angle Bed- Clock in Background with eyes opening Shirt Grab Quick Jacket Quick Door Out Quick Run - flaps Lecture Hall Burst and pan towards seats TA, Fuzzy with descent down and up Descent into Despa... Date Added: 2009-04-16 16:54:47 |
| Vita.pdf Path: Washington >> MDJ >> 3 Fall, 2009 Description: Michael D. Johnson University of Washington Box 353200 Seattle, WA 98195 Office phone: 206.616.2756 Fax: 206.685.9392 E-mail: mdj3@u.washington.edu EDUCATION Michigan State University, East Lansing, MI (2006) Ph.D. in Organizational Behavior/Human Re... Date Added: 2009-04-16 16:54:50 |
| identification.doc Path: Washington >> MGMT >> 580 Fall, 2008 Description: COGNITIVE AND AFFECTIVE IDENTIFICATION 1 RUNNING HEAD: COGNITIVE AND AFFECTIVE IDENTIFICATION COGNITIVE AND AFFECTIVE IDENTIFICATION IN ORGANIZATIONAL SETTINGS MICHAEL D. JOHNSON FREDERICK P. MORGESON MICHIGAN STATE UNIVERSITY Direct corresponden... Date Added: 2009-04-16 16:54:51 |
| exam_answers_Midterm_Exam_1_(Green)_Key.pdf Path: Washington >> CHEM >> 220 Winter, 2008 Description: ... Date Added: 2009-04-16 16:56:04 |
| 459_F3d_356_2006_US_App_LEXIS_19029.DOC Path: Washington >> EDLPS >> 516 Winter, 2008 Description: Page 1 1 of 1 DOCUMENT FRANK G. and DIANNE G., Parents of a Disabled Student, ANTHONY G., Plaintiffs-Appellees, v. BOARD OF EDUCATION OF HYDE PARK, CENTRAL SCHOOL DISTRICT, Defendant-Appellant. Docket No. 04-4981-cv UNITED STATES COURT OF APPEALS FO... Date Added: 2009-04-16 16:57:04 |
| Reading01.pdf Path: Washington >> ENVSC >> 296 Fall, 2009 Description: INTERVIEW WITH A FUNGUS D.P. Good evening, viewers. Our guest this evening is Pilobolus crystallinus, author of the award winning best seller, Do We Need Mankind? A Fungal Perspective. Mr. Pilobolus is a member of the kingdom Fungi, class Zygomycetes... Date Added: 2009-04-16 16:57:30 |
| sage-current-location.txt Path: Washington >> SAGE >> 3 Fall, 2009 Description: /home/gfurnish/sage-3.1.alpha0-sage.math-only-x86_64-Linux... Date Added: 2009-04-16 16:58:38 |
| notes_Lecture_15(2spp).pdf Path: Washington >> CHEM >> 152 Fall, 2008 Description: Chem 152A Lecture 15 Reading Assignment for Friday thru Monday: Zumdahl pp . 526-536 Hour Exam on Feb 17. Scientific calculators OK. No graphing calculators. No crib sheet. Twenty multiple choice questions covering Chapter 11 and pp 510-536 plus mate... Date Added: 2009-04-16 17:03:01 |
| notes3.pdf Path: University of Illinois, Urbana Champaign >> ECE >> 559 Fall, 2008 Description: Environment Flat Rural Urban Hilly Mall Indoors Spread 0.5 s 5 s 20 s 0.3 s 0.1 s Table 3.1: Typical delay spreads for various environments. If W > 1 , then the fading is said to be frequency selective, and h(t; ) can no longer be replaced by a ds... Date Added: 2009-04-16 17:03:43 |
| penrose_lightning_uw05.ppt Path: Washington >> UW >> 2005 Fall, 2009 Description: Outreach: Communicating with NEPTUNE\'s Many Audiences NEPTUNE Workshop November 15, 2005 Nancy Penrose Goal of Outreach Communicate NEPTUNE\'s potential for new science, discovery, and participation to the program\'s many audiences Audiences Scient... Date Added: 2009-04-16 17:03:59 |
| Introduction.ppt Path: Washington >> ESS >> 230 Fall, 2008 Description: Rive and Be s rs ache (ES /Oce 230) S an DaveMontgom ry e C huck Nittroue r 341 Johnson Hall / 685-2560 111 MarineS nce Building / 543-5099 cie s dave e @ss.washington.e du nittroue oce @ an.washington.e du Tina Dre r xle 112 MarineS nce Building / 6... Date Added: 2009-04-16 17:04:29 |
| Introduction.ppt Path: Washington >> ESS >> 05 Fall, 2009 Description: Rive and Be s rs ache (ES /Oce 230) S an DaveMontgom ry e C huck Nittroue r 341 Johnson Hall / 685-2560 111 MarineS nce Building / 543-5099 cie s dave e @ss.washington.e du nittroue oce @ an.washington.e du Tina Dre r xle 112 MarineS nce Building / 6... Date Added: 2009-04-16 17:04:29 |
| Response_1.pdf Path: University of Illinois, Urbana Champaign >> LIS >> 501 Fall, 2008 Description: LIS501 9 September 2005 Reading Response #1 This past week we grappled with the question What is information and read a historical overview of libraries and librarianship that analyzed the evolution of the profession in a series of stages and schemes... Date Added: 2009-04-16 17:05:39 |
| q4b.pdf Path: Washington >> MATH >> 071 Fall, 2009 Description: Math 124AC,BA,BB 1. (at + b) sin(t) Fourth Quiz 35 min 9:45 Nov. 2, 2006 2. w cos w sin w 3. 2 ez +ez 4. 3x + e(x 3 ) 5. (a cos(t) + b)1/2 Answers to third quiz in Math 124AC,BA,BB 1. (at + b) cos(t) + a sin(t) 2. (sin w)(cos ww sin w)w c... Date Added: 2009-04-16 17:06:11 |
| s425_hw5.pdf Path: University of Illinois, Urbana Champaign >> STAT >> 425 Fall, 2008 Description: STAT 425 HW #5 Due Wednesday, December 17, 2003 You can turn it in to my office, 116B IH, or mailbox in 101 IH. 1. Suppose p = 2, and let the kernel K be K(x, z) = 1 + x z = 1 + x1 z1 + x2 z2 . Let H be the reproducing kernel Hilbert space based on ... Date Added: 2009-04-16 17:09:00 |
| Malenka&Bear2004(review).pdf Path: Washington >> MEM >> 553 Fall, 2009 Description: Neuron, Vol. 44, 521, September 30, 2004, Copyright 2004 by Cell Press LTP and LTD: An Embarrassment of Riches Robert C. Malenka1,* and Mark F. Bear2 Nancy Pritzker Laboratory Department of Psychiatry and Behavioral Sciences Stanford University Scho... Date Added: 2009-04-16 17:09:02 |
| 2007GatewayOpen.pdf Path: University of Illinois, Urbana Champaign >> DRESSEL >> 3 Fall, 2009 Description: 2007 St Louis Gateway Open Two-Star Table Tennis Tournament September 29-30, 2007 Sanctioned by USA Table Tennis. Sponsored by the Missouri Athletic Club and St. Louis Table Tennis Club. Location: Missouri Athletic Club West clubhouse 1777 Des Peres... Date Added: 2009-04-16 17:09:43 |
| StephenBuffington.ppt Path: Washington >> SMA >> 550 Fall, 2008 Description: Incorporating Potential Climate Impacts into PNW Energy Planning Presented to: Northwest Power Planning Council Presented by: Stephen Buffington SMA 550, Winter 2002 NWPPC Mandate Through the Northwest Power Act of 1980, these states formed a comp... Date Added: 2009-04-16 17:10:41 |
| homework_Homework_7.pdf Path: Washington >> CHEM >> 155 Winter, 2008 Description: ... Date Added: 2009-04-16 17:10:49 |
| chr15_20kb_90perc.pdf Path: Washington >> PANTRO >> 2 Fall, 2009 Description: 2b 15 12 13 16 18 20 21 Y ... Date Added: 2009-04-16 17:11:15 |
| Final_participant_list_Kelso03.pdf Path: Washington >> KELSO >> 2003 Fall, 2009 Description: Climate and Water Resource Forecasts for the 2004 Water Year Sponsored by the Climate Impacts Group, University of Washington October 14, 2003 - Red Lion Inn, Kelso, Washington First Name Robert Mark Andre Ann Ken Kurt Wing Tom Steve Russ Alan Tim Ph... Date Added: 2009-04-16 17:12:17 |
| Chapter_2.pdf Path: University of Illinois, Urbana Champaign >> ECE >> 313 Fall, 2008 Description: Chapter 2 Conditional Probability Suppose that we have partial knowledge of the result of a trial of the experiment - we know that event A occurred on the trial - but we do not know which outcome in A occurred; only that the ... Date Added: 2009-04-16 17:14:20 |
| ICN-feb68.pdf Path: Washington >> CIVILR >> 3 Fall, 2009 Description: ... Date Added: 2009-04-16 17:14:25 |
| 2008WorldFinalsProblemSet.pdf Path: Fayetteville State University >> WW >> 2 Fall, 2009 Description: Problem A T Air Conditioning Machinery Input file: ducts.in You are a technician for the Air Conditioning Machinery company (ACM). Unfortunately, when you arrive at a customer site to install some air conditioning ducts, you discover that you are ru... Date Added: 2009-04-16 17:19:22 |
| week6.ppt Path: Fayetteville State University >> WW >> 2 Fall, 2009 Description: TopCoder Marathon Match 49 (currently running ends Feb. 18th) Upcoming Contests Algorithms qualifying rounds: TopCoder Open 2009 Tuesday, February 24th @ 7:00 AM Saturday, February 28th @ 12:00 PM Wednesday, March 4th @ 9:00 PM ... Date Added: 2009-04-16 17:19:24 |
| aggregation.ppt Path: Fayetteville State University >> COP >> 3330 Fall, 2009 Description: Aggregation/Composition Programming in C+ Fall 2008 Dr. David A. Gaitros dgaitros@admin.fsu.edu Aggregation/Compositio n Aggregation is the act of embedding an object of one class into another as a member data of another class. Some developers us... Date Added: 2009-04-16 17:20:29 |
| resume_watsonk.pdf Path: Fayetteville State University >> KCW >> 03 Fall, 2009 Description: Kelly Watson Florida State University Department of Geography 323 Bellamy Building, Tallahassee, FL 32306 Email: kcw03c@fsu.edu Education 2003-present Department of Geography, Florida State University, Tallahassee, Florida Ph.D. Candidate in Geograph... Date Added: 2009-04-16 17:20:34 |
| crypto2_new.ppt Path: Fayetteville State University >> CIS >> 5371 Fall, 2009 Description: CIS 5371 Cryptography 2. Safeguard and Attack 1 Encryption Encryption encryption key Plaintext decryption key Ciphertext Decryption 2 Encryption algorithms Notation Message M Algorithm A Key K Cryptographic transformation: M\' = A(K,M... Date Added: 2009-04-16 17:21:04 |
| test1.pdf Path: Fayetteville State University >> CAL >> 1 Fall, 2009 Description: MAC 2311 Calculus 1 Test 1 13 Sep 2004 Directions: Show ALL work for credit; Give EXACT answers when possible; Start each problem on a SEPARATE page; Use only ONE side of each page; Be neat; Leave margins on the left and top for the STAPLE; Calcul... Date Added: 2009-04-16 17:21:34 |
| 18_AppendixA_deal.pdf Path: Fayetteville State University >> ETD >> 04112005 Fall, 2009 Description: APPENDIX A CHRONOLOGY OF GERMAN OPERAS PREMIERED OR COMPOSED BETWEEN 1787 AND 1796 YEAR 1787 LOCATION / DATE Biberach, Feb. 2 Kremsmnster, Feb. 4 Vienna, Apr. 12 Vienna, Oct. 12 Berlin, Oct. 18 Vienna, Nov. 25 Mannheim, Mar. 4 Not performed TITLE ... Date Added: 2009-04-16 17:22:10 |
| franckhertz.pdf Path: Fayetteville State University >> PHY >> 3802 Fall, 2009 Description: IM.1. Franck-Hertz Experiment 1. Purpose: Perform the historic Franck-Hertz experiment to demonstrate the existence of discrete energy levels in mercury, and to determine the minimum kinetic energy needed by an electron in order to collide inelastica... Date Added: 2009-04-16 17:23:06 |
| Lecture20.pdf Path: Fayetteville State University >> PHY >> 2048 Fall, 2009 Description: Chapter 13: Fluids Archimedes used the principle of buoyancy to determine the amount of gold in a crown (Archimedes, 287 212 BC) Prof. Chris Wiebe Prof. Simon Capstick Buoyancy and Archimedes\' Principle Why do ships float in water? A force is exer... Date Added: 2009-04-16 17:23:35 |
| Appendix_E.pdf Path: Fayetteville State University >> PHASE >> 1 Fall, 2009 Description: Appendix E: Identify Characteristics of the Population at Risk Identify the populations and the drug using behaviors that contribute to the consequence problem. You may need to consult with local experts from the Medical Examiner\'s Office, emergency ... Date Added: 2009-04-16 17:27:33 |
| 1_LMR_Manuscript.pdf Path: Fayetteville State University >> ETD >> 08112004 Fall, 2009 Description: THE FLORIDA STATE UNIVERSITY COLLEGE OF HUMAN SCIENCES ADAPTIVE THERMOGENESIS IS INTACT IN B6 AND A/J MICE STUDIED AT THERMONEUTRALITY By LARA MICHELLE ROBERTS A Thesis submitted to the Department of Nutrition, Food and Exercise Sciences in partia... Date Added: 2009-04-16 17:27:37 |
| 1105_suppD&ANS.pdf Path: Fayetteville State University >> MAC >> 1105 Fall, 2009 Description: ... Date Added: 2009-04-16 17:28:00 |
| Roberts.pdf Path: Fayetteville State University >> LAW >> 323 Fall, 2009 Description: BLACK CLUB WOMEN AND CHILD WELFARE: LESSONS FOR MODERN REFORM DOROTHY E. ROBERTS* I. II. III. IV. V. INTRODUCTION . BLACK CLUB WOMEN\'S SOCIAL VIEW OF CHILD WELFARE . RESPONDING TO THE NEEDS OF CHILDREN . CONNECTING CHILDREN\'S AND WOMEN\'S INTERESTS . ... Date Added: 2009-04-16 17:28:42 |
| oppo10b_inv.pdf Path: Fayetteville State University >> PHY >> 2049 Fall, 2009 Description: ... Date Added: 2009-04-16 17:29:45 |
| 02_mru_intro.pdf Path: Fayetteville State University >> ETD >> 10212003 Fall, 2009 Description: INTRODUCTION God has sent me to accomplish with you things which will astonish the whole world whenever people hear about them. -Judith to Holofernes, The Book of Judith1 The purpose of this paper is to explore the figure of Judith in Anglo-Saxon l... Date Added: 2009-04-16 17:29:56 |
| dist_geom.pdf Path: Fayetteville State University >> INTROMATHB >> 03 Fall, 2009 Description: 5. Distance Geometry The fundamental problem of distance geometry is to find a set of coordinates from the distance matrix. If p0, . . . , pn is a list of vectors giving the coordinates of a sequence of points in 3D space, then the distance matrix f... Date Added: 2009-04-16 17:30:00 |
| 2233_SUM06finalREVpt1.pdf Path: Fayetteville State University >> MAC >> 2233 Summer, 2009 Description: MAC 2233 Final Exam Review 1. For z = f (x, y) = 2x2 3x2 y + 5y + 1, nd z (b) fx (2, 3) (a) x 2. A company spends x thousand dollars per week on newspaper advertising and y thousand dollars per week on television advertising. Its weekly sales were ... Date Added: 2009-04-16 17:30:04 |
| 01_prelims2_jdm2.pdf Path: Fayetteville State University >> ETD >> 11172003 Fall, 2009 Description: THE FLORIDA STATE UNIVERSITY SCHOOL OF SOCIAL WORK DEVELOPMENT OF THE LEVEL OF STABILITY INDEX FOR CHILDREN (LSIC): DETERMINING INDICATORS OF EMOTIONAL AND BEHAVIORAL STABILITY OF CHILDREN By Jacquelyn Denise McMillan A Dissertation submitted to the... Date Added: 2009-04-16 17:30:29 |
| 109_DOLL.pdf Path: Fayetteville State University >> ENGLISH >> 1112 Fall, 2009 Description: The Demeter Myth in Beckett Grace to breath that void. Know happiness-Beckett1 Mary A. Doll A survey of the Beckett criticism of the seventies reveals an overwhelming emphasis by the critics on Beckett\'s concern with philosophy. Beckett\'s use of suc... Date Added: 2009-04-16 17:31:03 |
| 01_Table_of_Contents.pdf Path: Fayetteville State University >> ETD >> 08182004 Fall, 2009 Description: THE FLORIDA STATE UNIVERSITY COLLEGE OF COMMUNICATION INTERNET POLICY AND USE: A FIELD STUDY OF INTERNET CAFES IN CHINA By HUA LIN SUN A Dissertation submitted to the Department of Communication in partial fulfillment of the requirements for the d... Date Added: 2009-04-16 17:31:53 |
| teaser-3.0-vector.pdf Path: Fayetteville State University >> IS >> 3 Fall, 2009 Description: ... Date Added: 2009-04-16 17:35:37 |
| 2Littell.pdf Path: Washington >> NWFSC >> 08 Fall, 2009 Description: Climatic gradients and Douglas-fir growth: Water limits growth from stand to region Jeremy Littell JISAO CSES Climate Impacts Group UW College of Forest Resources David L. Peterson USFS PWFSL Michael Tjoelker UW College of Forest Resources In this... Date Added: 2009-04-16 17:35:45 |
| Ch4a.ppt Path: Fayetteville State University >> COP >> 562105 Fall, 2009 Description: 1 Syntax Analysis Part I Chapter 4 COP5621 Compiler Construction Copyright Robert van Engelen, Florida State University, 2005 2 Position of a Parser in the Compiler Model Source Program Lexical Analyzer Token, tokenval Get next token Parser and r... Date Added: 2009-04-16 17:38:12 |
| Ch4a.ppt Path: Fayetteville State University >> COP >> 5621 Fall, 2009 Description: 1 Syntax Analysis Part I Chapter 4 COP5621 Compiler Construction Copyright Robert van Engelen, Florida State University, 2007 2 Position of a Parser in the Compiler Model Source Program Lexical Analyzer Token, tokenval Get next token Parser and r... Date Added: 2009-04-16 17:38:12 |
| miller.pdf Path: Fayetteville State University >> LAW >> 321 Fall, 2009 Description: SEEING OVER THE BRICK WALL: LIMITING THE ILLINOIS BRICK INDIRECT PURCHASER RULE AND LOOKING AT ANTITRUST STANDING IN CAMPOS V. TICKETMASTER CORP. THROUGH A NEW LENS SETH E. MILLER* I. INTRODUCTION .. II. LOOKING AT CAMPOS V. TICKETMASTER CORP. . A. F... Date Added: 2009-04-16 17:38:16 |
| 12_RHS_Dissertation_Chapter_Five.pdf Path: Fayetteville State University >> ETD >> 08172005 Fall, 2009 Description: CHAPTER FIVE: POWER RESTORED, 1673-1678 For Anglesey 1673 was a year of hope and a chance to redeem his political career. He had received a new opportunity to make himself a valuable member of court, for in April he obtained the office of privy seal... Date Added: 2009-04-16 17:40:15 |
| 12_RHS_Dissertation_Chapter_Five.pdf - Part 2 Path: Fayetteville State University >> ETD >> 08172005 Fall, 2009 Description: to the said earl of the said quit-rents as shall be just and reasonable . . . .3 MS 480860, Diary of Arthur Annesley, ea... Date Added: 2009-04-16 17:40:15 |
| 12_RHS_Dissertation_Chapter_Five.pdf - Part 3 Path: Fayetteville State University >> ETD >> 08172005 Fall, 2009 Description: sey was fast at work, attending privy council meetings and those for the committee on Irish affairs. He also spent time... Date Added: 2009-04-16 17:40:15 |
| 12_RHS_Dissertation_Chapter_Five.pdf - Part 4 Path: Fayetteville State University >> ETD >> 08172005 Fall, 2009 Description: ce in the second half of the seventeenth century, witnessed many victories and meant that continental Protestantism was... Date Added: 2009-04-16 17:40:15 |
| 12_RHS_Dissertation_Chapter_Five.pdf - Part 5 Path: Fayetteville State University >> ETD >> 08172005 Fall, 2009 Description: rd University Press, 1990), 224. Tim Harris, \"Introduction: Revising the Restoration,\" in The Politics of Religion in Re... Date Added: 2009-04-16 17:40:15 |
| 12_RHS_Dissertation_Chapter_Five.pdf - Part 6 Path: Fayetteville State University >> ETD >> 08172005 Fall, 2009 Description: Arlington\'s insolence would not go unpunished. Other courtiers expressed their opinions of the incident, offering Angles... Date Added: 2009-04-16 17:40:15 |
| 12_RHS_Dissertation_Chapter_Five.pdf - Part 7 Path: Fayetteville State University >> ETD >> 08172005 Fall, 2009 Description: MS Carte 53, 243, ff. 246-247; Clement Edwards Pike, ed., Selections from the Correspondence of Arthur Capel, Earl of Es... Date Added: 2009-04-16 17:40:15 |
| 12_RHS_Dissertation_Chapter_Five.pdf - Part 8 Path: Fayetteville State University >> ETD >> 08172005 Fall, 2009 Description: . They refused to offer Charles more than 300,000. Disputes between the two houses arose once more, and Charles again p... Date Added: 2009-04-16 17:40:15 |
| 12_RHS_Dissertation_Chapter_Five.pdf - Part 9 Path: Fayetteville State University >> ETD >> 08172005 Fall, 2009 Description: dismissed. This was largely due to maneuverings by his enemies at court, including Ranelagh and Danby, who had tried to... Date Added: 2009-04-16 17:40:15 |
|
|
Get Started With Course Hero Today!
Get study guides, join study groups, and more!
Sign up in seconds with your Facebook account!
Course Hero is a Facebook Application Partner.
Click below to sign-up for FREE.
Our Social Learning Network was built to provide students and key learning partners like professors a platform to share, meet and collaborate while accelerating their comprehension of course-related theories and concepts. We are committed to providing you immediate access to a growing wealth of study materials and an unparalleled academic network of students, professors and other key partners. Why do you care? Because you want the best grade possible and at times need a 24/7 resource that’s responsive to your needs. |
|
What People Are Saying About Course Hero
|
|||
|
|||
|
Explore the benefits of joining Course Hero's social learning network.
|
|||
 |
Get millions of study materials now!Need lecture notes for a missed class or want insightful explanation of the theories and concepts you learn in class? Look no further, Course Hero’s Study Materials empowers you to find a broad and deep set of materials that can help you right now!
Click below to sign-up for FREE.
|
||
 |
Get over 200,000 textbook solutions now!Having difficulty with your homework and need documents that are relevant for your Textbook? Don't be frustrated. Course Hero's Textbook Help presents you study materials from many college courses.
Click below to sign-up for FREE.
|
||
 |
Meet over 300,000 students and your fellow classmates now!Want to meet your current classmates or those that took the class last year? Don’t worry or have anxiety. Course Hero’s Study Groups gives you the seamless opportunity to develop both anonymous or direct relationships with those classmates whom you want to meet and get help from right now!
Click below to sign-up for FREE.
|
||
