Course Solutions And Notes - 14-Detailed_Lect_Out_LO.pdf 2c
| YKL002W.t2k.alpha-logo.pdf Path: UCSC >> YKL >> 002 Fall, 2009 Description: YKL002W.t2k ALPHA 2 1 H X H HXHIGC I I H X X X X XX I H HBS H D X G A C B H E E S E H F I S E T C C B B BCB C CEE B H XXXXXXHXI X A H B HHH I I I I I I I I I I I I I I I I I I I I I I I I I I I I X X X X X X X X X X X X X X X X X X X X ... Date Added: 2009-06-24 13:25:28 |
| YKL049C.t2k.alpha-logo.pdf Path: UCSC >> YKL >> 049 Fall, 2009 Description: YKL049C.t2k ALPHA 2 1 C D E F H B XX 1 10 20 30 40 B 2 1 B S E S B S B S B S E B H S B H E H S E H E B H B H E E E H X X X E X XXXXXXXXXXXXXX E E B B B B B S C C H B H H H H H H H H H XXXXXXXX B E E H B B E B B E B H X ... Date Added: 2009-06-24 13:25:42 |
| YKL010C.t2k.w0.5-logo.pdf Path: UCSC >> YKL >> 010 Fall, 2009 Description: 251 260 270 280 290 T 5 4 3 2 1 E T H H T T E A X VNC D V L I VP F V E I I I A Y C I A XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX G S N G K A L I M V F L V L F M S R L K F F L N K A F L Q N S N Q I L M C L A S R K L ... Date Added: 2009-06-24 13:26:44 |
| 2007629_r01x_058626.pdf Path: Stanford >> RFX >> 1035 Fall, 2009 Description: Case 1:05-cv-08626-GEL Document 397 Filed 06/29/2007 Page 1 of 10 UNITED STATES DISTRICT COURT SOUTHERN DISTRICT OF NEW YORK In re REFCO, INC. SECURITIES LITIGATION 17 y x ^7 05 Civ. 8626 (GEL) x JUDGMENT APPROVING CLASS ACTION SETTLEMENT W... Date Added: 2009-06-24 13:34:40 |
| Week04.pdf Path: Whitman >> P >> 156 Fall, 2009 Description: Week 4 - Continuous Charge distributions Powerpoint Handouts Approach Define the following quantities in terms of coordinates: rrr Displacement vector: r = rP rs r r ) rP Calculate: r = ; r = r r Charge element: dq Integration variable describes th... Date Added: 2009-06-24 13:39:57 |
| English 200 RR1.doc Path: Winthrop >> ENG >> 200 Fall, 2009 Description: Dr. Cothran English 200 Reading Response 1 Pick a topic (race, gender, religion, class, disability, nationalism, psychology, criminal behavior, sexuality/desire, anything!) that interests you. Then look through The Moonstone. Using quotes and example... Date Added: 2009-06-24 13:41:07 |
| ClassProblems-WaterTreatment.pdf Path: Southern Illinois University, Carbondale >> CE >> 310 Fall, 2008 Description: 3/18/2009 Class Problems Water Treatment CE 310 INTRODUCTION TO ENVIRONMENTAL ENGINEERING SPRING 2009 INSTRUCTOR L.R. CHEVALIER, PH.D., P.E. Problem 1 For the dimensions given below, determine the average vertical velocity (HLR) and hydraulic reten... Date Added: 2009-06-24 13:42:37 |
| Miller - Legislative Voting and Cycling.pdf Path: North-West Uni. >> JND >> 260 Fall, 2009 Description: Legislative Voting and Cycling Gary Miller gjmiller@artsci.wustl.edu Washington University in St. Louis Experimentation in Political Science Northwestern University May 28-29, 2009 Thanks to Bill Bottom, Jamie Druckman, Dima Galkin, Gyung-Ho Jeong,... Date Added: 2009-06-24 13:43:39 |
| Ex1sp07ky.pdf Path: Glendale Community College >> GC >> 130 Fall, 2009 Description: CHM 130 Spring 2007 EXAM 1 KEY Part One: Multiple Choice. (36 points) 1. What is the term for an extensively tested proposal of a scientific principle that explains the behavior? A. experiment B. hypothesis C. law D. theory E. fact 2. What is the ... Date Added: 2009-06-24 13:47:14 |
| hw6.pdf Path: Lake County >> ECE >> 549 Fall, 2009 Description: ECE549/CS543 Programming Assignment 6 Due: Tuesday, November 28, 2006 This programming assignment is concerned with the application of k-means clustering to image segmentation. The data for this assignment can be found in the directory: http:/course... Date Added: 2009-06-24 13:51:34 |
| Doityourselfstudyguide.pdf Path: Rochester >> ECE >> 111 Fall, 2009 Description: 1/3 ECE111 Do it yourself study guide Instructions: Starting at least a week before the final exam, use your class lecture notes, the textbook, and other sources to fill in the essential relationships for each topic & sub-topic, including basic prin... Date Added: 2009-06-24 13:53:33 |
| my first presentation.ppt Path: Iowa State >> E >> 104 Fall, 2009 Description: How to Make PowerPoint Presentation Peifeng Zhang English 599 Professor Ewald May 14, 2006 Step 1: After starting the PowerPoint program, you will see this default slide, save this presentation slideshow first by clicking the disk icon on the Stand... Date Added: 2009-06-24 13:59:47 |
| sample4.pdf Path: Heartland Community College >> CHEM >> 161 Fall, 2009 Description: Sample Exam #4 1. A sample of a gas has a volume of 0.750L at 40.0oC and 0.750 atm. What is the temperature if we increase the volume to 1.00 L and the pressure to 1.00 atm? a. 71oC b. 556oC c. 283oC d. 176oC e. 97oC 2. What is the density of ammoni... Date Added: 2009-06-24 14:05:33 |
| YGL241W.t2k.w0.5-logo.pdf Path: UCSC >> YGL >> 241 Fall, 2009 Description: 5 4 3 2 1 L LI V F XXXXXXXXXXXXX XXXM XXXIXXXY E P S S T N 101 110 120 130 140 H 6 5 4 3 2 1 L T G H S T H I I L S I F N F F F N E S D AL M I L V XXXXXXXXXXXXXXXXXXXXXXXXXX XXXXXXXXXXXXXXXXXXXXXXX L L I F R Q D E L R D L I D S Q K Y S ... Date Added: 2009-06-24 14:07:06 |
| 436CP42 UG Circ Pol Yagi.doc Path: RIT >> P >> 07103 Fall, 2009 Description: 436CP42 U/G Circ. Pol. Yagi SPECIFICATIONS Model Frequency range Gain Beamwidth Polarity Front to Back Ellipticity VSWR Feed impedance Connector Power Handling Turning radius Wind Area Mast Size Weight / ShipWt. 436CP42 U/G 430 -438 MHz 16.8 dBdc 2... Date Added: 2009-06-24 14:07:52 |
| SSRD_DCP_F08a_T14_V1.7.doc Path: USC >> CSCI >> 577 Fall, 2009 Description: System and Software Requirements Definition (SSRD) THE VIRTUAL ASSISTANT LIVING AND EDUCATON PROGRAM TEAM: 14 Swetha Suryanarayanan Kartik Sethi Bharat Mehndiratta Nikita Valechha Shobana Govindan Priyanka Nambiar Naveen Joy Mark Shehata Pamela Cla... Date Added: 2009-06-24 14:09:41 |
| SID_DCP_F08a_T14_V2.0.doc Path: USC >> CSCI >> 577 Fall, 2009 Description: Supporting Information Document (SID) The Virtual Assistant Living and Education Program Team #14 Name Swetha Suryanarayanan Nikita Valechha Kartik Sethi Shobana Govindan Bharat Mehndiratta Priyanka Nambiar Naveen Joy Mark Shehata Pamela Clay Role... Date Added: 2009-06-24 14:09:42 |
| hw3.pdf Path: Lake County >> ECE >> 190 Fall, 2009 Description: ECE190 Spring 2009 Homework 3 (Due: 02/10/2009) Instructions: Homework will be returned to you in discussion section on Friday. Please write the section number (AD1-AD7) that you wish your HW to be returned in. Also, make sure you staple all your pa... Date Added: 2009-06-24 14:10:13 |
| Lecture 28 - Topics for Final Exam.ppt Path: Ohio State >> EG >> 191 Fall, 2009 Description: Fundamentals of Engineering for Honors ENG H191 Lecture 28 Testing Designs Program Assessment Review for Final Check Grades Lecture 28 1 Fundamentals of Engineering for Honors ENG H191 Today - Thursday Test the cardboard design turn in your d... Date Added: 2009-06-24 14:10:24 |
| overview.pdf Path: Lake County >> ECE >> 199 Fall, 2009 Description: University of Illinois at Urbana-Champaign Department of Electrical and Computer Engineering ECE 199 Fall 2004 Course Overview Instructor: Wen-mei Hwu (w-hwu@uiuc.edu) 215 Coordinated Sciences Laboratory, phone: 244-8270 Office hours: Mon/Wed 1:00-2:... Date Added: 2009-06-24 14:10:33 |
| T0291.t04.w0.5-logo.pdf Path: UCSC >> T >> 0291 Fall, 2009 Description: T0291.t04 w0.5 6 5 4 3 2 1 W S T X X L XXXXXXX L L L L D L L XXXXXX E L L L L L L L L X X X X XXXXXXXXXX X E I L L I V F D L I L E M V L E D S VA F R T X X XXXXX E A G G A S F Y A L XX S T G VX I L A T Y G A S XX E L X X... Date Added: 2009-06-24 14:15:27 |
| P429_Schedule_2008.pdf Path: Virgin Islands >> P >> 429 Fall, 2009 Description: 2008-09 P429 A/B Timetable Date Sept 4 Sept 25 Oct 16 Oct 30 Nov 6 Dec 1 Jan 15 Jan 22 Feb 12 Mar 23 Apr 3 P429A Lab 5 due P429B progress report P429B final presentation P429B final report due P429A Lab 3 due P429A Lab 4 due, oral presentations P429B... Date Added: 2009-06-24 14:15:34 |
| HW7%20Solution%20key.pdf Path: Mines >> EGGN >> 464 Fall, 2008 Description: EGGN 464 Foundations Spring 2008 Homework #7: Deep Foundations, due April 15, Tuesday, 2008 Problem 1 A concrete pile 25 m long with a diameter of 0.5 m is driven into a sand with unit weight of 17 kN/m3 and drained friction angle of 35o. (14.1, 14.2... Date Added: 2009-06-24 14:25:35 |
| HoytWilkins-Vegetation.doc Path: UCSD >> SIO >> 286 Spring, 2008 Description: Kimberly Hoyt And Eric Wilkins Vegetation Introduction Sea level rise is an issue of concern to areas that lie in the transition zone between land and sea. Kendall Frost Reserve is a salt marsh located in the Mission Bay of San Diego California. It ... Date Added: 2009-06-24 14:25:50 |
| ReviewFinalExam.pdf Path: Delta MI >> MTH >> 151 Fall, 2009 Description: MTH 151 1. Review for Final Exam (exam given 08/WI) During the course, we studied many different types of functions. For each of the following graphs, decide which type of function best fits the given curve: linear, quadratic, rational, exponential... Date Added: 2009-06-24 14:25:56 |
| 020105agenda.doc Path: N. Arizona >> JAN >> 020105 Fall, 2009 Description: College of Arts and Letters Curriculum Committee 2-1-2005 3pm (15-201) Agenda 1. Approval of 11-23-04 minutes. 2. Discussion items. 3 Old business. 4. New business. a. English - changes to Extended degree in Education b. English - New course proposal... Date Added: 2009-06-24 14:36:26 |
| NYUStern_MSOM.pdf Path: Berkeley >> ATT >> 0182 Fall, 2009 Description: Department of Information, Operations and Management Sciences Positions in Operations Management The Operations Management Group in the Department of Information, Operations, & Management Sciences at the Stern School of Business, New York University,... Date Added: 2009-06-24 14:37:34 |
| notes_week9.pdf Path: Portland >> MTH >> 410 Fall, 2008 Description: Introduction to the Finite Element Method We introduce the nite element method rst for a one dimensional boundary value problem, then consider the formulation in higher dimensions for elliptic and parabolic problems. Variational formulation of a one-... Date Added: 2009-06-24 14:40:11 |
| assign10.doc Path: Berkeley >> IS >> 213 Spring, 1999 Description: Assignment 10: Interactive Prototype #3 and Final Write-up Suffragists Speak Group: Rosalie Lack Joanne Miller Sally Thomas May 10, 1999 SIMS 213 The Problem The Suffragists Speak group started the semester with a multimedia web site that contained ... Date Added: 2009-06-24 14:41:28 |
| solution_7.2.pdf Path: Washington >> AA >> 360 Fall, 2009 Description: ... Date Added: 2009-06-24 14:42:23 |
| US Forest Service Survey Crew Job Announcement 2007.pdf Path: JMU >> ARCHIVE >> 0408 Fall, 2009 Description: Page 1 of 2 Summer Survey Jobs Available Spend your summer working outdoors on National Forest lands. Employer: U.S.D.A. Forest Service Center for Aquatic Technology Transfer Pay Rate: $11.01 per hr; GS-3 Duration: May 14 August 17, 2007 Job Requir... Date Added: 2009-06-24 14:42:51 |
| Book1.xls Path: U. Houston >> CUIN >> 3111 Fall, 2008 Description: First Name Last name Jennifer Gonzales Veronica Mopps John Hopper Alex Harris Allison Johnson Mary Besson Andrew Foland Michelle Christie Class Math Math Math Math Math Math Math Math Level 8 8 8 8 8 8 8 8 Grade 98 86 67 92 91 88 96 100 ... Date Added: 2009-06-24 14:43:13 |
| hw1.ps Path: Washington >> HW >> 521 Fall, 2009 Description: %!PS-Adobe-2.0 %Creator: dvips(k) 5.92b Copyright 2002 Radical Eye Software %Title: hw1.dvi %Pages: 1 %PageOrder: Ascend %BoundingBox: 0 0 596 842 %EndComments %DVIPSWebPage: (www.radicaleye.com) %DVIPSCommandLine: dvips -o hw1.ps hw1.dvi %DVIPSParam... Date Added: 2009-06-24 14:44:40 |
| Final Review.doc Path: Uni. Westminster >> ATS >> 0417 Fall, 2009 Description: Final Review Unit One 1) Recognize terms related to cellular adaptation to injury: a) 2) What are the most common autosomal recessive disorders? a) 3) Be familiar with the gene pairing required for a) autosomal dominant and/or b) autosomal recessiv... Date Added: 2009-06-24 14:51:02 |
| geog222part1concepts.pdf Path: CC Philadelphia >> GEOG >> 222 Fall, 2009 Description: Geography 222 Part 1: Basic Concepts and Ideas 1. cartography - the recording of data on maps 2. area studies tradition - emphasizes the study of specific regions and an understanding of the varied aspects of those regions 3. earth science tradition ... Date Added: 2009-06-24 14:51:35 |
| slides.ppt Path: WVU >> CSEE >> 200101 Fall, 2009 Description: Visualization in West Virginia Frances L. Van Scoy Co-Project Director, WV EPSCoR 886 Chestnut Ridge Road, P.O. Box 6845 Morgantown, WV 26056-6845 USA fvanscoy@wvu.edu 304-293-2466 Fax 304-293-8155 Alliance Chautauqua at Kentucky August 22-25, 1999 ... Date Added: 2009-06-24 14:51:52 |
| syllabus.pdf Path: NSC Henderson >> GEY >> 712 Fall, 2009 Description: UNIVERSITY OF NEVADA LAS VEGAS GEOLOGY 712 - WATERSHED HYDROLOGY (3 Credits) http:/hydro.nevada.edu/courses/gey712 Zhongbo Yu email: zhongbo@unlv.nevada.edu; Office: LFG 118; Office phone: (702) 895-2447 COURSE DESCRIPTION Concepts and processes cont... Date Added: 2009-06-24 14:51:58 |
| attachment-0001.doc Path: Oregon State >> ENGR >> 20061206 Fall, 2009 Description: JetPropulsionLaboratory(JPL) http:/www.jpl.nasa.gov 2007SpaceGrant InternshipProgram An opportunity for over100 qualified studentsto participate in a tenweeksummer internshipprogramatJPLforSummer2007.Theprogramdatesare June 11 August17,2007. Engine... Date Added: 2009-06-24 14:52:09 |
| attachment.doc Path: Oregon State >> ENGR >> 20061206 Fall, 2009 Description: JetPropulsionLaboratory(JPL) http:/www.jpl.nasa.gov 2007SpaceGrant InternshipProgram An opportunity for over100 qualified studentsto participate in a tenweeksummer internshipprogramatJPLforSummer2007.Theprogramdatesare June 11 August17,2007. Engine... Date Added: 2009-06-24 14:52:42 |
| 312pfinal.pdf Path: Ohio State >> ECE >> 312 Fall, 2008 Description: ECE 312 - Winter Quarter 2007 Final Exam March 12th, 2007 Write your name below and on each sheet of the exam. Sign the honor pledge No aid given, received, or observed if it applies. There are 3 problems on this exam, each with multiple parts. Exam ... Date Added: 2009-06-24 15:01:08 |
| Final_Project_Description_07.doc Path: Washington >> GEOG >> 462 Fall, 2008 Description: Geog 460 Autumn 2006 Final Project Description Introduction The capstone of your Geography 460 experience is a final project accomplished in teams of three. This project will entail GIS data analysis on the topic of your choice under the theme of c... Date Added: 2009-06-24 15:03:10 |
| lec7.ps Path: Harvard >> CS >> 243 Fall, 2009 Description: %!PSAdobe3.0 %Title:(lec7.pdf) %Version:14 %Creator:(TeX) %CreationDate:(D:20030314150000) %DocumentData:Clean7Bit %LanguageLevel:2 %BoundingBox:00792612 %Pages:55 %DocumentProcessColors:(atend) %DocumentNeededResources:(atend) %DocumentSuppliedResou... Date Added: 2009-06-24 15:04:22 |
| Spring99Exam2.pdf Path: Lake County >> ECE >> 430 Fall, 2009 Description: ... Date Added: 2009-06-24 15:06:20 |
| sp1993he2.pdf Path: Lake County >> ECE >> 431 Fall, 2009 Description: ... Date Added: 2009-06-24 15:06:46 |
| 01-speaker_app_to_advisers1.doc Path: UC Davis >> ATT >> 0402 Fall, 2009 Description: UC DAVIS: COLLEGE OF LETTERS AND SCIENCE OFFICE OF THE DEANS February 2004 Department Academic Advisers College of Letters and Science Dear Advisers: Enclosed please find an application form for student commencement speaker for the Saturday, June 1... Date Added: 2009-06-24 15:10:48 |
| lecture10.pdf Path: Lake County >> ECE >> 441 Fall, 2009 Description: 41 42 43 ... Date Added: 2009-06-24 15:12:10 |
| mateo.pdf Path: Oregon State >> ECE >> 441 Fall, 2008 Description: Mateo Mengis 202 NW 10th St. Apt. 201 Corvallis, OR 97330 (541) 908-2839 mengism@onid.orst.edu Education: Oregon State University, Corvallis, Oregon Honors B.S. Pre-Electrical Engineering; expected grad. date: June 2009 3.90 GPA Relevant courses: C... Date Added: 2009-06-24 15:12:17 |
| pentium-m.pdf Path: University of Toronto >> ECE >> 452 Fall, 2009 Description: Volume 07 Issue 02 Published, May 21, 2003 ISSN 1535-864X Intel Technology Journal Intel Centrino Mobile Technology The Intel Pentium M Processor: Microarchitecture and Performance A compiled version of all papers from this issue of the Intel... Date Added: 2009-06-24 15:14:03 |
| lecture2.2.doc Path: Berkeley >> ECON >> 100 Fall, 2005 Description: Application Substitution may Save Endangered Species Many speciestigers, rhinoceroses, pinnipeds, deer, green turtles, geckos, sea horses, pipefishes, and sea cucumbersare endangered, threatened, or vulnerable to extinction partially because certain ... Date Added: 2009-06-24 15:14:54 |
| syllabus_6.pdf Path: Virginia Tech >> CS >> 4254 Fall, 2008 Description: Class Details Instructor: Dr. Srinidhi Varadarajan Office Hours: 10 am 11:00 am Mon-Wed CS4254: Network Architecture and Programming GTAs: John Gordon (jogordo3@vt.edu) Varun Pandey (vnpandey@vt.edu) Office Hours Location: McB 118 Office... Date Added: 2009-06-24 15:20:00 |
| T0393.t06.CB8-sep9-logo.pdf Path: UCSC >> T >> 161 Fall, 2009 Description: T0393.t06 CB8-sep9 2 1 161 170 180 190 200 FAFA 2 1 EDFH I J IG HG FGFADGDAFEA EA EAFGEAG BF 211 220 230 240 250 EA 2 1 E ADAEA FG HJGFE AEGA FEADEA EA F ADGFBDED A 261 ERQ 260 ARKVHELEPKTAQTGPAIRYDENVIGNHLRMLADDPAM... Date Added: 2009-06-24 15:21:21 |
| supplement.pdf Path: Arizona >> ECE >> 479 Fall, 2008 Description: ... Date Added: 2009-06-24 15:21:45 |
| Homework Set 4.doc Path: Mississippi State >> ECE >> 4743 Fall, 2009 Description: All problems refer to the following flowgraph (Y = x* a0 + x@1 * b1 ) Figure 1 X * N3 The schedule for initiation rate = 1, latency =3 and datapath is shown below. Sample A Sample B Sample C Clk N Clk N+1 Clk N+2 Clk N+3 Clk N+4 Datapath A N1( ) N2(*... Date Added: 2009-06-24 15:21:50 |
| Homework Set 4 Solutions.doc Path: Mississippi State >> ECE >> 4743 Fall, 2009 Description: All problems refer to the following flowgraph (Y = x* a0 + x@1 * b1 ) Figure 1 X * N3 The schedule for initiation rate = 1, latency =3 and datapath is shown below. Sample A Sample B Sample C Clk N Clk N+1 Clk N+2 Clk N+3 Clk N+4 Datapath A N1( ) N2(*... Date Added: 2009-06-24 15:21:51 |
| QuestionFinal.pdf Path: Université du Québec à Montréal >> INFO >> 4170 Fall, 2009 Description: eey | @ciips | ws 5e@dddr | w}srr$pre\"cDy #cesdddrri { h yh r r y h s y y y g h | sh h r g r g y h r s w@Hyr @crd@p}@dywes\"edy\"wsdddrriDey h | @ iws pe e| cy wps~ dr r|yx sye ery s |wsr ~y pdye{ r ewesdg@reSei@ yiheuey w@s | ws DF ... Date Added: 2009-06-24 15:22:33 |
| ECE486_finalproj_Fa2008.pdf Path: Lake County >> ECE >> 486 Fall, 2009 Description: 1 Name: RWP #: (painted on base of RWP) ECE 486 Final Project: The Reaction Wheel Pendulum Fall 2008 ECE 486 i Contents 1 Introduction. 1 1.1 1.2 2 The Reaction Wheel Pendulum . 1 Derivation of Mathematical Model. 1 Friction Identification Usi... Date Added: 2009-06-24 15:23:15 |
| oracle090903.pdf Path: Hamline >> ORACLE >> 090203 Fall, 2009 Description: the Published for 115 years at Minnesota\'s first university Tuesday, Sept. 9, 2003 Vol. 115 No. 2 Student leaders convince Residential Life adopts administration to invest in merit-based system for social responsibility fund room selection Member... Date Added: 2009-06-24 15:23:17 |
| hw7.pdf Path: Ohio State >> EE >> 341 Fall, 2009 Description: E 341 ENERGY CONVERSION The Ohio State University Department of Electrical Engineering EE 341 Energy Conversion Homework Set # 7 Print Your Name _ E 341 ENERGY CONVERSION Reading Assignments: 1. Chapter 6: AC Synchronous Motors Page 324~341 ... Date Added: 2009-06-24 15:23:52 |
| class15.pdf Path: UVA >> CS >> 150 Fall, 2008 Description: Objectifying and Programming with Objects One-Slide Summary Real databases, unlike PS5, have many concerns, such as scalability and atomic transactions. An object packages state and procedures. A procedure on an object is called a method. We invo... Date Added: 2009-06-24 15:24:18 |
| degen.pdf Path: SUNY Stony Brook >> PHY >> 521 Fall, 2009 Description: 1 Compact Stars White Dwarfs, Planets, Neutron Stars White dwarf structure dominated by P () for degenerate electron gas. (n + 1) K 1/2 (1n)/(2n) 1 R= c 4G (n + 1) K M = 4R(3n)/(1n) 4G n/(n1) 1 (3n)/(n1) 2 1 1 (n + 1) K 3/2 (3n)/(2n) 2 c 1 1 . ... Date Added: 2009-06-24 15:25:32 |
| 103quiz2.pdf Path: SUNY Stony Brook >> MAP >> 103 Fall, 2008 Description: Quiz II - MAP 103 Date 07/26/06 - Duration 20 minutes NO CALCULATORS SUNYSB Id No. : Name : Problem 1 Solve : (i) x 2 and x 0. (ii) x 7 1 and |x| 4. Problem 2 Write an equation of a line that passes through (1, 1) and (2, 3). What is the sl... Date Added: 2009-06-24 15:30:08 |
| hw8.ps Path: Virginia Tech >> CS >> 4234 Fall, 2008 Description: %!PS-Adobe-2.0 %Creator: dvipsk 5.58f Copyright 1986, 1994 Radical Eye Software %Title: hw8.dvi %Pages: 1 %PageOrder: Ascend %BoundingBox: 0 0 612 792 %DocumentFonts: cmbx10 cmr10 %EndComments %DVIPSCommandLine: /usr/local/tex3.14159/bin/dvips -o hw8... Date Added: 2009-06-24 15:31:34 |
| SampleReferencePage.pdf Path: Salisbury >> EDUC >> 502 Spring, 2008 Description: This is exactly how your reference page will look REFERENCES Glesne, C. (1999). Becoming qualitative researchers: an introduction. New York: Longman. Haller, E.J. & Kleine, P.F. (2001). Using educational research: a school administrators guide. New ... Date Added: 2009-06-24 15:38:46 |
| hw3Sp2008soln.pdf Path: Mich Tech >> CM >> 5300 Spring, 2008 Description: CM 5300, Advanced Transport Phenomena Homework #3 Spring 2008 Mon. 11 Feb., 2008 1. Problem 3B.10 2. Comparison of Solutions to the Time-Dependent Eqn. of Motion Equations 4.1-15 and 4.1-40 are solutions to the time-dependent equation of motion fo... Date Added: 2009-06-24 15:39:58 |
| Ass#6.pdf Path: Hudson VCC >> MATH >> 020 Fall, 2009 Description: Assignment 6 (28 Points) Chapter 7 Name_ Spring 2008 Math 20 Form A Directions: Read each question carefully and answer as clearly as possible. You may want to do your work on another sheet of paper and staple it to this sheet. Due Date: End of Cla... Date Added: 2009-06-24 15:40:43 |
| syllabus131.pdf Path: SUNY Stony Brook >> MAT >> 131 Summer, 2008 Description: CALCULUS I MAT 131, SPRING 2008 Prerequisites In order take Mat 131 you must have either passed Mat 123 or Mat 130 with a C or better, or have received a score of 5 or better on the mathematics placement exam. Lecturers: Lecture 1 (MWF 9:35am-10:30am... Date Added: 2009-06-24 15:41:47 |
| applications-of-homology.pdf Path: University of Toronto >> MAT >> 1300 Fall, 2009 Description: 9.5 Applications of Homology Z 0 q = 0, n otherwise. First we need some calculations. Theorem 9.5.1 Suppose n > 0. Then Hq (S n ) = Proof: By induction on n using Mayer-Vietoris. Corollary 9.5.2 S n is not homotopy equivalent (and in particular not... Date Added: 2009-06-24 15:44:15 |
| 4a.pdf Path: University of Toronto >> MAT >> 368 Fall, 2009 Description: Y t TF# u h \" H q H fSI9gf6 q \' U5 b ` U X i G U5 U5 i U U\' E ` U z 5 ` X q wy w v u U t f3QfidTS6e!~eiT}eTgce|6ebTeFfWTm$\'{!(S!vghW# s xffV$mB\" s ywu t s q xxvPrp \"eer#Wq$\'WpS9k9glhd#Qon@mlexajigShg6fegT6cTf$\'U... Date Added: 2009-06-24 15:44:20 |
| capstone_gleach.pdf Path: Hamline >> FAS >> 270 Fall, 2009 Description: 62 A STUDY OF THE /O/ PHONEME AS PRONOUNCED BY WOMEN IN MORRISON, CARVER, AND LE SUEUR COUNTIES IN MINNESOTA by Gretchen Leach A Capstone submitted in partial fulfillment of the requirements for the degree of Master of Arts in English as a Second ... Date Added: 2009-06-24 15:45:40 |
| Ch11_12_Review.pdf Path: N. Arizona >> SMG >> 224 Fall, 2009 Description: MAT 155 Chapter 11/12 Review Study Guide: Define each of the following. Provide an example of each. For the test, you may create and bring in one 3/5 card. No other materials will be allowed, unless provided by the instructor. Chapter 11 Transformati... Date Added: 2009-06-24 15:45:46 |
| 060304_044047_detune27_obs_CENTRALHOLE.ps Path: Stanford >> SOI >> 060303 Fall, 2009 Description: %!PS-Adobe-3.0 %BoundingBox: 0 28 425 651 %Title: Graphics produced by IDL %For: couvidat@stitch.Stanford.EDU, /auto/scr20/couvidat/HMI %Creator: IDL Version 6.1.1 (linux x86 m32) %CreationDate: Mon Mar 6 17:58:20 2006 %DocumentData: Clean7bit %Requi... Date Added: 2009-06-24 15:46:28 |
| T0501.t2k.dssp-ehl2-logo.pdf Path: UCSC >> T >> 0501 Fall, 2009 Description: T0501.t2k dssp-ehl2 2 1 10 20 30 40 H 2 1 E H 51 60 70 80 90 E 2 1 H H E 101 110 120 130 140 H 2 1 E E H 151 160 170 180 190 H 2 1 H 201 210 220 230 240 H 2 1 H E E H 251 260 270 280 290 H 2 1 E E H ... Date Added: 2009-06-24 15:47:28 |
| Latin Case Usage.doc Path: San Diego State >> CLASSICS >> 303 Fall, 2009 Description: from Prof. Cook (9/08) Use of Cases WITHOUT Prepositions (gen. Lodge, AG = Allen CL = Classical Latin Genitive (#1-7 w/ nouns, #8 w/ adjectives, #9-... Date Added: 2009-06-24 15:47:43 |
| fns2005poster.pdf Path: East Los Angeles College >> MD >> 273 Fall, 2009 Description: 15TH INTERNATIONAL CONFERENCE FRIEDRICH NIETZSCHE SOCIETY OF GREAT BRITAIN AND IRELAND fns2005 Keynote Speakers Raymond Geuss (Cambridge University, UK) Lawrence J. Hatab (Old Dominion University, USA) Paul S. Loeb (University of Puget Sound, USA)... Date Added: 2009-06-24 15:48:00 |
| Council Agenda 1129.pdf Path: University of Iowa >> C >> 030111 Fall, 2009 Description: City of Camelot Council Meeting Fifth Session of Simulation 11/29/05 Agenda 1. 2. 3. 4. Call to Order. Roll Call. Corrections or additions to minutes from November 17, 2005. Old Business: a. Massage Parlor request for a special use permit for the pro... Date Added: 2009-06-24 15:58:11 |
| YJL061W.t2k.str2-logo.pdf Path: UCSC >> YJL >> 061 Fall, 2009 Description: YJL061W.t2k STR2 3 2 1 CC X H H H H H H H H H C H H H C C C S H C H X X X X X X X X X X X X X X XX C C T S C H T H H X H H H XGGXXXXXXXXZXXXSQCXXXXXXXHHXHHH X X X X X X X XXX H Z TC S C S A Y H C YMY CYT CTYHHSSCCTYMQPQQHTT Q C T C H C P Z ... Date Added: 2009-06-24 16:03:28 |
| YJL047C-A.t2k.w0.5-logo.pdf Path: UCSC >> YJL >> 047 Fall, 2009 Description: YJL047C-A.t2k w0.5 1 1 10 20 30 E H H T E T E 40 CI I I I I L LL Y LVIGEGP GE IVE F E E E XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX MK IKI SIEISLSL LSEHYKRNENCISN M L V IG E G PR G E TI V ER F M L V I L V L V L V L V K K I V I ... Date Added: 2009-06-24 16:03:51 |
| jainism.ppt Path: Northern Virginia >> REL >> 231 Fall, 2009 Description: What is Jainism? At least 2500+ years old Followed by 3 - 4 million people mostly in India Life affirming but world-denying Seeks to release the soul from the round of rebirth, to liberate spirit from matter Ahimsa non-violence is the hallm... Date Added: 2009-06-24 16:07:34 |
| c2670.txt Path: Wisconsin >> ECE >> 556 Spring, 2001 Description: 1193 2076 233 64 1426 pri 1 0 pri 1 0 pri 1 0 pri 1 0 pri 1 0 pri 1 0 pri 1 0 pri 2 0 pri 2 0 pri 1 0 pri 1 0 pri 2 0 pri 1 0 pri 1 0 pri 1 0 pri 1 0 pri 1 0 pri 1 0 pri 1 0 pri 1 0 pri 1 0 pri 1 0 pri 2 0 pri 1 0 pri 1 0 pri... Date Added: 2009-06-24 16:08:32 |
| Why we should fear a McCain presidency.pdf Path: Texas A&M >> FINC >> 645 Fall, 2008 Description: ... Date Added: 2009-06-24 16:09:43 |
| 536.announcement.2007.pdf Path: SUNY Stony Brook >> AMS >> 532 Fall, 2008 Description: Spring Course Announcement: AMS-536 Molecular Modeling of Biological Molecules Dr. Robert C. Rizzo: Mon/Wed, 2:20-3:40 PM, Room S235, MATH TOWER SINC SITE Class schedule and syllabus: http:/www.ams.sunysb.edu/~rizzo (go to Teaching) Dear Stony Brook... Date Added: 2009-06-24 16:17:41 |
| McGuireRedoxSlides.pdf Path: Texas A&M >> GEOL >> 641 Fall, 2008 Description: Quantifying Redox Evolution in an Aquifer Contaminated with Waste Fuels and Chlorinated Solvents Wurtsmith Air Force Base Oscoda, MI, USA Collaborato rs MSU/USGS Research Team Geochemistry Team: Jennifer McGuire*, David Long, and Michael Velbel Hydr... Date Added: 2009-06-24 16:18:17 |
| ilx00z.txt Path: University of Illinois, Urbana Champaign >> ATMOS >> 20090323 Fall, 2009 Description: UPPER AIR CALCULATIONS AND PLOTTING (Ver 5.49-LINUX-X11) Current filename: /mnt/noaaport/nwstg/convert/09032312_upa.wxp Date: 1200Z 23 MAR 09 Searching for KILX. Searching the city database file for: KILX . Date:1200Z 23 MAR 09 Station: KILX W... Date Added: 2009-06-24 16:20:11 |
| Alpha-21264.ppt Path: Duke >> CPS >> 220 Fall, 2009 Description: The Alpha 21264 Microprocessor: Out-of-Order Execution at 600 MHz R. E. Kessler Compaq Computer Corporation Shrewsbury, MA REK August 1998 1 Some Highlights Continued Alpha performance leadership 600 MHz operation in 0.35u CMOS6, 6 metal layers,... Date Added: 2009-06-24 16:21:38 |
| spring2009practicefinal.pdf Path: Washington >> INDE >> 412 Fall, 2009 Description: Practice Final Exam INDE 412 Spring 2009 PROBLEM 1a (6 points) Consider a two-person zero-sum game with the following payoff table. Strategy 1 2 Player 1 3 4 5 1 6 1 2 -5 7 Player 2 2 4 9 3 -2 4 3 -3 6 8 10 -2 4 -7 0 4 -3 -5 Identify and eliminate d... Date Added: 2009-06-24 16:23:09 |
| Two Variable NLP Practice.pdf Path: UMBC >> MT >> 235 Fall, 2009 Description: MT235.01/03 Spring 2009 Two Variable NLP Practice Problems For the following unconstrained functions, find all points (x,y) where f(x,) has a possible relative maximum or minimum. Then use the second-derivative test to determine the nature of f(x,y)... Date Added: 2009-06-24 16:24:50 |
| 20483.txt Path: UNC >> DOCS >> 20483 Fall, 2009 Description: The Project Gutenberg EBook of Artillery Through the Ages, by Albert Manucy This eBook is for the use of anyone anywhere at no cost and with almost no restrictions whatsoever. You may copy it, give it away or re-use it under the terms of the Projec... Date Added: 2009-06-24 16:26:47 |
| 20617.txt Path: UNC >> DOCS >> 20617 Fall, 2009 Description: Project Gutenberg\'s Young Wild West at \"Forbidden Pass\", by An Old Scout This eBook is for the use of anyone anywhere at no cost and with almost no restrictions whatsoever. You may copy it, give it away or re-use it under the terms of the Project G... Date Added: 2009-06-24 16:30:45 |
| Chapter 3.pdf Path: University of West Georgia >> PPT >> 6080 Fall, 2009 Description: Ethical Issues Privacy Chapter 3 Ethics, Privacy, and Information Security Individuals vs. Society Accuracy Man of the Year Property Could I have the credit card company to delete my data? Accessibility Who will my data be shared with? Informat... Date Added: 2009-06-24 16:34:33 |
| galuchie Intro w comments.doc Path: Middlebury >> AC >> 023 Fall, 2009 Description: INTRODUCTION Music and politics have a long relationship in the United States. Americans saw constant interaction between the two in the 1990s. Issues such as race, voting, and First Amendment rights were all addressed within this decade. It was thro... Date Added: 2009-06-24 16:41:20 |
| MTTS7.doc Path: Salisbury >> EDUC >> 07461 Fall, 2009 Description: DearMrs.Smith, Itisgreatnewstomethatyouarewritingagrantproposalforourstudentstoreceivenew technologiesintheclassroom.Aseducatorsitisimportantforustopushourstudentstoembrace thechangingworldandbecometechnologicallyliteratebecauseitiswhattheywillseeint... Date Added: 2009-06-24 16:53:53 |
| PE4.pdf Path: Santa Barbara City >> CHEM >> 155 Summer, 2008 Description: S a n ta B a rb a ra C ity C o lle g e E ric B u llo c k Chem 155 Practice Exam #4 This exam covers Ch 7.5 through Ch. 10. Any sections not covered in class are not on this exam. *Show all your work for problems 16) - 20) *Always use correct signif... Date Added: 2009-06-24 16:55:22 |
| Hwk2.xls Path: Colorado >> ATOC >> 1050 Fall, 2008 Description: Enter question number: _ Temperature vs. Height chart 5 4 Height (km) 3 2 1 0 -20 -10 0 10 20 30 Temperature Height 0 1 2 3 4 5 Temperature -20 -10 0 10 20 30 ... Date Added: 2009-06-24 17:07:02 |
| pingping-wholebookrecognition.pdf Path: Lehigh >> PIX >> 206 Fall, 2009 Description: Towards Whole-Book Recognition Pingping Xiu Engineering Dept Lehigh University 19 Memorial Drive West, Bethlehem, PA 18017 USA E-mail: pix206@lehigh.edu, baird@cse.lehigh.edu URL: www.cse.lehigh.edu/pix206, www.cse... Date Added: 2009-06-24 17:17:00 |
| Chapter 09.ppt Path: N.E. Illinois >> CS >> 317 Fall, 2009 Description: MicrosoftVisualBasic2005 CHAPTER9 Using Arrays and File Handling 9 Objectives Initialize an array Initialize an array with default values Access array elements using a loop Use ReDim to resize an array Chapter 9: Using Arrays and File Handling ... Date Added: 2009-06-24 17:20:04 |
| lec1_slides_me123.ps Path: W. Alabama >> GEN >> 123 Fall, 2009 Description: %!PS-Adobe-2.0 %Creator: dvips 5.58 Copyright 1986, 1994 Radical Eye Software %Title: lec1_slides_me123.dvi %CreationDate: Mon May 24 21:55:55 1999 %Pages: 8 %PageOrder: Ascend %BoundingBox: 0 0 612 792 %EndComments %DVIPSCommandLine: _dvips lec1_sli... Date Added: 2009-06-24 17:24:15 |
| 710.txt Path: UNC >> DOCS >> 710 Fall, 2009 Description: The Project Gutenberg eBook, Love of Life, by Jack London, Illustrated by Charles Livingston Bull This eBook is for the use of anyone anywhere at no cost and with almost no restrictions whatsoever. You may copy it, give it away or re-use it under ... Date Added: 2009-06-24 17:24:59 |
| 5410.txt Path: UNC >> DOCS >> 5410 Fall, 2009 Description: The Project Gutenberg EBook of The Memoirs of Count Grammont, Volume 2 by Anthony Hamilton This eBook is for the use of anyone anywhere at no cost and with almost no restrictions whatsoever. You may copy it, give it away or re-use it under the term... Date Added: 2009-06-24 17:27:14 |
| 23689.txt Path: UNC >> DOCS >> 23689 Fall, 2009 Description: The Project Gutenberg EBook of The Continental Monthly, Vol 6, No 5, November 1864, by Various This eBook is for the use of anyone anywhere at no cost and with almost no restrictions whatsoever. You may copy it, give it away or re-use it under the ... Date Added: 2009-06-24 17:28:28 |
| YML130C.t2k.alpha-logo.pdf Path: UCSC >> YML >> 130 Fall, 2009 Description: YML130C.t2k ALPHA 3 2 1 H X 1 10 20 30 40 H 3 2 1 I E S SE AE SEHE ABDSE BH TA II IIHHH XXXXEXXHXXXXX B C S ABCH EE A X B H HH S I X G I I I I I S H H I S I I S S S G S X X X X X X X X X X X H HI HHHHHH 70 IEISAE G H B A IIIIH... Date Added: 2009-06-24 17:31:09 |
| Krista Hronakes hw #2 .doc Path: Penn State >> ENVE >> 451 Fall, 2009 Description: Krista Hronakes Homework assignment #2 1. 2. Still having problems The daily flow capacity of the sandstone aquifer is: Q= -KA dh/dr Q=-(6*10^-7m/sec)(2000m)(800m)(3m) 2000m Q= -.00144 m 3/ day The flow is going again the hydraulic head 3. Hydrogra... Date Added: 2009-06-24 17:35:38 |
| lecture25pdf.pdf Path: Penn State >> ENVE >> 451 Fall, 2009 Description: Goals/Learning Objectives Goal(s): Gain an understanding of what integrated pest management (IPM) is and how it is used to manage insect pests. Slide Index Goals/Learning Objectives Insect Pest Management IPM: The Scenario. Map Some more information.... Date Added: 2009-06-24 17:35:39 |
| 200047_r01n_981664.pdf Path: Stanford >> CD >> 1002 Fall, 2009 Description: IN THE UNITED STATES DISTRICT COURT FOR THE DISTRICT OF NEW JERSEY x : : Master File No. :98-1664 (WHW) : : This document relates to: :All Actions Except the Prides Action (No. 98-2819) x NOTICE OF SETTLEMENT OF CLASS ACTION TO: ALL PERSONS AND ENT... Date Added: 2009-06-24 17:36:49 |
| Cells.ppt Path: N. Georgia >> MESUBL >> 2834 Fall, 2009 Description: Nucleus Endoplasmic Reticulum Golgi Mitochondrion Lysosomes Vacuoles Cell Membrane Simple Structure No recognizable organelles Most bacteria Flagella/Pili Nucleoid (DNA) Cell Wall Higher level structures Transport System Larger in size Plant and An... Date Added: 2009-06-24 17:37:37 |
| lbf12z.txt Path: University of Illinois, Urbana Champaign >> ATMOS >> 20081110 Fall, 2009 Description: UPPER AIR CALCULATIONS AND PLOTTING (Ver 5.48.1-LINUX-X11) Current filename: /mnt/noaaport/nwstg/convert/08111000_upa.wxp Date: 0000Z 10 NOV 08 Searching for KLBF. Searching the city database file for: KLBF . Date:0000Z 10 NOV 08 Station: KLBF... Date Added: 2009-06-24 17:37:54 |
| MidReviewS07.pdf Path: Dallas >> CS >> 4347 Fall, 2008 Description: ! !# \"$% \" $\' , ., / ., 1 $ , , / , $! $ , 2 , 0 -3 / 4 / - 35 4 6 4 \" 1 3 4 .3 , , . , / ! 8 # / $ ( 4 0 , , $ , $ 4 $ $ ... Date Added: 2009-06-24 17:38:37 |
| ep_nfl_dat.txt Path: Berkeley >> ASTRO >> 00113120 Fall, 2009 Description: # Ep dEp lprob lNiso dlNiso 164.831 0.135 -2.00e-04 138.971 0.185 164.966 0.142 -2.25e-04 138.971 0.185 165.118 0.163 -3.29e-04 138.971 0.185 165.292 0.186 -5.08e-04 138.971 0.185 165.492 0.213 -1.36e-03 138.971 0.185 165.720 0.244 -9.37e-04 138.971 ... Date Added: 2009-06-24 17:47:43 |
| sheet2.pdf Path: Concordia Chicago >> MATH >> 163 Fall, 2008 Description: Sheet 2: Series Ian Biringer and John Lind Denition 1 A series of real numbers is an expression an R. n=1 an , where each The data needed to dene the series i=0 an is no dierent than that needed for the sequence (an ), but for the series the ter... Date Added: 2009-06-24 17:47:53 |
| Lecture 6 - DAB.ppt Path: UNLV >> BIOL >> 251 Summer, 2008 Description: Environmental Microbiology Talaro Chapter 26 1 Environmental Microbiology Study of microbes in their natural habitats Microbial Diversity study of the different types of microbes in an environment Microbial Ecology Studies the interactions b... Date Added: 2009-06-24 17:53:59 |
| Chapter12.xls Path: YCP >> ACC >> 220 Fall, 2009 Description: CHAPTER 12 INCOME AND CHANGES IN RETAINED EARNINGS OVERVIEW OF BRIEF EXERCISES, EXERCISES, PROBLEMS, AND CRITICAL THINKING CASES Brief Exercises B. Ex. 12.1 B. Ex. 12.2 B. Ex. 12.3 B. Ex. 12.4 B. Ex. 12.5 B. Ex. 12.6 B. Ex. 12.7 B. Ex. 12.8 B. Ex. 12... Date Added: 2009-06-24 17:55:48 |
| outline2.pdf Path: UCLA >> POLISCIM >> 139 Spring, 2009 Description: ... Date Added: 2009-06-24 18:00:48 |
| Both urea key.doc Path: Grossmont >> CHEMISTRY >> 141 Fall, 2009 Description: Chem 141 Quiz 2 (24 pts) Fall 2007 Name_key_ Instructor: Martin Larter Last First 1. Both urea, (NH2)2CO, and guanidine, HNC(NH2)2, are used as fertilizers that contribute nitrogen to the soil. Which one of these compounds is the richer source of... Date Added: 2009-06-24 18:05:37 |
| freeburg.doc Path: University of Hawaii - Hilo >> ICS >> 311 Fall, 2009 Description: ICS 311 Fall 2006 Matt Freeburg freeburg@hawaii.edu Subway Network Decontamination: Problem Formulation The following problem formulation models a subway network that has become contaminated with a hazardous substance and a set of machines which ar... Date Added: 2009-06-24 18:08:48 |
| Stech.xls Path: UPR Mayagüez >> ICOM >> 6005 Fall, 2009 Description: Sheet1 vti_encoding:SR|utf8-nl vti_timelastmodified:TR|21 Jan 2005 21:13:42 -0000 vti_extenderversion:SR|5.0.2.6738 vti_author:SR|LAPTOP-MR\\Administrator vti_modifiedby:SR|LAPTOP-MR\\Administrator vti_timecreated:TR|21 Jan 2005 21:13:42 -0000 vti_cach... Date Added: 2009-06-24 18:09:07 |
| 209 - Final - OUTLINE 2008 Path: Cornell >> PORT >> 2090 Fall, 2008 Description: Portugus 209 Fall 2008 Provinha Final - Seo 1 Nome _ # _ Nota _ I- 20 PONTOS - TUDO vs. TODO. Ateno : Por favor, deixe em BRANCO ou RISQUE as perguntas que no vai responder! Use um artigo quando necessrio. Em algumas questes voc tem que decidi... Date Added: 2009-06-25 15:02:51 |
| EC_ch07-case.ppt Path: Gonzaga >> MBUS >> 676 Fall, 2009 Description: Ch7 (#2) - Discussion Board Suppose a manufacturer uses an outside shipping company. How can the manufacturer use an exchange to arrange for the best possible shipping? How can a shipment status be tracked? The manufacturer can consult an exchange ... Date Added: 2009-06-25 18:17:39 |
| emailresponse.doc Path: Georgia Tech >> CEE >> 200202 Fall, 2009 Description: Hi member1 Be careful about declaring your assignment is too broad. You are expected to provide your classmates with an overview of the kinds of components that are used in mechanical systems, with symbols. Here are some ideas: springs, dampers, mass... Date Added: 2009-06-25 18:20:37 |
| Routing.ppt Path: Michigan State University >> CSE >> 838 Fall, 2009 Description: Packet Routing Moon Jung Chung 06/18/09 CSE838 Lecture notes copy right: Moon Jung Chung Routing-1 One to many (multi-casting) (i) Spread (ii) Distribute data (iii) One-to-one route Example: A -> {2,3,4}, B={6}, C -> {7}, D -> {0,5} Spread: dis... Date Added: 2009-06-25 18:25:29 |
| Activity Sheet[1].doc Path: N. Georgia >> KAPHIL >> 8284 Fall, 2009 Description: While listening to each group present, fill out the information asked below. 1. Historic Place _ 2. State _ 3. What is it? _ 4. List 3 interesting facts 1. 2. 3. 1. Historic Place _ 2. State _ 3. What is it? _ 4. List 3 interesting facts 1. 2. 3. ... Date Added: 2009-06-25 18:31:12 |
| sitemap1.0.ppt Path: Texas A&M >> CPSC >> 489 Fall, 2008 Description: Welcome HowNottoBeSeen TheKnights WhoSayNi ThePetShop Lesson1 TheForest ofHiding TheForest ofManyPaths TheForestof BrokenLinks DeadLinks Lesson2 TheLabyrinth Shrub1 Run Away! TheKnightsWho SayEcky. Design HyperReal Shrub2 Misleading links Th... Date Added: 2009-06-25 18:31:48 |
| IAT201_Week11.pdf Path: Sveriges lantbruksuniversitet >> IAT >> 201 Fall, 2009 Description: (More) Evaluation IAT 201 Week 11 Lyn Bartram 1 Administrivia Q u iz h a n d o u ts in w o r k s h o p s to d a y A s s ig n m e n t 4 r e tu r n Much improved - Congratulations! R e v ie w w h a t s r e m a in in g Evaluate your prototy... Date Added: 2009-06-25 18:31:59 |
| 05060613.pdf Path: Wisconsin >> SH >> 050606 Fall, 2009 Description: ... Date Added: 2009-06-25 18:33:13 |
| bsper10.txt Path: UNC >> DOCS >> 2905 Fall, 2009 Description: Project Gutenberg Etext of The Burning Spear, by John Galsworthy #18 in our series by John Galsworthy Copyright laws are changing all over the world, be sure to check the laws for your country before redistributing these files! Please take a look a... Date Added: 2009-06-25 18:36:19 |
| 74.pdf Path: Oregon State >> MTH >> 632 Fall, 2008 Description: Section 74 Def: ! Polygonal region defined by p 0,!, p n on a circle. ! Vertices, edges of region. ! Orientation of edges. ! Labeling of edges. ! Labeling scheme of length n. ! Quotient space obtained from labeling scheme. Thm: If X is obtained from ... Date Added: 2009-06-25 18:37:39 |
| Lecture12.ppt Path: Alabama >> CS >> 491 Fall, 2008 Description: ComputerSecurity Lecture12 PhillipG.Bradford ComputerScience UniversityofAlabama LectureOutline ReviewLastLecture PGPContinued SecretSharing ThresholdSchemes RecallThresholdSchemes (k,n)ThresholdScheme Datainitiallyinonepiece ADe... Date Added: 2009-06-25 18:38:36 |
| gregory.pdf Path: New Mexico >> CS >> 460 Spring, 2008 Description: Project Proposal Edu-Gamer An Educational Game for the OLPC William Gregory wkgrego@unm.edu (505) 553-0914 Executive Summary This proposal details an entertaining and educational tool for the One Laptop per Child campaign. The intent of this project... Date Added: 2009-06-25 18:41:04 |
| 2005_2006AmeriCorpsPipeline-0001.doc Path: Washington >> MAILMAN >> 20050513 Fall, 2009 Description: WashingtonCampusCompact CampusConnectionsProgram UniversityofWashington PipelineProjectCoordinatorAmeriCorpsPositionDescription WashingtonCampusCompactisastatewidecoalitionofcollegeanduniversitypresidents whohaveunitedtofurtherthecivicpurposesofhighe... Date Added: 2009-06-25 18:43:51 |
| lect10.ppt Path: Mines >> EGGN >> 512 Fall, 2009 Description: EGGN 512 - Notes Having OpenCV problems? Try using the previous version (v 1.0) Notes on HW3 Today Deformable models (5.4) Pose estimation (Ch 11) Notes on HW3 Problem 1 Moravec operator may detect interest points close to the image boundar... Date Added: 2009-06-25 18:44:32 |
| p34_048.pdf Path: St. Michael >> CH >> 212 Fall, 2009 Description: 48. We use the law of refraction (assuming nair = 1) and the law of sines to determine the paths of various light rays. The index of refraction for fused quartz can be found in Fig. 34-19. We estimate nblue = 1.463, ny g = 1.459, and nred = 1.456. Th... Date Added: 2009-06-25 18:47:53 |
| 313hw11.pdf Path: George Mason >> MATH >> 313 Fall, 2008 Description: 36bzzry,fetlr /=/\' ho-17-*,Iznl. 1-4 % 4t, 4?<,at) s *#il-1 ted z,r,iinl = ryEl*izT, l;deaEq-rl:b :EFl-ffi. =M;y*5.* ffiuo o+L s*d -P =+. )\' (84 +{) i tf +flJ{fttt\'/ frTtZ)(fA*) \' tfl nf )-to-y\' Z ,4f rJe*\'dt-* t4-=77a a f\'t/)... Date Added: 2009-06-25 18:48:11 |
| messagerecs.pdf Path: Temple >> USB >> 607 Fall, 2009 Description: Temple University Capital Campaign Message Recommendations September 2005 The Message Development Process Part 1: Identifying Potential Messages Through Interviews and Focus Groups: David Adamany Alumni Donors Howard Gittis Undergraduate students ... Date Added: 2009-06-25 18:51:35 |
| i55058p.pdf Path: LSU >> I >> 55058 Fall, 2009 Description: Department of Defense INSTRUCTION NUMBER 5505.8 June 6, 2000 IG, DoD SUBJECT: Investigations of Sexual Misconduct by the Defense Criminal Investigative Organizations and Other DoD Law Enforcement Organizations References: (a) DoD Instruction 5505.8... Date Added: 2009-06-25 18:52:13 |
| His 200S06.doc Path: N. Arizona >> SSR >> 200 Fall, 2009 Description: His200 HistoriansandtheStudyofHistory Spring2006 3credithours Time:T,Th9:3510:50LA203 Instructor:ScottS.Reese Office:LA345 Tel.:5239049 Email:scott.reese@nau.edu OfficeHours:11:301pmT,Th,W121andbyappointment CourseURL:http:/jan.ucc.nau.edu/~ssr7/HIS... Date Added: 2009-06-25 18:55:13 |
| ex_viscosite.pdf Path: Stetson >> CTN >> 326 Fall, 2009 Description: ... Date Added: 2009-06-25 18:56:27 |
| Assign4Solutioins.pdf Path: Virgin Islands >> MECH >> 335 Fall, 2009 Description: ... Date Added: 2009-06-25 18:59:04 |
| hw6.2004.pdf Path: UF >> STAT >> 6934 Fall, 2009 Description: HW 6 for Stat 6934 - Spring 2004 Due February 25, 2004 Reading in text for this assignment Chapter 12-13 for next week, Chapter 14 1. by hand Ch 12/7 2. using SAS Ch 12/10,11 for problem 11 also do run a 2-way factorial ANOVA using gender and ... Date Added: 2009-06-25 18:59:15 |
| gradebook1.xls Path: Central Mich. >> EDU >> 221 Fall, 2009 Description: JulieButzier Spring2005 EDU290 HW1 HW2 HW3 HW4 HW5 AVGHW Q1 Q2 Q3 AVGQ Final AVGHW AVGQ FinalGrade 30% 45% 25% 98 89 88 99 65 77 82 96 89 85 99 67 78 81 94 90 83 98 70 79 84 90 87 80 96 66 77 76 98 88 86 99 69 78 67 95 89 84 98 67 78 78 95 95 88 86 ... Date Added: 2009-06-25 19:00:03 |
| HW2.pdf Path: Colby >> MA >> 374 Fall, 2009 Description: MA374 Fall 2007 Homework 2 Due 9/24/2007 Homework Policies: Working in groups is absolutely fine but you must write up your own answer in your own words. Homework is due at the beginning of class on the day indicated. (1) T... Date Added: 2009-06-25 19:03:00 |
| Enonce_Lab3.pdf Path: Université du Québec à Montréal >> M >> 224674 Fall, 2009 Description: nonc du laboratoire n 3 BUT : Le but de la ralisation troisime laboratoire est : dappliquer les connaissances acquises dans le cours pour expliciter les besoins ncessaires la conception du logiciel du SGSJS, TRAVAIL DEMAND : Le travail demand cons... Date Added: 2009-06-25 19:03:35 |
| 67953_1.pdf Path: Pittsburgh >> AEI >> 9969 Fall, 2009 Description: ... Date Added: 2009-06-25 19:04:03 |
| week7.pdf Path: Allan Hancock College >> MATH >> 133 Fall, 2009 Description: Math 133 - Mathematics IB (Advanced) Tutorial ProblemsWeek 7 2006d2 Algebra 1. For each matrix A, nd the (real) eigenvalues; for each eigenvalue, nd a basis for the eigenspace. If it is possible, nd an invertible matrix P and a diagonal matrix D su... Date Added: 2009-06-25 19:07:31 |
| reqV1T3.pdf Path: Delaware >> REQ >> 475 Fall, 2009 Description: The CourseCheck Graduation Requirement Verication System CISC475/675 Spring 2009 Team 3 Ryan Clemens Eric Dramstad Michael MacMillan Narasimhan Ragavendran February 27, 2009 Contents 1 Part I Introduction 2 This document describes CourseCheck ,... Date Added: 2009-06-25 19:07:33 |
| PS8_key.pdf Path: Montana >> CHEM >> 141 Fall, 2008 Description: Chemistry 141 Problem set 8 1) Which of the following bonds would be the least polar yet still be considered polar covalent? Explain your assignment in each case. For those that are polar indicate the dipole. a) Mg-O ionic b) C-O polar CO ( EN 2.6... Date Added: 2009-06-25 19:15:30 |
| syllabi.txt Path: CSU San Bernardino >> CS >> 320 Fall, 2009 Description: .Open CS320 High-Level Computer Languages Details (Syllabi): Generic syllabus: .See ./syllabus.html (gives the general rules for my classes) plus the CSCI320 syllabus: .See ./syllabus.txt (Source), .See ./syllabus.html (HTML), Also see the $Schedule ... Date Added: 2009-06-25 19:16:05 |
| StartNetBeans.pdf Path: East Los Angeles College >> CS >> 288 Fall, 2009 Description: 1 Setting Up NetBeans IDE for Java Projects CS288, Autumn 2005 Purpose This short document leads you through how to set up NetBeans for the first Lab exercises. By the end of the document you should have initialised the necessary folders and compila... Date Added: 2009-06-25 19:16:34 |
| POL359D01.TXT Path: Sveriges lantbruksuniversitet >> POL >> 19991 Fall, 2009 Description: Sheet1 PROFILE OF STUDENTS IN SFU COURSES COURSE: POL 359-4 D01 LOCATION: SFU TITLE: ST-DEM/RIGHTS/WELFAR SECTION TYPE: SEM SEMESTER: 1999-1 ENROL: 22 = PROGRAM OF STUDENT (Top 5 programs reported in each category Programs with < 3 students not shown... Date Added: 2009-06-25 19:16:54 |
| 4630 Problem Set 7.doc Path: North Texas >> ECON >> 4630 Fall, 2008 Description: 4630 Problem Set 7 (DUE: 10/27/08) 1. The average American adult drinks 2.4 gallons of beer each month. Suppose a sample of 18 students at the University of North Texas revealed the following amounts of beer consumed last month: Student Beer consumed... Date Added: 2009-06-25 19:19:23 |
| cs121_syllabus.pdf Path: Drexel >> WEB >> 200708 Fall, 2009 Description: CS 121 - Computation Lab I - Fall 2006 http:/www.cs.drexel.edu/complab/cs121/fall2006/ For information on CS 122 - Computation Lab II - Winter 2007 please click here! CS 121 - Computation Lab I - Fall 2006 Frequently Asked Questions (6) | Announce... Date Added: 2009-06-25 19:22:23 |
| homework_april21_2009.pdf Path: Harvard >> MATH >> 113 Fall, 2009 Description: Math 113 (Spring 2009) Yum-Tong Siu Homework Assigned on April 16, 2009 due April 21, 2009 1 Problem 1 (from Stein k < 1 by 1 K (k ) = 0 dx (1 x2 )(1 k 2 x2 ) 2 1 , K (k ) ... Date Added: 2009-06-25 19:28:51 |
| m310_questionnaire_scales_audio_part2.ppt Path: NMSU >> M >> 310 Fall, 2009 Description: Questionnaire Scales: Part II (Click icon for audio) Dr. Michael R. Hyman, NMSU Formatting Issues for Non-comparative Scales Issue 1. Verbal category descriptions 2. Number of categories 3. Balanced or unbalanced 1. Odd or even categories 2. Forced ... Date Added: 2009-06-25 19:30:13 |
| indx.txt Path: Harvard >> OBS >> 02218 Fall, 2009 Description: srcid srcno ra dec x y srcname lev gl gb offset psf error ratio scale_src scale_bkg ac_ra ac_dec ac_srcname ... Date Added: 2009-06-25 19:30:37 |
| Animal Models.doc Path: University of Illinois, Urbana Champaign >> VCM >> 646 Fall, 2008 Description: VCM 646 - Selection Of Animal Models Responsibilities of Persons Using Animal Models: Refine, Reduce, Replace Federal laws require investigators to consider alternatives to the use of animals and to justify the use of animals and the number of anim... Date Added: 2009-06-25 19:31:59 |
| SLIDE_OperSplit.ps Path: Kentucky >> MA >> 625 Fall, 2008 Description: %!PS-Adobe-2.0 %Creator: dvips(k) 5.86 Copyright 1999 Radical Eye Software %Title: SLIDE.dvi %Pages: 29 %PageOrder: Ascend %BoundingBox: 0 0 612 792 %EndComments %DVIPSWebPage: (www.radicaleye.com) %DVIPSCommandLine: dvips SLIDE.dvi -o %DVIPSParamete... Date Added: 2009-06-25 19:33:19 |
| Lecture28s07.ppt Path: Case Western >> ENGR >> 145 Fall, 2009 Description: Lecture 28: Polymer Structure; Molecular Weight Reading assignment: Callister 15.1-15.5, 15.7-15.9 Learning objectives: Recognize the mer units of common polymers Identify the various types of isomers that are found in polymers From distribution o... Date Added: 2009-06-25 19:34:20 |
| ICVectorsc<3c>9.pdf Path: Los Angeles Southwest College >> MUSC >> 525 Fall, 2009 Description: BAIN MU SC 525 Post-Tonal Music Theory IC VECTORS c < 3 and c >9 Forte name 2- 1 2- 2 2- 3 2- 4 2- 5 2- 6 IC Vector 100000 010000 001000 000100 000010 000001 Forte name 10-1 10-2 10-3 10-4 10-5 10-6 IC Vector 988884 898884 889884 888984 888894 88888... Date Added: 2009-06-25 19:35:38 |
| BlueChip.xls Path: Penn State >> CMD >> 5185 Fall, 2009 Description: Blue Chip Stock Club Investment Analysis Stock 3M Caterpillar Coca-Cola DuPont General Electric General Motors Intel Microsoft Wal-Mart Total Average Highest Lowest Symbol MMM CAT KO DD GE GM INTC MSFT WMT Date Acquired 06/12/00 03/15/00 08/01/00 09/... Date Added: 2009-06-25 19:35:45 |
| Request.doc Path: Penn State >> CMD >> 5185 Fall, 2009 Description: Request For A New Application Date Submitted: Submitted by: Purpose: November 9, 2006 Chris DeAngelis Create a Commission Rate Calculator. Application Title: Algorithms: Commission Rate Calculator Commission= Sales Price * Commission Rate Reset No... Date Added: 2009-06-25 19:35:47 |
| signals.pdf Path: Berkeley >> ME >> 102 Fall, 2008 Description: Introduction Transducer is a sensing device that converts a physical input (displacement, velocity, strain, temperature, flow rate, . ) into an output, usually a voltage. The term sensor is used to refer to the transducer or to the combination of tra... Date Added: 2009-06-25 19:35:53 |
| 8Parsing.pdf Path: UNC >> COMP >> 401 Fall, 2008 Description: Comp 401 Assignment 8: Combining the Scanner and Avatars Date Assigned: Thu Mar 19, 2009 (Early) Completion Date: Mar 26 (Mar31), 2009 In this assignment, you will combine assignment 6 and 7 to create a working chat application. To do so, you will c... Date Added: 2009-06-25 19:36:19 |
| reviewTest2Sum03.doc Path: FIU >> COP >> 2250 Fall, 2008 Description: REVIEW 1) What would be the output of the following program if it runs without errors public class scaleQ2 { char color; /t for transparent, b for blue, r for red int label; public scaleQ2() { label = 0; color = ; } public void initializeData(int x... Date Added: 2009-06-25 19:36:47 |
| religion.pdf Path: UNL >> PP >> 212 Fall, 2009 Description: Forms of Religious Belief Forms Animism: the belief that personal forces Animism: exist in inanimate, animate, or natural phenomena phenomena Animatism: the belief that impersonal Animatism: f orces exist in inanimate, animate or natural phenomen... Date Added: 2009-06-25 19:40:05 |
| 1111 Fall 05 Present.pdf Path: McDaniel >> GERMAN >> 1111 Fall, 2009 Description: Oral Presentations Dates, Topics, Films and Presenters Date September 8 Topics/ Film Presenters Group presentation 1: German Expressionism in Film, Literature and Theater 1. _ Film: The Cabinet of Dr. Caligari by Robert Wiene, Germany, 1919, 52 minut... Date Added: 2009-06-25 19:42:31 |
| ecotravail-1.doc Path: Université du Québec à Montréal >> R >> 22204 Fall, 2009 Description: Mesure de la de la population active chaque mois, lenqute sur la population active (EPA) recense des dizaines de milliers de canadiens et leur pose des questions sur leur statut sur le march du travail. Avec ces donnes, Statistique Canada dvoile le ... Date Added: 2009-06-25 19:43:52 |
| histplotshadingcolor.ps Path: Georgia Tech >> GTG >> 880 Fall, 2009 Description: %!PS-Adobe-2.0 %Pages: (atend) %PageOrder: Ascend %Creator: NCAR GKS %CreationDate: Oct 21 2007 18:55:13 %DocumentFonts: (atend) %EndComments %BeginProlog /M3 { 2 copy lt {pop} {exch pop} ifelse 2 copy lt {pop} {exch pop} ifelse } bind def /Sc { 1. e... Date Added: 2009-06-25 19:44:31 |
| tor_color_test.ps Path: Georgia Tech >> GTG >> 880 Fall, 2009 Description: %!PS-Adobe-2.0 %Pages: (atend) %PageOrder: Ascend %Creator: NCAR GKS %CreationDate: Oct 21 2007 18:55:13 %DocumentFonts: (atend) %EndComments %BeginProlog /M3 { 2 copy lt {pop} {exch pop} ifelse 2 copy lt {pop} {exch pop} ifelse } bind def /Sc { 1. e... Date Added: 2009-06-25 19:44:32 |
| iverson-simple-views.txt Path: Trinity U >> CS >> 2322 Fall, 2009 Description: From kei@interlog.com Mon Oct 16 15:28:04 2000 Date: Mon, 16 Oct 2000 15:16:48 -0400 From: K. E. Iverson <kei@interlog.com> Reply-To: forum@jsoftware.com To: forum@jsoftware.com Subject: Jforum: Smple Views Programmers and mathematicians commonly de... Date Added: 2009-06-25 19:46:45 |
| lecture_notes_0_to_1.5.pdf Path: Purdue >> EE >> 438 Fall, 2000 Description: ECE 438 CLASS NOTES FALL 2003 Digital Signal Processing with Applications Ilya Pollak Purdue University c 2003 Purdue University All Rights Reserved. 2 Chapter 0 Introduction. Why does an Electrical Engineering major need a course on digital si... Date Added: 2009-06-25 19:49:03 |
| Pareto charts.ppt Path: FIU >> ADE >> 5383 Fall, 2008 Description: Before Grouped applications into the four functional categories for management and delivery of training NUCLEAR TRAINING APPLICATIONS 45 Number of Applications 40 35 30 25 20 15 10 5 0 t king back ation men Trac elop Feed alific on ev Qu Acti nt... Date Added: 2009-06-25 19:49:27 |
| lecture-4per.ps Path: Berkeley >> EECS >> 263 Fall, 2008 Description: %!PS-Adobe-2.0 %Creator: dvipsk 5.58f Copyright 1986, 1994 Radical Eye Software %Title: lecture.dvi %Pages: 4 0 %PageOrder: Ascend %Orientation: Landscape %BoundingBox: 0 0 612 792 %EndComments %BeginProcSet: PStoPS 1 15 userdict begin [/showpage/era... Date Added: 2009-06-25 19:50:17 |
| lecture.ps Path: Berkeley >> EECS >> 263 Fall, 2008 Description: %!PS-Adobe-2.0 %Creator: dvipsk 5.58f Copyright 1986, 1994 Radical Eye Software %Title: lecture.dvi %Pages: 15 %PageOrder: Ascend %Orientation: Landscape %BoundingBox: 0 0 612 792 %EndComments %DVIPSCommandLine: dvips -t landscape -o lecture.ps lectu... Date Added: 2009-06-25 19:50:19 |
| pinello.ps Path: Berkeley >> EE >> 290 Spring, 2004 Description: %!PS-Adobe-2.0 %Creator: dvips 5.76 (MiKTeX 1.11) Copyright 1997 Radical Eye Software (www.radicaleye.com) %Title: pinello.dvi %CreationDate: Tue Dec 21 13:33:11 1999 %Pages: 10 %PageOrder: Ascend %BoundingBox: 0 0 596 842 %DocumentFonts: Helvetica %... Date Added: 2009-06-25 19:50:52 |
| anova2.pdf Path: Texas A&M >> STAT >> 652 Fall, 2008 Description: One-way ANOVA in SPSS Data le Each line of the data le corresponds to one case, i.e., one experimental unit. A given line has two variables, one indicating the treatment and the other the response. Descriptive statistics Use Analyze Descriptive Stat... Date Added: 2009-06-25 19:53:46 |
| intro.ppt Path: North Texas >> CECS >> 5400 Fall, 2008 Description: Educational Telecommunications Telecommunications by Gerald Knezek Professor of Technology & Cognition University of North Texas Telecommunications Telecommunications q Tele - at a distance Communications - exchange of information q Telecommunica... Date Added: 2009-06-25 19:53:47 |
| hw2.pdf Path: Moravian >> CS >> 294 Fall, 2009 Description: HW2: Formatted I/O Due: Tuesday, January 27th What will be the output from the following program. Do not use the computer to do this! #include <stdio.h> #include <stdlib.h> int main() { int i=10, j=25; char c=A; double d=3.141592; char s[10]=\"string\"... Date Added: 2009-06-25 19:56:07 |
| 5lab.pdf Path: CofC >> BIOL >> 337 Fall, 2008 Description: Biology 337 Invertebrate Zoology NAME: _ LAB TIME: _ Lab worksheet Dr. Bob Podolsky LAB 5. Ph. MOLLUSCA (Cl. Polyplacophora, Cl. Gastropoda) Molluscs are so extraordinarily diverse that we give them two labs and cover only four of the seven classe... Date Added: 2009-06-25 19:56:13 |
| KBResume2.doc Path: Illinois State >> ITK >> 140 Fall, 2008 Description: Kyle A. Bristow 9650 Morel Dr. Bloomington, Il 61704 Phone: (309) 829-7325 Cell: (309) 824-1467 kyleb401@yahoo.com OBJECTIVE: Seeking part-time employment while attending Heartland Community College Such as: Customer Response Center Entry level Acco... Date Added: 2009-06-25 19:57:34 |
| Exam II Key.pdf Path: Texas >> JRZ >> 272 Fall, 2009 Description: Chem. 310N, Spring 2008 Professor Krische Midterm Exam II Average = 50 Grading Scale 90-100 = A+ 80-89 = A 70-79 = A65-69 = B+ 60-64 = B 55-59 = B50-54 = C+ 45-49 = C 40-44 = C37-39 = D+ 33-36 = D 30-32 = D0-29 = F Name: Problem 1. (16 points) 2. ... Date Added: 2009-06-25 19:58:03 |
| Exam1.pdf Path: St. Olaf >> PHYS >> 244 Fall, 2009 Description: ... Date Added: 2009-06-25 20:02:42 |
| Lesson5.pdf Path: UCCS >> CS >> 531 Fall, 2009 Description: CS 531 Software Requirements Analysis and Specification Fall 2004 Lesson 5, 9 Sep 2004 Systems Engineering Reading Ch. 6 Systems Engineering Overview Consider both business and technical needs The book talks about this in the context of embedd... Date Added: 2009-06-25 20:02:47 |
| PH233_M3_v1.doc Path: Academy of Art >> PH >> 233 Fall, 2009 Description: Introduction In this module we will deal with the technical details of white balance. It will cover the factors involved in getting an accurate white balance and the potential uses of both accurate and intentionally inaccurate white balance. Student ... Date Added: 2009-06-25 20:07:45 |
| lect22.pdf Path: ECCD >> MATHSTAT >> 4109 Fall, 2009 Description: 0RP0TPgCE\'C~iBETdCb0RPVgP TS es04s0E ) 8 Q Q PB q B Q SB B e Q q G D P e S#%g ~iqQ R\'04T\'7R0RPm#8 dh0f) RqR\'04T\'7R0 RPs# D S Q P S n S Q Q G h e d S Q P S n S Q Q h h Q e S Q P S n S QB D h Q G B D h n q P Q ... Date Added: 2009-06-25 20:07:53 |
| 321 Module 4_MXrev2.doc Path: Academy of Art >> IDS >> 321 Fall, 2009 Description: 321 Module 4 Alias Studio Paint Introduction We are going to explore more sketching this time in a modeling package. You will never need to get your perspective right since you can work in the 3D view and snap to curves in Alias. Some designers only ... Date Added: 2009-06-25 20:08:54 |
| PH 608 Module 10 Quiz.doc Path: Academy of Art >> PH >> 608 Fall, 2009 Description: PH 608 Lighting Module 10 Quiz 1. Tungsten light is most energetic in the blue area of the color spectrum. False 2. You must shoot in the RAW mode to be able to adjust the color temperature of a digital file. True 3. When viewed as a digital file, th... Date Added: 2009-06-25 20:08:59 |
| MODULE 13=10= glossary.pdf Path: Academy of Art >> M >> 605 Fall, 2009 Description: MODULE 10 <Back 1 pag e CLUT: Color Look-Up Tab le. The indexed color reference ( mapping) pa lette of a 256- color (or less) ind exed palette imag e. Ea ch entry of the CLUT conta ins the 24-bit value for a single color comp rising 8 bits for each o... Date Added: 2009-06-25 20:09:19 |
| WaveletLecture3.pdf Path: Texas >> M >> 391 Fall, 2009 Description: Splitting: lters a(1) = a0 , a1 (1) (0) (0) = a(0) Z a0 , a1 , a2 , a3 (1) (1) (1) d0 , d1 (0) (0) = d(0) a(0) = n 1 (1 ) (1 ) a2n +a2n+1 , 2 d (0 ) = n 1 (1 ) (1 ) a2n a2n+1 2 Filtering: convolution on Filter bank: H a(1) H Z, dow... Date Added: 2009-06-25 20:13:21 |
| L3S Marketing Math.pdf Path: NYU >> C >> 550001 Fall, 2009 Description: INTRODUCTION TO MARKETING INTRODUCTION TO MARKETING Marketing Math Marketing Math Professor Kim Corfman Professor Kim Corfman Stern School of Business Stern School of Business 1 Marketing Math: Outline and Key Terms Fixedvs. variable costs Fixed ... Date Added: 2009-06-25 20:14:27 |
| 437Lect30_2006x6.pdf Path: Arizona >> ECOL >> 437 Fall, 2008 Description: Lecture 30, 05 Dec 2006 Vertebrate Physiology ECOL 437 (MCB/VetSci 437) Univ. of Arizona, Fall 2006 Kevin Bonine & Kevin Oh Housekeeping, 05 Dec 2006 - Term paper and previous drafts. - Oral presentations in lab, ppt file, handout. Upcoming Reading... Date Added: 2009-06-25 20:14:59 |
| thermo.ps Path: University of Louisiana at Lafayette >> CIC >> 6380 Fall, 2009 Description: %!PS-Adobe-2.0 %Creator: dvips 5.525 Copyright 1986, 1994 Radical Eye Software %Title: thermo.dvi %CreationDate: Mon Oct 07 14:54:45 1996 %Pages: 9 %PageOrder: Ascend %BoundingBox: 0 0 612 792 %EndComments %DVIPSCommandLine: C:\\EMTEX\\DVIPS.EXE thermo... Date Added: 2009-06-25 20:15:40 |
| F05_Week_9.doc Path: WVU >> EE >> 480 Fall, 2008 Description: WEST VIRGINIA UNIVERSITY COLLEGE OF ENGINEERING AND MINERAL RESOURCES Lane Department of Computer Science and Electrical Engineering DESIGN PROJECT TEAM WEEKLY REPORT TEAM NO/TITLE: Team 21: NSA/Identix Biometrics Demo Member Brendan Forst Jeffrey S... Date Added: 2009-06-25 20:19:40 |
| cdes0607.pdf Path: Toledo >> AST >> 201 Fall, 2009 Description: i q xvig t i q g g | e e v g ei q d i i q v r i q x | RxuhphfeBCRruRr4wwB3}yqpHrsmfrppBR3R3ts i sR\"R{ru4RX8ss}Tk fe}$pyefufp37qu7qs7~p3RCswphsR3HmhRp3sB}h7rfrf~)@V`PXrf2 c q ig t te g ei dq ei q c vi qg qig v... Date Added: 2009-06-25 20:23:03 |
| Hawaii_rocks.ppt Path: University of Hawaii - Hilo >> GG >> 103 Fall, 2009 Description: HAWAII ROCKS (and minerals) Oceanite (from Mauna Loa) a basalt with >40% mafic phenocrysts, and all the phenocrysts are olivine. olivine Ankaramite (from Huallai) a basalt with >40% mafic phenocrysts, and those phenocrysts consist of olivine and... Date Added: 2009-06-25 20:28:26 |
| earthquake_damage_GG130.ppt Path: University of Hawaii - Hilo >> GG >> 130 Fall, 2009 Description: Collapsed buildings: Dec. 7, 1988, Armenia, M6.9, ~25,000 people died http:/www.pep.bc.ca/images/hazard_prep/Earthquake_Photos/11_236.jpg Collapsed buildings: January 17, 1995, Kobe, Japan, M6.9, depth ~5 km http:/www.pep.bc.ca/images/hazard_prep/... Date Added: 2009-06-25 20:28:29 |
| m_3311120_ne_12_1_20070604.txt Path: Arizona >> DOQQ >> 33111 Fall, 2009 Description: Metadata: Identification_Information: Citation: Citation_Information: Originator: USDA-FSA-APFO Aerial Photography Field Office Publication_Date: 20080109 Title: NAIP Digital Ortho Photo Image Geospatial_Da... Date Added: 2009-06-25 20:30:43 |
| airini.pdf Path: Arizona >> LRC >> 595 Fall, 2009 Description: ... Date Added: 2009-06-25 20:32:43 |
| b554hgsa.txt Path: Mt. Holyoke >> BSOL >> 554 Fall, 2009 Description: b554hgsa -10.7530 9047 -10.7071 9081 -10.6612 9123 -10.6154 9131 -10.5695 9116 -10.5237 9110 -10.4778 9114 -10.4320 9104 -10.3861 9066 -10.3403 9017 -10.2944 9106 -10.2485 9133 -10.2027 9083 -10.1568 9189 -10.1110 9270 -10.0651 9192 -10.0193 9173 -9.... Date Added: 2009-06-25 20:34:28 |
| emacs_tutorial.ps Path: Stanford >> STAT >> 201 Fall, 2009 Description: %!PS-Adobe-2.0 %Creator: dvips(k) 5.86 Copyright 1999 Radical Eye Software %Title: emacs_tutorial.dvi %Pages: 1 %PageOrder: Ascend %BoundingBox: 0 0 612 792 %EndComments %DVIPSWebPage: (www.radicaleye.com) %DVIPSCommandLine: dvips emacs_tutorial.dvi ... Date Added: 2009-06-25 20:35:07 |
| Dempere_Lecture.pdf Path: UF >> EMA >> 4714 Fall, 2008 Description: Sustainable Engineering Sustainable Guest Lecture to Materials Selection and Design By Dr. Amelia Dempere March 23, 2007 Green Engineering is the design, commercialization and use of Green processes and products that are feasible and economical whi... Date Added: 2009-06-25 20:35:54 |
| OldMT01_Solutions.pdf Path: Sveriges lantbruksuniversitet >> PHYS >> 2210902 Fall, 2009 Description: ... Date Added: 2009-06-25 20:38:09 |
| PresentationRubric-CaseStudy.doc Path: RIT >> SE >> 540 Fall, 2009 Description: SE 540 Software Architecture - Fall 2006 Case Study Presentation System: _ Observer: _ Speakers: _ _ (Rating: 1= Poor, 2=Fair, 3=Good, 4=Very Good, 5=Excellent) Rating Comments Technical Content Architecture Business Cycle Requirements and Qualit... Date Added: 2009-06-25 20:38:17 |
| essay.pdf Path: Minnesota >> TARRE >> 004 Fall, 2009 Description: ... Date Added: 2009-06-25 20:39:55 |
| example2.txt Path: Maine >> COS >> 125 Fall, 2008 Description: To create the foundation for your web page you will need head tags open and closed> type: <head> </head> you will also need Body tags to inclose your xhtml document into follow example: <body> </body> now you have to make sure the head tags and bod... Date Added: 2009-06-25 20:41:20 |
| homework4.pdf Path: UMass Lowell >> FACULTY >> 450 Fall, 2009 Description: Homework 4 92.450 / 550 Mathematical Modeling Due June 22 1. Suppose traffic is moving uniformly in the direction of increasing B with density 3! . At time > ! road work at the point B ! reduces the maximum possible flow there to ;A ;7 . The ... Date Added: 2009-06-25 20:44:59 |
| exposeBaremeDetaille.pdf Path: Cal Poly >> INF >> 6900 Fall, 2009 Description: GRILLE D\'VALUATION NOM DE L\'ORATEUR NOM DE L\'OBSERVATEUR 1 1 2 3 4 5 6 7 TRS FAIBLE 2 FAIBLE contact objectifs dfinitions rappel du plan simplicit pertinence porte de la voix dbit 3 BON FORME 4 TRS BON 5 EXCELLENT INTRODUCTION annonc... Date Added: 2009-06-25 20:45:51 |
| 23Prolog2.ps Path: Wisconsin Milwaukee >> CS >> 631 Fall, 2009 Description: #%-12345X@PJL JOB @PJL SET RESOLUTION=600 @PJL ENTER LANGUAGE = POSTSCRIPT %!PS-Adobe-3.0 %Title: Microsoft PowerPoint - 23 Prolog 2 %Creator: Pscript.dll Version 5.0 %CreationDate: 11/26/2000 16:56:5 %For: Administrator %BoundingBox: (atend) %Pages:... Date Added: 2009-06-25 20:58:06 |
| gauss_ep_fl_dat.txt Path: Berkeley >> ASTRO >> 00159994 Fall, 2009 Description: # Ep dEp lprob lEiso dlEiso 33.295 0.027 2.03e-05 116.618 0.208 33.324 0.031 8.50e-05 116.618 0.209 33.358 0.036 1.48e-04 116.618 0.209 33.396 0.041 2.06e-04 116.618 0.209 33.439 0.047 2.35e-04 116.618 0.209 33.489 0.053 2.46e-04 116.618 0.209 33.546... Date Added: 2009-06-25 21:02:55 |
| YHR190W.t2k.alpha-logo.pdf Path: UCSC >> YHR >> 190 Fall, 2009 Description: YHR190W.t2k ALPHA 3 2 1 IXXSX X X X X X H H 1 10 20 30 40 H 3 2 1 B I H E H B H B H B H B H 51 60 70 80 90 S B 3 2 1 I H I H S B H HHH 101 I I I I X X X X H HIIH HH I B H B C B G SC H X X X X XX H XXXX H E E S H H X... Date Added: 2009-06-25 21:09:54 |
| YHR169W.t2k.dssp-ehl2-logo.pdf Path: UCSC >> YHR >> 169 Fall, 2009 Description: YHR169W.t2k DSSP-EHL2 2 1 CCC 1 E E C X X X 10 20 30 40 H 2 1 G S T H T H T E T S 51 60 70 80 90 H 2 1 T E H T E EEEE X X X CCCCCEXE X X X T 2 1 H S E H T T T E EEEE CCCC X X X H 2 1 T H T T E H HH 201 C C... Date Added: 2009-06-25 21:10:14 |
| PSYC106D01.TXT Path: Sveriges lantbruksuniversitet >> PSYC >> 20003 Fall, 2009 Description: Sheet1 PROFILE OF STUDENTS IN SFU COURSES COURSE: PSYC 106-3 D01 TITLE: SOCIAL ISSUES SEMESTER: 2000-3 LOCATION: SFU SECTION TYPE: LEC ENROL: 163 = PROGRAM OF STUDENT (Top 5 programs reported in each category Programs with < 3 students not shown sep... Date Added: 2009-06-25 21:10:42 |
| Assignment_4.pdf Path: UMass (Amherst) >> CONTENT >> 270 Fall, 2009 Description: 136.270 Assignment 4 (Sections 16.1-16.4) Handed: Nov.21 2003. Due: Nov.26 2003 in class. Show your work; providing answers without justifying them would not be sufficient. 1. [8 marks] Evaluate 2 (4 xy D 3 - 4 x 2 y ) dA where D is the region b... Date Added: 2009-06-25 21:12:06 |
| discussion8.pdf Path: Berkeley >> EE >> 128 Fall, 2008 Description: }\' L. Ii {Vj I 5~4<f\"\'\" \",J-Ie J.,1Jruie-uk I -t A \'v<\'Q.~V.-i-,!r;-y\"$ (;1;1: A v:\' = i1 rt t~ Vl, J\' - Vt\\) (Vye. J. L. e At\' u,\' J -lA.L ef1J-y~L )O(WhC71 of (1 X =Ax \'\" (A (;IR hXn) + x: (t-) ~ C,j III AIf /\\2 + CJ,V2.12. t+... Date Added: 2009-06-25 21:13:51 |
| pp1.doc Path: N.E. Illinois >> BLBC >> 438 Fall, 2009 Description: Jee Kang 10/04/05 BLBC 438 Fall 2005, Tue 4:15-6:55 Inst: Prof. Parul Raval Topic for Position Paper Topic: Childrens language acquisition in bilingual education I want to describe language acquisition for students in bilingual class. I want to narr... Date Added: 2009-06-25 21:15:38 |
| Seasons Power Point.ppt Path: Texas Tech >> ECCWEB >> 3318 Spring, 2009 Description: JenniferPaxton TheFourSeasons st 1 Grade Winter Snow Cold Weather Wet Whatclothesdoyou wearduringwinter? Coat Sweater Scarf Beanie Spring Spring SunnyDays Rain Cool Weather Whatclothesdowe wearduringspring? RainCoats RainBoots Shortsleeves Pa... Date Added: 2009-06-25 21:16:08 |
| CHAPTER 7 NOTES Path: Raritan >> BUSLAW >> BusLaw101 Spring, 2009 Description: Chapter 7 Class Notes *Know terms of the contract Will Theory- Entering contract free of will Equal Value Theory- Unequal bargaining power Sales of Goods contract- Article 2 of the universal code Valid/ Void/ Voidable. *99% of contracts are Valid* Vo... Date Added: 2009-06-25 21:16:10 |
| 0419-apelman-detroitucpmail.pdf Path: Allan Hancock College >> USA >> 1921 Fall, 2009 Description: Apelman: Report on Detroit Radical Activity [April 1921] 1 Dept. of Justice General Intelligence Division Report on UCP Propaganda Mailed to Detroit, MI - April 7-14, 1921. by J.S. Apelman Document in DOJ/FBI Investigative Files, NARA M-1085, reel ... Date Added: 2009-06-25 21:19:43 |
| Slides-11.pdf Path: ECCD >> SYSC >> 3101 Fall, 2009 Description: 11 Subprograms * 5th ed. Concepts of PLs by RW Sebesta, 2002 by Addison-Wesley 11 - 1 Fundamental Characteristics of Subprograms 1. A subprogram has a single entry point 2. The caller is suspended during execution of the called subprogram 3. Cont... Date Added: 2009-06-25 21:23:22 |
| quinn.ppt Path: Virginia Tech >> CS >> 4234 Fall, 2008 Description: Copyright The McGraw-Hill Companies, Inc. Permission required for reproduction or display. Parallel Programming in C with MPI and OpenMP Michael J. Quinn Copyright The McGraw-Hill Companies, Inc. Permission required for reproduction or display. ... Date Added: 2009-06-25 21:24:27 |
| k125-errata.ps Path: Washington >> MATH >> 125 Fall, 2008 Description: %!PS-Adobe-2.0 %Creator: dvipsk 5.58f Copyright 1986, 1994 Radical Eye Software %Title: k125-errata.dvi %Pages: 1 %PageOrder: Ascend %BoundingBox: 0 0 612 792 %DocumentPaperSizes: Letter %EndComments %DVIPSCommandLine: dvips -o 22218.ps k125-errata.d... Date Added: 2009-06-25 21:26:31 |
| set7.pdf Path: UF >> STA >> 4502 Fall, 2008 Description: Nonparametric Statistical Methods Instructor: P.V.Rao Fall Semester, 2002 These notes were prepared by Ronald Randles and Dennis Wackerly Department of Statistics University of Florida 118-0 NSM - Chapter 9 119 Chapter 9 Regression Problems Invo... Date Added: 2009-06-25 21:27:52 |
| final_review.pdf Path: Washington >> ATMOS >> 211 Fall, 2009 Description: ATM 211: Climate and Climate Change Review for Final General Bring a calculator to the final exam Be able to read and interpret information from graphs (see examples in homeworks) Format will be the same as the midterm, but somewhat longer. Class we... Date Added: 2009-06-25 21:33:17 |
| test3C.pdf Path: N.C. State >> MA >> 141 Fall, 2008 Description: MATH 141-008 Test 3 Version C (100 Points) Oct 28, 2005 Name: Answer the questions in the spaces provided on the question sheets. If you run out of room for an answer, continue on the back of the page. SHOW ALL YOUR WORK. WRITE NEATLY AND LARGE.... Date Added: 2009-06-25 21:43:20 |
| grades.xls Path: UMass (Amherst) >> PHYS >> 2490 Fall, 2009 Description: Student ID xxxx338 xxxx085 xxxx029 xxxx829 xxxx097 xxxx759 xxxx032 xxxx485 xxxx899 xxxx927 xxxx698 xxxx519 xxxx077 xxxx633 Course Grade C+ F C+ A+ D B A A B+ F A C+ A+ A+ ... Date Added: 2009-06-25 21:45:26 |
| Gupta.doc Path: UNLV >> HCA >> 701 Fall, 2008 Description: Technological advancement in the Health Field. Introduction The paper is about the various advancements made in the medical and health related fields over these years. It will include why these advances were necessary and what we have gained out of ... Date Added: 2009-06-25 21:53:55 |
| r59486_53736_hadron.ps Path: Stanford >> MEETING >> 051122 Fall, 2009 Description: %!PS-Adobe-2.0 %Title: r59486_53736_hadron.ps (Portrait A 4) %Pages: (atend) %Creator: HIGZ Version 1.26/04 %CreationDate: 2005/11/22 15.20 %EndComments %BeginProlog /s {stroke} def /l {lineto} def /m {moveto} def /t {translate} def /sw {stringwidth}... Date Added: 2009-06-25 21:55:44 |
| Essential Introduction to Computers.pptx Path: NYIT >> IRIS >> 101 Fall, 2009 Description: Microsoft Office 2007 Essential Introduction to Computers and How to Purchase a Personal Computer Objectives Define the term computer and discuss the four basic computer operations: input, processing, output, and storage Define data and informati... Date Added: 2009-06-25 22:00:59 |
| P1_2009.pdf Path: Purdue >> CGT >> 221 Spring, 2008 Description: ... Date Added: 2009-06-25 22:02:15 |
| hw1.ps Path: Nevada >> MATH >> 330 Fall, 2008 Description: %!PS-Adobe-2.0 %Creator: dvips(k) 5.92b Copyright 2002 Radical Eye Software %Title: hw1.dvi %Pages: 2 %PageOrder: Ascend %BoundingBox: 0 0 612 792 %DocumentFonts: CMR10 CMBX10 CMEX10 %EndComments %DVIPSWebPage: (www.radicaleye.com) %DVIPSCommandLine:... Date Added: 2009-06-25 22:04:05 |
| Reactions of carboxylic acids.pdf Path: UMBC >> CHEM >> 231 Fall, 2009 Description: Reactions of carboxylic acids ... Date Added: 2009-06-25 22:04:19 |
| notebooks.pdf Path: UF >> MIL >> 5666 Fall, 2009 Description: University of Florida Department of ECE 1/10/08 EEL 5666: Intelligent Machines Design Laboratory A. Antonio Arroyo, PhD Eric M. Schwartz, PhD LABORATORY NOTEBOOKS Each student must maintain a separate laboratory notebook, even if the student is pa... Date Added: 2009-06-25 22:05:22 |
| Unit Testing.pdf Path: Washington University in St. Louis >> CSE >> 131 Fall, 2009 Description: ... Date Added: 2009-06-25 22:07:32 |
| ABET.pdf Path: Penn State >> EPH >> 114 Fall, 2009 Description: Reflection ABET Outcome Survey Place a check in the box that best describes the correlation between the ABET Outcomes and what you learned in AE 481W/482: Senior Thesis. Highlight the box and type a capital X. ABET Outcomes for AE 481W/482 a. An abi... Date Added: 2009-06-25 22:07:36 |
| 01-intro.pdf Path: Princeton >> COS >> 426 Spring, 2009 Description: Overview Administrivia ! People, times, places, etc. Computer Graphics Adam Finkelstein Princeton University COS 426, Spring 2005 Syllabus ! What will I learn in this course? Raster Graphics ! Getting started Administrative Matters Instructo... Date Added: 2009-06-25 22:08:26 |
| T0391.t06.str2-logo.pdf Path: UCSC >> T >> 0391 Fall, 2009 Description: T0391.t06 str2 4 3 2 1 1 10 20 30 40 H 4 3 2 1 TS YZ G T ZYZA YT ZA YTS Z 51 60 70 80 90 A 4 3 2 1 T TSZ YZT YA T A Z T S ZYZ 101 110 120 130 140 T 4 3 2 1 YZYT Z YAYZYZ YZYTSA Z TS G T 151 KVIQSSS Z 15... Date Added: 2009-06-25 22:13:49 |
| L07VariablesInC.ppt Path: UMBC >> PUB >> 104 Fall, 2009 Description: Variables in C Topics Naming Variables Declaring Variables Using Variables The Assignment Statement Reading Sections 2.3 - 2.4 UMBC CMSC 104, Section 0801 - Fall 2002 What Are Variables in C? Variables in C have the same meaning as variable... Date Added: 2009-06-25 22:14:41 |
| T0399.t06.near-backbone-11-logo.pdf Path: UCSC >> M >> 0399 Fall, 2009 Description: T0399.t06 near-backbone-11 2 1 10 20 30 40 ABGADGD 2 1 GI HI DIDI G DIBDA D A D G DA GD 51 GDGDGADIDIDA 60 FRLSFNKIKVTTDQNHFSG DGBA 50 1 MSMKKTKNWLLVFLTVTFCFLMLGCQSKEDKKGGTKPSNEAALTKTENLD ... Date Added: 2009-06-25 22:17:30 |
| Team Toughness Questions.doc Path: Union College >> MER >> 419 Fall, 2009 Description: 1. What type of data recording devices will you have available in the field such as laptops, PDAs, etc.? 2. What is a typical food sample and do you have an idea of the size and of weight of it? 3. Do you have any approximations of the forces require... Date Added: 2009-06-25 22:17:35 |
| rings.doc Path: Union College >> MER >> 419 Fall, 2009 Description: ... Date Added: 2009-06-25 22:17:42 |
| COS_116_HW_6.doc Path: Princeton >> COS >> 116 Spring, 2009 Description: COS 116 The Computational Universe Homework 6 Due: April 24 at start of lecture Q1) Look up the following numbers (approximate, of course) by web search and list them. Use a consistent unit (e.g, meters) (a) Width of human hair (b) Size of the Silico... Date Added: 2009-06-25 22:18:19 |
| essay06.pdf Path: Purdue >> MATH >> 315 Fall, 2009 Description: Math 315 Achilles Logic vs. Tortoise Logic due Wednesday, October 4, 2000 Write a critique of the dialogue Chromatic Fantasy, And Feud (Hofstadter, p. 177180). Compare and contrast the dierent approaches which Achilles and the Tortoise take toward l... Date Added: 2009-06-25 22:18:30 |
| YKL120W.t2k.alpha-logo.pdf Path: UCSC >> YKL >> 120 Fall, 2009 Description: YKL120W.t2k ALPHA 2 1 B E B XXXXXXXXXXXXXXXXXXX B B B B B B E C H H E B B H H H H H H I I I I I I H I X X X X X X X X X X X X X X X X HII HHHHHHHHHHHHHH I IIII H E EHE H IHH HH H XXXXXDXXXXXXXXX X S H C B A E H H H H E 1 10 20 30 ... Date Added: 2009-06-25 22:20:13 |
| YKL114C.t2k.stride-ebghtl-logo.pdf Path: UCSC >> YKL >> 114 Fall, 2009 Description: YKL114C.t2k EBGHTL 3 2 1 CCCC X X X X 1 10 20 30 40 H 3 2 1 H T TET H E T TETT EC C C T T E EXEXXXXXX X X X X CC T 51 60 70 80 90 E 3 2 1 H T E T E T H HHHHHHHHHHHHHHHCCCEEEEE X X X X X X X X X X X X X X X C TTEC T ... Date Added: 2009-06-25 22:21:21 |
| YKL196C.t2k.alpha-logo.pdf Path: UCSC >> YKL >> 196 Fall, 2009 Description: YKL196C.t2k ALPHA 3 2 1 A B B B H E B B E A H E A D T H B T C B XHXXXH X X X X E A H EEEAE A B E G H F AE X XXXXX S I XBBBXX X X X EEE AAA H H S T H H T I H H H A E X X B B E IHSS S C E S A H S H E H B S E C I I I I B H H I XXXXXXXXXXX... Date Added: 2009-06-25 22:21:23 |
| Syed_Ahmed.ppt Path: W. Alabama >> ME >> 100 Fall, 2009 Description: Active Solar Heating Active By:SyedF.Ahmed Parts of the Active Solar Heater Parts Solarsystemsconsistof collectorsandelectricityto distributetheSunsEnergy Theheartofasolarcollectoris black Heatismovedbycirculating water,antifreeze,andair Appl... Date Added: 2009-06-25 22:25:59 |
| prog11OGLMousePlotPt.txt Path: Oakland University >> CSE >> 566 Fall, 2009 Description: #include <GL/glut.h> GLsizei winWidth = 400, winHeight = 300; / Initial display-window size. void init (void) { glClearColor (0.0, 0.0, 1.0, 1.0) / Set display-window color to blue. glMatrixMode (GL_PROJECTION); gl... Date Added: 2009-06-25 22:28:32 |
| s1lect05.ppt Path: Missouri State >> A >> 114 Fall, 2009 Description: Comet C/2003 K4 Browse Chapter 1 and start reading Chapter 2. If your plan is for one year, plant rice. If your plan is for 100 years, educate children. Confucious The vote Aliens. Black holes and worm holes. Current events. Everything else ... Date Added: 2009-06-25 22:30:21 |
| Phys250_00_10_DarkM.pdf Path: Berkeley >> PHYSICS >> 250 Fall, 2008 Description: The Dark Side B.Sadoulet Dark Matter Observational Evidence and Inventory Observational evidence Galaxies Clusters Large scale structure Inventory L/M ratio Baryon ratio New methods Weak lensing Sunyaev Zeldovich Phys 250 -10 Dark Matter 1 The... Date Added: 2009-06-25 22:34:06 |
| ARGUMENT.LIB.sp.09.pdf Path: Mt. SAC >> ENG >> 68083 Fall, 2009 Description: Jean Garrett English 68 ARGUMENTATION ESSAY LIBRARY ASSIGNMENT April 23, 2009 Write an argument paper on one of the topics below, choosing an approach appropriate to the topic and being certain that you comply with the pattern of ARGUMENTATION dis... Date Added: 2009-06-25 22:36:49 |
| syllabus_dw.pdf Path: N.C. State >> PEC >> 477 Fall, 2008 Description: PEC 477 Coaching Concepts Fall 2008 Instructor: Dr. Williamson debra_williamson@ncsu.edu Office hours: MTWTH 9:10-10:10 Office location: 2022 phone: 919-515-6384 Class meetings: 10:15-11:30 TH Texts: Successful Coaching. Martens. (2004) 3rd Edition; ... Date Added: 2009-06-25 22:36:55 |
| Exercises2.pdf Path: NMT >> GEOP >> 505 Fall, 2009 Description: Spring, 2005 Analysis of Time Series and Spatial Data Homework 2; Due 2/18 February 9, 2005 (1) If the frequency response of a linear system is (f ) = (f ) + i (f ) and is Hermitian, i.e., (f ) = (f ) show that (t) sin(2f t) = |(f )| sin(2f t + (f... Date Added: 2009-06-25 22:42:11 |
| MC9S08GB60.pdf Path: WVU >> CPE >> 313 Fall, 2008 Description: MC9S08GB60 MC9S08GB32 MC9S08GT60 MC9S08GT32 MC9S08GT16 Data Sheet HCS08 Microcontrollers MC9S08GB60/D Rev. 2.3 12/2004 freescale.com MC9S08GB/GT Data Sheet Covers: MC9S08GB60 MC9S08GB32 MC9S08GT60 MC9S08GT32 MC9S08GT16 MC9S08GB60 Rev. 2.3 12/200... Date Added: 2009-06-25 22:46:07 |
| 4001-X1-Lecture1.ppt Path: Allan Hancock College >> LEC >> 4001 Fall, 2009 Description: Lecture 1: Our Evolving View of the Universe Dr. Michael Burton GENS4001 1999-X1 Evolving View of the Universe 1 History of Science & Astronomy: The Greeks 550BC Pythagoras: Natural phenomena described by mathematics. 300BC Aristotle: Universe ... Date Added: 2009-06-25 22:46:41 |
| Syllabus-GSCM-S09.doc Path: UCSB >> ESM >> 289 Fall, 2009 Description: Green Supply Chain Management (ESM289) Syllabus, Spring 2009 Time: Room: Reading: Work load: Exams: Instructor: Contact: Office hours: Mondays & Wednesdays, 11:00am-12:15pm Bren Hall 1424 To be done upfront, i.e. for the session in which it is listed... Date Added: 2009-06-25 22:48:34 |
| 07-Biometrics-Lecture3-Day2-Part2-14-00-16-30 Path: University of Toronto >> MATH >> MAT 400 Fall, 2008 Description: Continuing Education COST 2101 Training School 1 Biometric Identity Verification http:/scgwww.epfl.ch/courses Dr. Andrzej Drygajlo Speech Processing and Biometrics Group Signal Processing Institute Ecole Polytechnique Fdrale de Lausanne (EPFL) Ce... Date Added: 2009-06-25 22:50:50 |
| Maya_pull.pdf Path: East Los Angeles College >> MS >> 3302 Fall, 2009 Description: ! \" # $% # ! ( 3 + ! / # % 3 0. ! 3 \" , 0-1 . ( ! % -. ) 2 1. 2 % ! % ! #! ! , %\' () (! ) # + % ! 2 4. ! # 4\" 5. % ) + ! ! !\" # 6 5. 7 ! / ! < ) ( 8 ! ! : \" #$ $ ( # #$ % ... Date Added: 2009-06-25 22:54:55 |
| lec07-outline.rtf Path: Acton School of Business >> PSYC >> 362 Fall, 2009 Description: Mapping the Receptive Field of a Retinal Ganglion Cell q q q Record the firing of a single retinal ganglion cell Move a spot of light across the visual field The part of the visual field in which the light changes the firing of the ganglion cell is ... Date Added: 2009-06-25 22:57:42 |
| ContextsReparations.pdf Path: JMU >> FALCON >> 336 Fall, 2009 Description: forty acres and a mule: what if america pays reparations? Dalton Conley Contexts; Fall 2002; 1, 3; Ethnic NewsWatch (ENW) pg. 13 Reproduced with permission of the copyright owner. Further reproduction prohibited without permission. Reproduced with ... Date Added: 2009-06-25 22:57:51 |
| agrawald.pdf Path: MSOE >> CS >> 384 Fall, 2009 Description: MEMORY MANAGEMENT Term Paper Operating Systems CS-384 Submitted to: Dr. Taylor Submitted by: Deepak Agrawal Submitted on: February 2, 2003 1 Table of contents (Index) Introduction3 Contiguous memory allocation.3 Dynamic Memory Allocation4 Linking.... Date Added: 2009-06-25 23:01:36 |
| ioapplet.doc Path: Pace >> CS >> 396 Fall, 2009 Description: import java.awt.*; import java.applet.*; import java.awt.event.*; public class ioapplet extends Applet { TextArea screen = new TextArea (2, 10); Label screenLabel = new Label (\"Screen\"); TextField keyboard = new TextField (4); Label keyboardLabel = n... Date Added: 2009-06-25 23:01:54 |
| q1_sol.pdf Path: NMSU >> AST >> 105 Fall, 2009 Description: Quiz 1 - Lunar Phases - Solutions Astronomy 105G: The Planets Spring 2009 January 29, 2009 [28 points ] The diagram below shows the orbit of the Moon around the Earth over the course of a single orbit (about one month). We are looking down on the Ea... Date Added: 2009-06-25 23:15:56 |
| selmerB.ps Path: LSU >> MATH >> 7280 Fall, 2008 Description: ... Date Added: 2009-06-25 23:26:02 |
| SalemCityProjectSelectionShell.xls Path: GA Southern >> BUSA >> 3132 Fall, 2008 Description: Microsoft Excel 8.0a Answer Report Worksheet: [Book2]Sheet1 Report Created: 12/27/00 12:14:18 AM Target Cell (Max) Cell $E$13 TOTAL Points Name Original Value 0 Final Value 12943 Adjustable Cells Cell Name $B$4 Hire 7 Police Officers Selected $B... Date Added: 2009-06-25 23:28:03 |
| YJL222W-A.t2k.alpha-logo.pdf Path: UCSC >> YJL >> 222 Fall, 2009 Description: YJL222W-A.t2k ALPHA 2 1 BEE E C B D G C H B A B E CABBTE A C S A S H EEB B AB EEEEFE B B C A DEAEE AT AABT E AS S C B T B B A XXXXXXXXXXXXXXXXXBXXXXX X XXXBABXXX C H S C B E E H H B A E E A C H S E E B G E S D A B B E I G B I X EEA E T... Date Added: 2009-06-25 23:31:05 |
| day17.pdf Path: Rose-Hulman >> MA >> 323 Fall, 2009 Description: MA 323 Geometric Modelling Course Notes: Day 17 Bezier Splines I David L. Finn Today, we start considering piecewise Bezier curves or Bezier splines. We have previously introduced the idea of piecewise polynomial curves (Hermite curves), which was a... Date Added: 2009-06-25 23:31:33 |
| 2005 fictive follks.doc Path: Delaware >> FALLSOCI >> 305 Fall, 2009 Description: 1. You are a 19 years old. You are a single parent and receive no child support for your three year old daughter. You did not graduate high school. You clean houses for income, at a rate of $6.75 per hour, 40 hours per week (including some weekend ho... Date Added: 2009-06-25 23:32:47 |
| 161geninfoSP07.pdf Path: Rutgers >> CHEM >> 161 Fall, 2009 Description: GENERAL INFORMATION AND SYLLABUS CHEMISTRY 161, SPRING 2007 LECTURER AND COORDINATOR: PROF. ASBED VASSILIAN WRIGHT-RIEMAN LABS 135 Busch Campus, Tel: 445-5879; asbed@rutchem.rutgers.edu Welcome to the first semester of the \"General Chemistry\" cours... Date Added: 2009-06-25 23:32:56 |
| 2008_ee348_emagI_Final_solns.pdf Path: Oakland University >> EE >> 348 Fall, 2009 Description: Fundamentals of Electromagnetic Fields and Waves: I Fall 2008, EE 30348, Electrical Engineering, University of Notre Dame Final Exam - Solutions Please show your steps clearly and sketch gures wherever necessary. Points will be awarded for corre... Date Added: 2009-06-25 23:38:29 |
| ans22.pdf Path: HWS >> MATH >> 375 Fall, 2009 Description: MATH 375.22 1. Class 22: Selected Answers Let G = Z4 Z12 . a What is the order of G? b Solution: 4 12 4 12 jGj = jZ Z j = jZ j jZ j = 4 12 = 48: Let H be the cyclic subgroup of G generated by 2; 2. What is the order of H ? Solution: 4 12 jH j =... Date Added: 2009-06-25 23:41:39 |
| Email_Intro.txt Path: USC >> CS >> 577 Fall, 2009 Description: X-Apparently-To: wishih@yahoo.com via web20206.mail.yahoo.com; 17 Oct 2001 10:36:50 -0700 (PDT) X-Track: 1: 40 Date: Wed, 17 Oct 2001 12:38:22 -0500 From: Scott Henninger <scotth@cse.unl.edu> X-Mailer: Mozilla 4.73 [en]C-{C-UDP; EBM-SONY1} (Wind... Date Added: 2009-06-25 23:42:33 |
| Equations1_8.pdf Path: UVA >> ASTR >> 553 Fall, 2008 Description: R Rg Vc2 = R g 2 = g Rg Lz = R2 = const = (R, z ) ; r R 2 = ; R R z z d (Lz ) = 0 ; dt z= z =0 z =0 z= 2 z z2 z =0 z =0 2 = z z2 = 2 z z =0 2 = ( 2 / z 2 )z=0 z (t) = Z cos(t + 0 ) x(t) = X cos(t + 0 ) 2g y (t) = X s... Date Added: 2009-06-25 23:44:11 |
| Parts List.pdf Path: Mississippi State >> ECE >> 1002 Fall, 2009 Description: ECE1002 LabPartsList,Fall2008 YoucanbuythesepartsattheRadioShackstoreinStarkville,911Highway12West,Suite 204b,oronlineatRadioShack.com.Similarparts,availablefromDigiKey,NewarkElectronics, andmanyothersources,arequitesatisfactory,aswell. PartDescript... Date Added: 2009-06-25 23:49:49 |
| exam3S08sol.pdf Path: George Mason >> MATH >> 114 Fall, 2008 Description: ... Date Added: 2009-06-25 23:53:39 |
| present4.pdf Path: Troy >> MTH >> 4425 Fall, 2009 Description: Proofs to Present Spring 2007 Pat Rossi Name Theorem 1 (Mean Value Theorem for Integrals) Rb If f (x) is continuous on [a, b] , then (a, b) such that a f (x) dx = f (x) (b a) . Proof. Let the hypothesis be given. Since f (x) is continuous on [a, ... Date Added: 2009-06-25 23:59:22 |
| midterm07.pdf Path: Toledo >> ECE >> 241 Fall, 2009 Description: University of Toronto Faculty of Applied Science and Engineering Department of Electrical and Computer Engineering Midterm Examination ECE 241F - Digital Systems Wednesday October 10, 2007, 6:00 7:30 pm Duration: 90 minutes Examiners: S Brown, J. Ro... Date Added: 2009-06-26 00:09:32 |
| struct_task list4.pdf Path: University of Illinois, Urbana Champaign >> AE >> 441 Fall, 2008 Description: AE 441 Spring 2009 Aerospace Vehicle Design Aircraft Design Section Task List #4 Structures 1. Try and catch up with the tasks if you feel you are lagging behind. 2. Prepare for the upcoming freeze date in a week. Whether or not you impose the free... Date Added: 2009-06-26 00:14:32 |
| soln_10p7_10p8.pdf Path: Colorado >> MATH >> 4520 Fall, 2008 Description: ... Date Added: 2009-06-26 00:15:13 |
| HW1 Solution.pdf Path: UConn >> ME >> 260 Fall, 2009 Description: ... Date Added: 2009-06-26 00:15:52 |
| Chapter4.pdf Path: University of Montana >> MATH >> 121 Fall, 2008 Description: Chapter 4: March 8 March 17 1 Section 4.1: Exponential Functions For a number a > 0, the exponential function with base a is dened as f (x) = ax . As an example, lets look at f (x) = 2x . We know how to nd f (x) for 0 and for whole numbers: 20 = 1,... Date Added: 2009-06-26 00:18:44 |
| Week8.L1.1030.pdf Path: University of Toronto >> STA >> 220 Fall, 2009 Description: Word of the day (October 30, 2006) Respect Men are respectable only as they respect Treat others as you want them to treat you because what goes around comes around 1 Q: If we have observations like this: 0, 1,1 and 2, then what is the sample vari... Date Added: 2009-06-26 00:21:55 |
| 217.2005.Spring.Q2.pdf Path: Roosevelt >> M >> 217 Fall, 2009 Description: Math 217 Quiz 2a NAME February 17, 2005 30 pts. max Show all work; no work no credit. 1. (12 points) Scores on an IQ test are approximately normally distributed with mean 110 and standard deviation 25. a. What proportion of people who take the t... Date Added: 2009-06-26 00:22:04 |
| pp8sol.pdf Path: University of Toronto >> STA >> 257 Fall, 2009 Description: ... Date Added: 2009-06-26 00:22:23 |
| 12.pdf Path: Michigan State University >> LIB >> 1987 Fall, 2009 Description: ... Date Added: 2009-06-26 00:22:54 |
| mar10.pdf Path: University of Toronto >> STA >> 410 Fall, 2009 Description: ... Date Added: 2009-06-26 00:24:24 |
| PAE2429.t04.bys-logo.pdf Path: UCSC >> D >> 2429 Fall, 2009 Description: PAE2429.t04 bys 3 2 1 84 90 100 HGTH GTH 110 DTGLAEYRERRKEEAWRRYYEEYGYQYQQY E ... Date Added: 2009-06-26 00:26:15 |
| etd2730.pdf Path: Sveriges lantbruksuniversitet >> LIB >> 4291 Fall, 2009 Description: FACTORS INFLUENCING THE EARLY MARINE ECOLOGY OF JUVENILE SOCKEYE SALMON (0.nerka) IN RIVERS INLET, BRITISH COLUMBIA Seana Leigh Buchanan BSc, Simon Fraser University 2000 THESIS SUBMITTED IN PARTIAL FULFILLMENT OF THE REQUIREMENTS FOR THE DEGREE OF... Date Added: 2009-06-26 00:28:28 |
| etd2280.pdf Path: Sveriges lantbruksuniversitet >> LIB >> 2971 Fall, 2009 Description: ... Date Added: 2009-06-26 00:28:29 |
| cs1026_topic4.ppt Path: UWO >> CS >> 1026 Fall, 2009 Description: Topic 4 Introduction to Media Computation: Digital Pictures Notes adapted from Introduction to Computing and Programming with Java: A Multimedia Approach by M. Guzdial and B. Ericson, and instructor materials prepared by B. Ericson. Learning Goals ... Date Added: 2009-06-26 00:28:55 |
| worksheet06_solution.pdf Path: Iowa State >> MATH >> 165 Fall, 2008 Description: Worksheet 6 - Math 165 Name: Show all work to receive credit for each problem. All work must be organized and legible. Give exact answers, not decimal approximations. This assignment is worth 15 points and is due Tuesday, April 10 in class. 1. Evalua... Date Added: 2009-06-26 00:30:29 |
| II113BlankPeriodicTable.pdf Path: Mt. Hood Community College >> CH >> 221 Spring, 2008 Description: Printable Periodic Table of Elements 07/28/2005 12:16 PM A Blank Periodic Tale of the Elements Use this form to help you memorize the positions of the elements! http:/classes.mhcc.edu/web/ch221_mr/221PPT/pdf221/BlankPerTable.htm Page 1 of 2 ... Date Added: 2009-06-26 00:30:40 |
| II103Density.pdf Path: Mt. Hood Community College >> CH >> 221 Spring, 2008 Description: Density = mass / volume Remember: Units of mass: grams, kg, etc. Units of volume: cm3, mL, L, etc. mL = cm3 (for this class!) Density is temperature dependent Make sure units are correct! Most Common Density Units: Units for liquid density: g ... Date Added: 2009-06-26 00:30:54 |
| p4.doc Path: Arizona >> CS >> 127 Fall, 2008 Description: <?xml version=\"1.0\" encoding=\"UTF-8\"?> <Error><Code>NoSuchKey</Code><Message>The specified key does not exist.</Message><Key>2cf73c6648fa416f970b7cba91f27e304bc0e91e.doc</Key><RequestId>F 936F64C8553F364</RequestId><HostId>sxoylhwiLIQsod3XQkyBsqTfvIb... Date Added: 2009-06-26 00:33:10 |
| Syllabus.pdf Path: Santa Clara >> COEN >> 020 Fall, 2009 Description: Syllabus COEN 20 Introduction to Embedded Systems Instructor: Email: Office Hours: Phone: T.A. Home Page: Section ID: Pre-Requisite: Thomas Brunl tbraunl@scu.edu Room 2.09, Tu/Th 9:00-10:00am or after lectures or by appointment 554-4485 (Tu/We/Th) G... Date Added: 2009-06-26 00:37:43 |
| otm55-mn55aa_sef.txt Path: UCLA >> E >> 0002 Fall, 2009 Description: $GLL SPACECRAFT EVENT FILE *SEF PSDT*OTM55.SEF/MN55AA *LEVEL SEB *PREP B.MCLAUGHLIN X3-5970/D.BLUHM X3-1129 *RUNID QODCB *PROGRAM SEQGEN 97-098/14:51:03.000 *CREATION 98-293/13:22:23.107 *BEGIN 98-296/18:50:00.0... Date Added: 2009-06-26 00:40:50 |
| 12.pdf Path: Laurentian >> BIOL >> 3000 Fall, 2009 Description: Activators of eukaryotic transcription initiation -part 1 Proteins which activate transcription initiation by RNA polymerase II and III are called transcription factors. These should not be confused with GTFs that play a more central role in the ass... Date Added: 2009-06-26 01:08:02 |
| Quiz #3.doc Path: Iowa State >> ECON >> 101 Fall, 2008 Description: Name:_ Principles of Microeconomics ECON 101 7-19-06 Quiz #3 1. Marginal utility is a. always greater than total utility. b. utility that is not as good as normal utility. c. not related to total utility. d. the extra utility derived from consuming o... Date Added: 2009-06-26 01:22:27 |
| YKL214C.t2k.dssp-ebghstl-logo.pdf Path: UCSC >> YKL >> 214 Fall, 2009 Description: YKL214C.t2k EBGHSTL 3 2 1 C X C H X X X X H C C C CCCCCCCTT CC T S S S S HHHHHXTSSTTTTSSSCX T XXXH X X X X X X X H T C H X X H H H X X S E E C C C H X X X X X X X E H H T HHTTTCHSHHSEEHHTCCCHHC T T H T T C H T C G C T H S T G S XXXXXSXXXXXXX... Date Added: 2009-06-26 02:19:41 |
| psat_ps4_barplots_wrap_base18b_worst_bext.pdf Path: UC Riverside >> CERT >> 308 Fall, 2009 Description: PSAT MAP 1800 1584 1368 1152 936 720 504 288 72 -144 18 12 14 9 4 13 6 2 1 11 3 15 7 15 17 16 16 16 5 10 8 15 -360 -576 -792 -1008 -1224 -1440 -1656 -1872 -2088 -2736 -2304 -1872 -1440 -1008 -576 -144 288 720 1152 1584 2016 2448 Traced Sour... Date Added: 2009-06-26 03:41:08 |
| inner.pdf Path: FIU >> COP >> 4338 Fall, 2008 Description: Inner Classes Mark Allen Weiss Copyright 2000 9/26/00 1 Outline q q q q q History of inner classes Nested (static inner) classes The instance inner class and iterator pattern Inner classes inside of functions Anonymous inner classes Tuesday, Se... Date Added: 2009-06-26 03:43:50 |
| exam1_2008_solution.pdf Path: UF >> EXAM >> 6282 Fall, 2009 Description: EML 6282 Robot Geometry 2 Spring 2008 A reference fixed coordinate system is shown in the corner of a room. The origin is in the plane of the floor and the z axis is normal to the floor. A thin steel rod is mounted in the room. One end is attached t... Date Added: 2009-06-26 04:24:09 |
| pr8ec70205.pdf Path: UPenn >> EC >> 70205 Fall, 2009 Description: Problem Set 8 Spring 2005, Econ 702 Problem 1 Consider the AK model we covered in class. Derive the necessary condition for the balanced growth path in this economy. Problem 2 (Transitional dynamics) Consider the transformed hat NGM with labor augume... Date Added: 2009-06-26 04:31:28 |
| 09.txt Path: Grinnell >> CSC >> 153 Spring, 2009 Description: CSC153 2004S, Class 9: Preconditions and Postconditions Admin * HW1 not graded yet * Interesting Convo tomorrow * Read \"Local Procedure Bindings with letrec\" * Lots of discussion today, just a little lab * Test coming: Distributed next Monday, due a... Date Added: 2009-06-26 04:34:23 |
| prepost.txt Path: Grinnell >> CSC >> 153 Spring, 2009 Description: CSC153 2004S, Class 9: Preconditions and Postconditions Admin * HW1 not graded yet * Interesting Convo tomorrow * Read \"Local Procedure Bindings with letrec\" * Lots of discussion today, just a little lab * Test coming: Distributed next Monday, due a... Date Added: 2009-06-26 04:34:26 |
| 2005Math416Homework5Solutions.pdf Path: Michigan >> PERSONAL >> 416 Fall, 2009 Description: H X WT \" EYB R a R vB W RUUT d WYCAH ` CR vB @TP B RT X T T TP X R R R @ R k W GUTG WCUbRUWYdWvB UWq B r USB f Cj y y pxvu o yv y k wjv t wx j y u t ov t v tu o uj 2Irvtky 0jWqz0{vtyC0t c V ` dix2 ca ` ... Date Added: 2009-06-26 04:45:02 |
| ism50_lecture8.pdf Path: UCSC >> CMPS >> 050 Fall, 2009 Description: ISM 50 - Business Information Systems Lecture 8 Instructor: Katerina Potika UC Santa Cruz April 24, 2008 Outline Announcements CISCO review Student Presentation (news) E-commerce Alibris case Announcements Business paper proposal due today Assignme... Date Added: 2009-06-26 04:49:10 |
| 4chapt11.ps Path: Duke >> X >> 006 Fall, 2009 Description: %!PSAdobe3.0 %Title: (MO3DCA797453604D5.pdf) %Version: 1 1 %CreationDate: (D:20021107093152) %DocumentData: Clean7Bit %LanguageLevel: 2 %BoundingBox: 0 0 792 612 %Pages: 5 0 %DocumentProcessColors: (atend) %DocumentNeededResources: (atend) %DocumentS... Date Added: 2009-06-26 05:25:55 |
| chapter2.ppt Path: Duke >> X >> 006 Fall, 2009 Description: Writing and Understanding C+ q q There are language independent skills in programming (C+, Java, .) However, writing programs in any language requires understanding the syntax and semantics of the programming language Syntax is similar to rules ... Date Added: 2009-06-26 05:26:01 |
| week9lec.pdf Path: Bergen CC >> EE >> 117 Fall, 2009 Description: ... Date Added: 2009-06-26 05:42:43 |
| Lecture7.pdf Path: Bergen CC >> EE >> 225 Spring, 2009 Description: ... Date Added: 2009-06-26 05:43:26 |
| lec01.pdf Path: Bergen CC >> EE >> 230 Spring, 2009 Description: ... Date Added: 2009-06-26 05:43:48 |
| chap16b.pdf Path: Southern Oregon >> ES >> 111 Fall, 2008 Description: Geog 112: Physical Geography II Fluvial Processes Greg Jones, Department of Geography Channel Changes: Vertical responses are mostly due to flood events: Slight filling Deep scouring Filling Horizontal alterations in channel patterns. Straight C... Date Added: 2009-06-26 05:51:18 |
| Lecture17 Path: UPenn >> ACCT >> 101 Summer, 2009 Description: Lecture 17 Accounting for Leases Review Long-term bonds Types of bonds (i.e., types of issuers) Issuing bonds at a premium or discount to par value Accounting for the bonds Recognizing a gain or loss from buying back the bond 2 Review: Steps t... Date Added: 2009-06-28 11:49:53 |
| eval4 Path: Oregon State >> CS >> 411 Spring, 2009 Description: CS411 Operating Systems II Spring2009 NAME Michael Burns Project #4 Follow-up (Individual) (5% of Project #4 grade) Submit this evaluation at http:/engr.oregonstate.edu/teach before midnight Friday, June 5 TEAM # 12 Part 1: Self-evaluation 1. Explai... Date Added: 2009-06-28 13:09:22 |
| test11 Path: Georgia Tech >> COE >> 2001 Spring, 2009 Description: ... Date Added: 2009-06-29 18:50:43 |
| Quiz3-Fall2007 Path: Georgia Tech >> CEE >> 3000 Spring, 2009 Description: Name: _ Date: _ CEE 3000: CIVIL ENGINEERING SYSTEMS QUIZ 3 Fall 2007 Closed Books/Notes (Use the back of sheets if necessary) 1. A public utility is planning a new water supply for a development and you have been asked to compare the cost of constr... Date Added: 2009-06-29 18:55:46 |
| critical thinking Path: Alabama >> SOC >> 101 Spring, 2009 Description: Alison Claire Burnette Sociology 101 Chapter 13 Critical Thinking The Salvation Army is a popular \"faith-based\" social service with which people across the nation are familiar. It was founded as an organization that wanted to bring people together i... Date Added: 2009-06-29 23:31:13 |
| ch7 Path: UWO >> ECON >> 1020 Spring, 2009 Description: Utility and Demand The Household\'s Budget A household\'s budget line describes the limits to its consumption choices. It is a boundary between affordable and unaffordable combinations of goods and services. The budget constraint is analogous t... Date Added: 2009-06-30 15:27:28 |
| Orange concentration calcium Path: Arizona >> CHEMISTRY >> CHem152 Spring, 2009 Description: 1. Orange- 53 mg/100 grams 2. Lemon- 46 mg/100 grams 3. Grapefruit- 34mg/100 grams ... Date Added: 2009-07-01 01:48:58 |
| DefinitionsCh 4 5 Path: Chadron >> PS >> PS 231 Spring, 2009 Description: Chapter 4 Bill of Rights the first ten amendments to the Constitution which set forth basic protections for individual rights to free expression, fair trial and property. civil liberties the fundamental individual rights of a free society, such as f... Date Added: 2009-07-05 15:16:47 |
| BuildVec Path: Georgia Tech >> CS >> CS 1371 Fall, 2008 Description: clear clc load twovec.mat redvec = []; x = 1; y = 1; test = false; while test = false = length(onevec) if sum(redvec) > 10 test = true; end if test = false redvec(y) = onevec(x); end if sum(redvec) > 10... Date Added: 2009-07-06 07:25:19 |
| COMBINED LECTURES Path: 東京大学 >> BUS >> BAM315 Spring, 2009 Description: CHAPTER 1 COMPUTERS AND YOU A computer is a machine that, under a program\'s direction and control, performs four basic operations: input, processing, output, and storage. A program is a list of instructions that tells the computer how to perform thes... Date Added: 2009-07-06 23:45:44 |
| homework1_solution.pdf Path: Iowa State >> CPRE >> 288 Fall, 2009 Description: Assigned: 1/13/05 Due: 1/25/05 CprE 211 Spring 2005 Homework 1 Solution Last Name First Name Section _ _ _ Remember, these homework exercises not only give you practice with course concepts, but also represent the types of questions you will be ... Date Added: 2009-07-08 06:50:55 |
| exam_2_key_06 Path: UCLA >> LIFE SCI >> ls 4 Winter, 2008 Description: Your llame Circle yourTAname: Daphna LS4.1 2ndlrfidterm l 20 pts 2 20 pts Lindsay student id# May Shane nu) t00 prs t/ tection* May 2006 18, 3 20 pts 4 20 pts 5 20 pts total I A\' The markers tt:YJtLfronze. (b:l (st) genes unknown.tdhybrid test... Date Added: 2009-07-08 12:56:05 |
| ProblemasExamenes Path: Peru State >> FIECS >> EC314 Spring, 2009 Description: Ejercicios de exmenes. Francisco Parreo Torres. 1. Problema 1 Un petrolero realiza las travesas entre una Plataforma Petrolfera y una Refinera y viceversa de forma ininterrumpida tardando 12 horas en cada viaje. El barco es propulsado por dos motor... Date Added: 2009-07-09 18:34:50 |
| mythmaps-1 Path: UCF >> HUM >> 2210 Spring, 2009 Description: ... Date Added: 2009-07-12 14:41:12 |
| Untitled2 Path: UCF >> COP >> 3502 Spring, 2009 Description: / /* Kanad Biswas * */ To create a linked list by adding elements at the rear, and to print the list #include <stdio.h> # #include <stdlib.h> struct node { int data; struct node *next; } }; struct node* Addrear(struct node *list, int d) ; v void Pri... Date Added: 2009-07-12 14:45:37 |
| 2008 learning and memory Path: Stony Brook University >> BIO >> 208 Fall, 2008 Description: Long term potentiation (LTP): a mechanism to strengthen synapses; a possible cellular substrate for learning and memory: homosynaptic Cellular changes in LTP Strong inputs exhibit long term potentiation; weak inputs do not unless combined with a st... Date Added: 2009-07-15 23:00:26 |
| AnsEx03CHE132S09 Path: Stony Brook University >> CHE >> 131 Fall, 2008 Description: Answers Exam 03 CHE 132 Spring 2009 Number 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 Form 0/A A C B D D C E C E E E A E B B D B A D D E 1/B E E D B D B E E B E E B E A C C B D A E C 2/C A E D E D C E D C E D B E A A D C E E D E 3/D A D C ... Date Added: 2009-07-15 23:04:51 |
| ws 19 Path: Texas A&M >> MEEN >> 221 Spring, 2009 Description: ... Date Added: 2009-07-16 08:39:11 |
| Untitled89 Path: Tuskegee >> MENG >> 212 Spring, 2009 Description: ... Date Added: 2009-07-16 11:34:41 |
| problemset5[1] Path: BU >> EC >> 201 Fall, 2007 Description: EC201, Fall 2007, Prof. Jordi Jaumandreu Problem set #5 Competitive Markets 1. Many marginal cost curves are U-shaped. As a result, it is possible that the MC curve hits the demand or price line at two output levels. Which is the profit maximizing ou... Date Added: 2009-07-16 12:51:52 |
| assessment_lec Path: UC Davis >> PSC >> 168 Fall, 2008 Description: ASSESSMENT AND DIAGNOSIS INTAKE ASSESSMENT REASONS FOR REFERRAL AND ASSESSMENT (including \"chief complaint\") HISTORY OF CURRENT PROBLEM (including precipitants, stressors, symptoms, duration of symptoms, etc) CLIENT SOCIAL HISTORY (current living sit... Date Added: 2009-07-16 17:03:55 |
| Chapter 8 Path: Maastricht >> GEOL >> 100 Spring, 2009 Description: Multiple-Choice Questions 1) Which of the following forms at the highest grade of regional metamorphism? A) hornfels B) schist C) slate D) phyllite Answer: B Diff: 1 2) What platy, parallel, mineral grains are the most visual aspect of foliated metam... Date Added: 2009-07-16 23:53:14 |
| CS33-3 Path: UCLA >> CS >> 33 Fall, 2008 Description: Basic Computer Architecture CS 33: Computer Organization Topic 3: Basic Computer 9/2008 John A. Rohr All Rights Reserved JAR 3-1 Basic Computer Architecture Input Process Output Save Results CS 33: Computer Organization Topic 3: Basic Compu... Date Added: 2009-07-20 01:18:43 |
| lec-36 Path: BITS, Pilani - Dubai >> CSIS >> BITS C481 Fall, 2008 Description: What\'s Next. Data Link Layer Introduction and services Error detection and correction Multiple access protocols Link-layer Addressing Ethernet Link-layer switches (Hub, Bridge and Switch) PPP and HDLC Link virtualization: ATM, MPLS 15 Nov... Date Added: 2009-07-20 13:43:50 |
| Greek Art and Archaeology_2008SYLLAB_REVISED Path: USC >> AHIS >> 321 Fall, 2008 Description: Greek Art and Archaeology ArtH/Clas 321 ~ Fall 2008 Prof. Ann Marie Yasin * REVISED SYLLABUS * week 8 T. 10/14 Urban Spaces Spivey, chap. 5, \"Myth into History, History into Myth. Temple Sculptures,\" pp. 210 74. Th. 10/16 Class Cancelled week 9 T.... Date Added: 2009-07-20 17:00:12 |
| L1 Path: USC >> AME >> 341AL Fall, 2007 Description: 1st Order Systems Governing equations Governing equation is an ordinary differential eqn. (ODE) with only 1st order derivatives Consider Linear Eqn.: dx + x = F (t ) dt = constant & positive t = independent variable, e.g. time General Solut... Date Added: 2009-07-20 17:22:31 |
| assign92k6 Path: UBC >> PHYS >> physics 10 Spring, 2008 Description: Physics 153 Assignment 9 Due Friday November 24, 2006 by 5:30pm 1. Power is to be transmitted along a stretched wire by means of transverse harmonic waves. The wave speed is 10m/s, and the linear mass density os 0.01kg/m. The power source oscillates ... Date Added: 2009-07-20 23:13:36 |
| eoq_model_S_07 Path: USC >> BUAD >> 311T Fall, 2008 Description: The Economic Order Quantity (EOQ) Model Professor Ashok Srinivasan 1 Outline Assumptions EOQ Model Example and Tradeoffs Robustness of the model Set-up reduction and the EOQ model Economies of scale 2 The EOQ Model 1 Assumptions Demand is... Date Added: 2009-07-21 00:53:58 |
| Chapter_4 Path: USC >> BUAD >> 350 Summer, 2009 Description: Macroeconomics Test Yourself Chapter4 1. Which of the following is a characteristic of \"bonds\"? a. pay zero interest. b. can be used for transactions. c. are sold for a price that varies inversely with the interest rate. d. all of the above. e. none ... Date Added: 2009-07-21 00:59:09 |
| Ch_322a_10.08 Path: USC >> CHEM >> 322AL Summer, 2009 Description: Relative Reactivities of Halogens towards Methane The observed order of reactivity in the halogenation of methane is F2 > Cl2 > Br2 > I2 (no reaction) Overview of Energetics in the Halogenation Reactions F Cl Br I !Ho (kcal/mol) 2X . X2 (2) X .... Date Added: 2009-07-22 20:35:59 |
| HAP7_20 Path: UMSL >> BIOL >> 1141 Summer, 2009 Description: Elaine N. Marieb Katja Hoehn CHAPTER PowerPoint Lecture Slides Human Anatomy & Physiology SEVENTH EDITION The Lymphatic System 20 Copyright 2006 Pearson Education, Inc., publishing as Benjamin Cummings Lymphatic System: Overview Consists of ... Date Added: 2009-07-23 15:19:24 |
| Practice Final Exam Questions Path: UCSD >> BILD 2 >> 2 Fall, 2008 Description: BILD 2 Winter 2009 Practice Final Exam Questions Dr. Towb 3/9/09 1) Of the carbohydrates, fats, and proteins in a hamburger, what has been partially digested prior to entry into the small intestine? 2) Why are there multiple proteases during diffe... Date Added: 2009-07-25 20:00:18 |
| Xr14-11 Path: CSU Fullerton >> ISDS >> ISDS 361B Summer, 2009 Description: Less than HS 193 231 195 189 200 194 198 170 183 169 188 141 245 257 163 192 234 278 194 207 181 158 221 244 223 163 228 211 207 195 139 191 207 223 209 175 177 166 174 189 168 HS grad 189 182 209 197 215 269 224 192 265 197 234 158 184 223 201 263 ... Date Added: 2009-07-26 01:28:12 |
| Lecture F 5-15 Path: UCSD >> MMW 3 >> 654321 Spring, 2009 Description: Lecture F 5/15 1. Life in the Sung dynasty (11-12thc.) o Wide range of urban employments => social mobility e.g. peasants do business in town; businessmen\'s sons take exams for the govt. o Commercial class gains prestige; military loses prestige. o ... Date Added: 2009-07-26 16:27:38 |
| Stroke Path: Troy >> QM >> 3342 Spring, 2009 Description: Risk 12 24 13 56 28 51 18 31 37 15 22 36 15 48 15 36 8 34 3 37 Age 57 67 58 86 59 76 56 78 80 78 71 70 67 77 60 82 66 80 62 59 Blood Pressure Smoker 152 0 163 0 155 0 177 1 196 0 189 1 155 1 120 0 135 1 98 0 152 0 173 1 135 1 209 1 199 0 119 1 166 ... Date Added: 2009-07-26 17:31:17 |
| Week 5 Network Security Path: DeVry Cincinnati >> BIS >> 311 Fall, 2008 Description: Reading on Network Security What is security? Security has a wide range of meanings depending on the position of the stakeholder interested in promoting it. To financial personnel, security not only includes ensuring only authorized personnel have a... Date Added: 2009-07-27 16:11:17 |
| sol3 Path: Waterloo >> MATH >> math 239 Spring, 2008 Description: MATH 239 ASSIGNMENT 3 Solutions 1. Let k, n be fixed non-negative integers. Show that the number of solutions to the equation t1 + . . . + tk = n, where t1 , . . . , tk {0, 2, 4, 6, 8}, is equal to [xn ] (1 - x10 )k , (1 - x2 )k and determine this... Date Added: 2009-07-28 22:12:38 |
| Ethylene signalling and response pathway_ a unique signalling cascade with a multitude of inputs and Path: A.T. Still University >> 231 >> 224-12 Spring, 2006 Description: PHYSIOLOGIA PLANTARUM 123: 195206. 2005 Printed in Denmark all rights reserved doi: 10.1111/j.1399-3054.2004.00447.x Copyright # Physiologia Plantarum 2005 Review Ethylene signalling and response pathway: a unique signalling cascade with a multit... Date Added: 2009-08-01 02:42:30 |
| lecture 7 - tree 3-in-1 with note Path: National University of Singapore >> ECE >> CS1102C Spring, 2007 Description: Trees 1 Readings Required [Carrano & Prichard] Chapter 10 2 Linked list Each node in a Linked list has one child. To traverse from the head node to the last node requires O(n) time. 3 A Tree as a Data Structure shown upside down Used to repr... Date Added: 2009-08-02 12:17:01 |
| Chap13 Path: University of Phoenix >> ACC 460 >> BSBH0IE428 Spring, 2008 Description: Chapter 13 Using Cost Information to Manage and Control Questions for Review and Discussion 1. Fixed costs are fixed in that they do not vary with volume. However, they may vary with other factors. Heating and air conditioning costs, for example, var... Date Added: 2009-08-02 13:20:15 |
| sms Path: A.T. Still University >> SMS >> 76 Spring, 2009 Description: - SabaPyaar ka meetha \"Ehsaas\" dilaney laga hai tu ab to mujh se mujhi ko churaney laga hai tu teri chahtooN ka chaya hai saruur iss kadar har pal har jagah nazar aaney laga hai tu veeraan thi yeh zindgi tere aaney se pehley khushiyoon ke sapney mu... Date Added: 2009-08-04 02:40:38 |
| old exam 2 Path: McGill >> BIOL >> 202 Spring, 2009 Description: ... Date Added: 2009-08-08 15:59:02 |
| bio lecture notes douglas Path: Rutgers >> BIO >> 102 Spring, 2009 Description: Classification Taxon (pl taxa)- theory and practice of classifying organisms Linnaeus- founder of modern classification system designed binomial nomenclature Ernst Mayer- scientist of evolutionary biology Monophyletic group: includes an ancestral spe... Date Added: 2009-08-10 16:00:25 |
| 5.6 Path: City College SF >> ENGN >> 45 Spring, 2009 Description: D = Do e - Q RT In this equation Q is the activation energy of diffusion and will depend on the diffusion mechanism whether it is vacancy migration or random walk. It will also depend on the crystal lattice of the solvent. Both Q and Do are cons... Date Added: 2009-08-10 17:11:46 |
| HW8P3-S.pdf Path: Maryland >> PHYS >> 374 Spring, 2001 Description: HW8P3-S.nb 1 Physics 374 Fall 2004 Prof. E. F. Redish HW8, Problem 3 a. We are given that at time = 0, the shape of the pulse is given by F(X) = Ae-H b L , and that this pulse is moving in the positive x direction with a speed vo . We have shown in... Date Added: 2009-08-10 19:49:09 |
| HW8P3-S.pdf Path: Maryland >> PHYS >> 08 Fall, 2004 Description: HW8P3-S.nb 1 Physics 374 Fall 2004 Prof. E. F. Redish HW8, Problem 3 a. We are given that at time = 0, the shape of the pulse is given by F(X) = Ae-H b L , and that this pulse is moving in the positive x direction with a speed vo . We have shown in... Date Added: 2009-08-10 19:49:09 |
| fiche5.pdf Path: Portland >> FR >> 201 Fall, 2008 Description: FR201 Fiche 5: Negation with compound tenses The purpose of this fiche is to help you understand the syntax (word order) of negation in French, in particular with respect to compound tenses. Simple versus compound tenses. In a simple tense, the verb ... Date Added: 2009-08-10 19:50:51 |
| 000200_1.pdf Path: Pittsburgh >> AEI >> 3827 Fall, 2009 Description: ... Date Added: 2009-08-10 19:51:15 |
| Lab10.pdf Path: University of Hawaii - Hilo >> ICS >> 331 Fall, 2009 Description: Lab10 Servomotor Control For this lab: 1. You will be building a second 5 volt regulated power supply for the servomotor. 2. Install piezo buzzer 3. The servomotor will be connected to the power supply and the PIC16. 4. You\'ll need to test your serv... Date Added: 2009-08-10 19:51:17 |
| 3531lc07.alltel.su99.doc Path: UNF >> COP >> 3531 Fall, 2008 Description: INDEXED FILE PROCESSING . CHANGE GEARS . DIFFERENT FILE ORGANIZATIONS (INDEXED AND RELATIVE) . DIFFERENT ACCESSING TECHNIQUES (SEQUENTIAL, RANDOM). WE WILL START BY CONSIDERING THE THREE MAJOR TYPES OF FILE ORGANIZATIONS: SEQUENTIAL INDEXED RELATIVE ... Date Added: 2009-08-10 19:52:42 |
| ideal.ps Path: RIT >> PHYS >> 273 Fall, 2009 Description: %!PS-Adobe-2.0 %Title: ideal.ps %Creator: fig2dev Version 3.2 Patchlevel 3d %CreationDate: Tue Oct 7 16:29:15 2003 %For: richmond@spiff (Michael Richmond) %Orientation: Landscape %Pages: 1 %BoundingBox: 0 0 612 792 %BeginSetup %IncludeFeature: *PageS... Date Added: 2009-08-10 19:53:01 |
| Access3.ppt Path: University of Montana >> CS >> 172 Fall, 2008 Description: Access Chapter 3 Reports and Queries Reports! Printable Document (looks nice/nicely formatted) that displays INFORMATION (not just Data!) from the database. Multiple ways to create them (like all the stuff we\'ve encountered) Wizard Design View... Date Added: 2009-08-10 19:53:36 |
| CIP and HIP and sintering kinetics.ppt Path: Mich Tech >> MSE >> 3110 Fall, 2009 Description: Cold Isostatic Press L Force Dye Stress=Force/L2 2r r 2 Force( 2 ) L Particle stress= Particle _ contact _ area Particles will yield until the particle contact area increases such that the particle stress=yield stress of the particle material. HI... Date Added: 2009-08-10 19:54:09 |
| E3_2F07.pdf Path: Michigan >> CHEM >> 125 Fall, 2008 Description: Fall Break and E3 Team Report No lectures on Tuesday, Oct. 16 and Thursday, Oct. 18 No dis/lab sections, Monday, Oct. 15 - Friday, October 19 E3 Session 2 for 200/300 dis/labs: dis/labs: 10/10, 10/11 and 10/12 E3 Session 2 for 100 dis/labs: dis/lab... Date Added: 2009-08-10 19:54:59 |
| Training.pdf Path: Idaho >> PSYC >> 416 Fall, 2008 Description: Psychology 416/516 Training Systems Model of Training Continual evaluation and modification Different methods for different conditions Research orientation Part of a larger system Needs Assessment Organization Analysis Task Analysis Person Analysi... Date Added: 2009-08-10 19:55:06 |
| 1030-wicks-notesfromroad.pdf Path: Virginia Tech >> USA >> 1923 Fall, 2009 Description: Wicks: Notes from the Road [Sept. 23-Oct. 31, 1923] 1 Notes from the Road: September 23 - October 30, 1923. by Harry M. Wicks Documents in the Comintern Archive, f. 515, op. 1, d. 184, ll. 32-44; d. 185, ll. 14-16; 22-25; 55. Erie, Pennsylvania. S... Date Added: 2009-08-10 19:55:28 |
| l02.pdf Path: East Los Angeles College >> M >> 0405 Fall, 2009 Description: MATH298 Set 2 2005/01/24 MULTIPLICATION OF MATRICES First attempt Let A1 = a1 b1 c1 d1 A2 = a2 b2 c2 d2 Let us define the product as A1.A2 = a1a2 b1b2 c1c2 d1d2 This may seem logical - but this is NOT the most widely used way to multiply ... Date Added: 2009-08-10 19:55:30 |
| Feb15.pdf Path: Acton School of Business >> CHEM >> 152 Fall, 2009 Description: Chem 152 Honors Chemistry Spring 2006 Reading Assignments: Friday 15: 5 Monday 15: 6 Wednesday 15: 7 Discussion Sections Monday 7:30 Spac 106 Tuesday 7:00 DBH 212 Quantum Description of Atomic and Molecular Structures 1900-Newtonian mechanics nat... Date Added: 2009-08-10 19:55:51 |
| Thailand.pdf Path: Pace >> AK >> 31033 Fall, 2009 Description: Identifying and Explaining Risk Factors Associated with Information Systems Projects in Thailand: A Model and Research Propositions Joan Mann. Nipon Parinyavuttichai Old Dominion University, USA James P. Johnson Rollins College, USA Abstract Many in... Date Added: 2009-08-10 19:55:56 |
| Course and Lab 1.doc Path: UNLV >> ECG >> 420 Fall, 2008 Description: ECG 420L: Engineering Electronics II Introduction: Hello and welcome to the ECG420L laboratory! This lab course is associated with the lecture course ECG420 (Analog) Circuits II. Students taking this course are assumed to have excellent working know... Date Added: 2009-08-10 19:56:43 |
| Prelab11.pdf Path: Western Michigan >> ECE >> 4510 Fall, 2008 Description: Prelab Eleven Control Area Network (CAN) Interface Port M (PM.0 PM.1) is designated as CAN0 pins. Port M (PM.2 PM.2) is designated as CAN1 pins. Task One The designated CAN Module is CAN0. The Baud rate should be set to 1 Mbs. Select the Oscillat... Date Added: 2009-08-10 19:59:24 |
| iln00z.txt Path: University of Illinois, Urbana Champaign >> ATMOS >> 20081127 Fall, 2009 Description: UPPER AIR CALCULATIONS AND PLOTTING (Ver 5.48.1-LINUX-X11) Current filename: /mnt/noaaport/nwstg/convert/08112712_upa.wxp Date: 1200Z 27 NOV 08 Searching for KILN. Searching the city database file for: KILN . Date:1200Z 27 NOV 08 Station: KILN... Date Added: 2009-08-10 19:59:49 |
| bna12z.txt Path: University of Illinois, Urbana Champaign >> IOP >> 20030531 Fall, 2009 Description: UPPER AIR CALCULATIONS AND PLOTTING (Ver 5.28A-LINUX-X11) Current filename: /noaaport/nwstg/convert/03053112_upa.wxp Date: 1200Z 31 MAY 03 Searching for KBNA. Searching the city database file for: KBNA . Date:1200Z 31 MAY 03 Station: KBNA WMO ... Date Added: 2009-08-10 20:00:06 |
| dvn00z.txt Path: University of Illinois, Urbana Champaign >> ATMOS >> 20081206 Fall, 2009 Description: UPPER AIR CALCULATIONS AND PLOTTING (Ver 5.48.1-LINUX-X11) Current filename: /mnt/noaaport/nwstg/convert/08120612_upa.wxp Date: 1200Z 6 DEC 08 Searching for KDVN. Searching the city database file for: KDVN . Date:1200Z 6 DEC 08 Station: KDVN... Date Added: 2009-08-10 20:00:20 |
| basch-guibas.ps Path: Acton School of Business >> COMP >> 650 Fall, 2008 Description: %!PS-Adobe-2.0 %Creator: dvipsk 5.58f Copyright 1986, 1994 Radical Eye Software %Title: kinetic.dvi %Pages: 13 %PageOrder: Ascend %BoundingBox: 0 0 612 792 %EndComments %DVIPSCommandLine: dvips kinetic.dvi -o kinetic.ps %DVIPSParameters: dpi=300, com... Date Added: 2009-08-10 20:00:43 |
| m112syllabussum2008.pdf Path: Los Angeles City College >> MATH >> 112 Fall, 2009 Description: Los Angeles City College Mathematics 112 PreAlgebra Section 3341 Mon/Tues/Wed/Thur 7:15 9:40 PM Summer 2008 BUNG-10 Instructor: Kevin Windsor EMAIL: windsokr@lacitycollege.edu Textbook: PREALGEBRA, Carson, 2nd Edition. Office Phone: (323) 953-4... Date Added: 2009-08-10 20:04:33 |
| hw8soln.pdf Path: UCSD >> PORD >> 262 Fall, 2009 Description: ... Date Added: 2009-08-10 20:04:35 |
| Math Web Sites.doc Path: N. Georgia >> DEMART >> 0553 Fall, 2009 Description: Appropriate Web sites for teaching High School Mathematics: 1. http:/www.mathforum.org/library A mathematics Internet library loaded with wonderful reference material including Internet resources. 2. http:/www.sosmath.com/index.html A review of mater... Date Added: 2009-08-10 20:06:15 |
| Introduction.pdf Path: TN Tech >> CHEM >> 311 Fall, 2009 Description: CHEM 3010 Laboratory Laboratory syllabus and and schedule at: http:/iweb.tntech.edu/chem311-dc/labsyl.htm Laboratory texts: PH Catalyst edited by Crouse (PH) Laboratory Exercises for Organic Chemistry, 5th Ed. Crouse (LE) Required items: Notebook ... Date Added: 2009-08-10 20:06:44 |
| sample_quiz8.pdf Path: Barton CCC >> MATH >> 140 Fall, 2009 Description: Math 140 Sample Quiz 8 3x 5mx + 6m2 + x2 4 = 0. page 1 1. Consider the parametric equation 5m (a) Find all values of m for which x = 7 is a solution of the equation. (b) Find all values of m for which there are two dierent solutions of this equat... Date Added: 2009-08-10 20:06:59 |
| Text guide.pdf Path: Laurentian >> CHEM >> 200303 Fall, 2009 Description: Study Guide to Chemistry 2410 (6th Edition Quantitative Chemical Analysis) Course Notes 1.0 Units and Concentration Scales 1.1 SI system of units, fundamental and derived units 1.2 Concentration Scales 1.3 Concentration scale calculations 2.0 Experim... Date Added: 2009-08-10 20:08:25 |
| ssamara2.pdf Path: University of Illinois, Urbana Champaign >> CS >> 598 Fall, 2008 Description: Visualizing Social Networks Linton C. Freeman Reviewed by Suraj Samaranayake Freeman reviews the visualization of social networks, starting way back in 1932 when Jacob Moreno created what he called a sociogram. Figure 1 and 2 in the paper show these ... Date Added: 2009-08-10 20:08:56 |
| (26) General Principles of Molecular Cloning BY431 2005.pdf Path: UAB >> BY >> 431 Fall, 2009 Description: General Principles of Molecular Cloning The Use of T4 DNA Ligase for Molecular Cloning T4 DNA ligase catalyses the synthesis of a phosphodiester bond between the 3\'-hydroxyl and 5\'-phosphoryl ends of DNA, and requires Mg2+ and ATP as co-factors. T4 D... Date Added: 2009-08-10 20:09:10 |
| David.txt Path: UT Chattanooga >> ENCH >> 435 Fall, 2009 Description: Subject: Weekly-435 Date: Fri, 6 Sep 2002 10:46:47 -0400 (EDT) From: Nobody <nobody> Reply-To: Jolley18@aol.com To: jim-henry@utc.edu, Frank-Jones@utc.edu CC: Jolley18@aol.com 00-my-name-is: David Jolley 1-worked-on: Worked on calculations for dist... Date Added: 2009-08-10 20:11:39 |
| ps1.pdf Path: UCSB >> PHYS >> 223 Fall, 2009 Description: Physics 223b: Problem Set 1 due January 20, 2009. 1. Mystery lattice: An x-ray scatterer determines the structure of a monatomic crystal. It is described mathematically as follows. A set of primitive vectors for the Bravais lattice is: a1 = (0, 1, 1... Date Added: 2009-08-10 20:12:14 |
| Q6-Sol.pdf Path: St. Cloud >> CSCI >> 504 Spring, 2008 Description: CSCI 404/504: Design and Analysis of Algorithms (Fall 2006) Instructor: Pranava K. Jha Solution to Quiz 6 Consider an instance of an all-pairs-shortest-paths problem. There are four vertices: 1, 2, 3 and 4. The contents of the path matrix appear bel... Date Added: 2009-08-10 20:12:29 |
| final_ans.pdf Path: Oregon >> PH >> 352 Fall, 2009 Description: ... Date Added: 2009-08-10 20:12:41 |
| trajCR.ps Path: Toledo >> DGP >> 2505 Fall, 2009 Description: %!PS-Adobe-2.0 %Title: Piecewise Cubic Catmull-Rom Trajectory %Creator: MapleV %DocumentFonts: /Helvetica %Pages: 1 %BoundingBox: -100 -100 3399 2549 %EndComments % (actual BBox: 0 0 3299 2449) 20 dict begin gsave /m {moveto} def /l {lineto} def /C {... Date Added: 2009-08-10 20:12:51 |
| graphlines.pdf Path: Georgia Perimeter >> MATH >> 0097 Spring, 2008 Description: Exam Name_ MULTIPLE CHOICE. Choose the one alternative that best completes the statement or answers the question. Give the ordered pairs for the points labeled on the graph. 1) 8 y 1) 4 -8 -4 -4 4 8 x H G -8 A) G(3, -5); H(-6, -5) C) G(3, ... Date Added: 2009-08-10 20:13:10 |
| quadword.pdf Path: Georgia Perimeter >> M >> 1111 Fall, 2009 Description: ... Date Added: 2009-08-10 20:13:15 |
| probabilityhw2.ps Path: UConn >> MATH >> 105 Fall, 2009 Description: %!PS-Adobe-2.0 %Creator: dvips(k) 5.86 Copyright 1999 Radical Eye Software %Title: probabilityhw2.dvi %Pages: 2 %PageOrder: Ascend %BoundingBox: 0 0 596 842 %DocumentFonts: Helvetica %EndComments %DVIPSWebPage: (www.radicaleye.com) %DVIPSCommandLine:... Date Added: 2009-08-10 20:13:28 |
| quiz5.pdf Path: Laurentian >> BIOL >> 4500 Fall, 2009 Description: Biol 4500 Seminars in Biological Sciences Spring 2006 Quiz 5 Reference: Flackowsky et al., 2005 (Archives of Animal Nutrition) Name:_ According to the review article 1. What is a first generation genetically-modified plant (1 mark)? Give an example (... Date Added: 2009-08-10 20:14:08 |
| slac-pub-9621.pdf Path: Stanford >> PUBS >> 9500 Fall, 2009 Description: SLAC-PUB-9621 January 2003 Novel Photon Detectors for RICH Applications J. Va\'vra* Stanford Linear Accelerator Center, Stanford University, Stanford, CA 94309, U.S.A. + Abstract The paper describes recent developments in Photon Detectors useful f... Date Added: 2009-08-10 20:14:27 |
| exam2a.ps Path: Virginia Tech >> STA >> 2023 Fall, 2009 Description: %!PS-Adobe-2.0 %Creator: dvipsk 5.55a Copyright 1986, 1994 Radical Eye Software %Title: exam2a.dvi %Pages: 9 %PageOrder: Ascend %BoundingBox: 0 0 612 792 %EndComments %DVIPSCommandLine: dvips exam2a -o %DVIPSParameters: dpi=600, compressed, comments ... Date Added: 2009-08-10 20:16:35 |
| rquiz0403.pdf Path: Cal Poly >> PHYS >> 131 Fall, 2009 Description: READING QUIZ 4/3/2009 1. Briefly describe a situation where the average velocity of an automobile is zero but its average speed is not. 2. The figure below shows how to determine instantaneous velocity as the slope of the tangent of the graph. What... Date Added: 2009-08-10 20:17:08 |
| Lego_9797_Parts_List.pdf Path: Nevada >> CSC >> 200 Fall, 2009 Description: LEGO Bricks Parts List For Base Set #9797 The LEGO MINDSTORMS Education NXT set #9797 is the main set for building NXT robots. Here is a list of the building elements included in the set. 1x 448521 Minifigure, cap, red 2x 4119589 Connector peg, 2-mo... Date Added: 2009-08-10 20:17:25 |
| lecture10.ppt Path: Pittsburgh >> CS >> 401 Fall, 2008 Description: Lec.10 (Chapter 8 SWING Java Components Sample Components JFrame, JLabel, JButton, JTextField Even-Driven Programming Concept Layout Manager FlowLayout, GridLayout ... Date Added: 2009-08-10 20:17:50 |
| section10.ppt Path: Washington >> CS >> 451 Fall, 2009 Description: CSE451 Section 10 1 Last section! Project 4 due tomorrow Today: Some practice for the exam Evaluations \"Big picture\" review tomorrow Project 3 + all old stuff back tomorrow You will get project 4 grades at the final exam 2 Rev... Date Added: 2009-08-10 20:18:56 |
| 11-replacement.pdf Path: Washington >> CS >> 451 Fall, 2009 Description: CSE 451: Operating Systems Autumn 2001 Lecture 11 Demand Paging and Page Replacement Demand Paging We\'ve hinted that pages can be moved between memory and disk this process is called demand paging is different than swapping (entire process moved,... Date Added: 2009-08-10 20:18:57 |
| section2.ppt Path: Washington >> CS >> 451 Fall, 2009 Description: Reminders Project 1 due tomorrow at 5:00 pm Homework 2 out, due next Wednesday Start thinking about project groups (3 people) for the rest of the quarter Today: project 1 questions 1 Project 1 issues C strings Copy_to/from_user and... Date Added: 2009-08-10 20:19:32 |
| practice_final.pdf Path: UCSD >> WEBER >> 116 Fall, 2009 Description: Name: Economics 116 Economic Development Fall 2006 James Rauch PRACTICE FINAL EXAM This exam is worth 200 points. Answer all five questions. Each question is worth 40 points. 1. a. Public services such as sanitation and transportation are often ... Date Added: 2009-08-10 20:21:23 |
| practice_final.pdf Path: UCSD >> DOCS >> 116 Fall, 2009 Description: Name: Economics 116 Economic Development Fall 2006 James Rauch PRACTICE FINAL EXAM This exam is worth 200 points. Answer all five questions. Each question is worth 40 points. 1. a. Public services such as sanitation and transportation are often ... Date Added: 2009-08-10 20:21:23 |
| CSCL1401shortassign4.pdf Path: Minnesota >> STOU >> 0046 Fall, 2009 Description: CSCL 1401 - Response Paper #4 - due Tuesday, April 16th For next week, read Andr Breton\'s Mad Love. Known as a poet and the theorist of the surrealist movement, Breton\'s \"novel\" is a departure from our previous texts in that it is not what we might t... Date Added: 2009-08-10 20:22:31 |
| 350_exam_2_Version_B_key.pdf Path: SUNY Stony Brook >> HBY >> 350 Fall, 2008 Description: HBY350 PHYSIOLOGY: SECOND TWO-HOUR EXAM DECEMBER 19, 2008 Instructions, please. 1. Have your ID badge available for inspection (so we can silently identify you when taking roll). 2. Provide the following information HERE: NAME (PRINTED) __ PROGRAM ... Date Added: 2009-08-10 20:22:52 |
| EndocrineTargetTissues.pdf Path: Glendale Community College >> COMMON >> 202 Fall, 2009 Description: Major Endocrine Glands and Target Tissues Hypothalamus GH-RH GH-IH TRH CRH Pituitary Gland MSH Skin Liver GH Many tissues TSH Thyroid gland Thyroid hormones ACTH Adrenal glands Glucocorticoids (cortisol) ADH Kidneys Oxytocin Uterus Prolactin Mammary ... Date Added: 2009-08-10 20:23:54 |
| toothbrush.doc Path: Penn State >> ASM >> 5127 Spring, 2009 Description: Collin Clark Danielle DeCicco Bill Hornick Amanda Mahaffey Date 26 February 2008 Team Five Abstract The objective of this design report is to convey to the consumer the innovative ideas for a travelfriendly electronic toothbrush. Through vigorous res... Date Added: 2009-08-10 20:24:26 |
| 70308mdtsol.pdf Path: BU >> EC >> 32990 Fall, 2009 Description: Ec 703 Microeconomic Theory Spring 2008 Boston University Dilip Mookherjee Ec703 SOLUTIONS TO MIDTERM EXAMINATION, 2008 1. Consider an economy with I households and J firms. Each firm has a strictly convex and compact production set. Each household ... Date Added: 2009-08-10 20:24:28 |
| CMN_02_18_S09b_T02.pdf Path: USC >> CSCI >> 577 Fall, 2009 Description: Client Meeting Notes CSCI 577b: Spring 09 Software Engineering-II Team #2 Housing Application Tracking System Date: Team Members Bhuvan Vijayvergiya Pratik Kumar Shivalika Goyal Godfrey Duke 13th February,2009 Roles Project Manager/System Architect/... Date Added: 2009-08-10 20:25:51 |
| XRootd_SAG2004.ppt Path: Stanford >> SLAC >> 041203 Fall, 2009 Description: Xrootd Proxy Service Andrew Hanushevsky Heinz Stockinger Stanford Linear Accelerator Center SAG 2004 20-September-04 http:/xrootd.slac.stanford.edu The BaBar Experiment Use big-bang energies to create B meson particles Look at collision decay pro... Date Added: 2009-08-10 20:26:19 |
| l3.ps Path: Georgia Tech >> CS >> 6250 Fall, 2008 Description: %!PS-Adobe-2.0 %Creator: dvips 5.76 Copyright 1997 Radical Eye Software (www.radicaleye.com) %Title: E:\\COURSES\\CS6250\\FALL99\\L3.dvi %CreationDate: Sun Aug 29 12:32:00 1999 %Pages: 5 %PageOrder: Ascend %BoundingBox: 0 0 612 792 %EndComments %DVIPSCom... Date Added: 2009-08-10 20:26:20 |
| test1mistakes.ppt Path: FIU >> CVAUG >> 001 Fall, 2009 Description: Review of Common Test #1 Mistakes Plurality versus Majority Plurality winner = candidate with more first place votes than any other Majority winner = candidate with more than 50% of the first place votes. Plurality = the most votes Majority = mo... Date Added: 2009-08-10 20:26:40 |
| PSY130reviewchap10.pdf Path: North Central State College >> PSY >> 130 Fall, 2009 Description: PSY 130 Review Test #10 Chapter 10 1. What percentage of legal adoptions are by relatives, usually stepparents or grandparents? A. B. C. D. A. B. C. D. 20 50 60 70 accept decisions of parents and teachers without challenge. usually disregard the feel... Date Added: 2009-08-10 20:26:45 |
| postmidtermsp05.pdf Path: Portland >> CS >> 581 Spring, 2008 Description: CS 581: Theory of Computation Mid-term exam follow-up exercise James Hook In this problem you will sketch the proof that a non-deterministic Turing machine can be simulated by a deterministic Turing machine and explore important consequences of the c... Date Added: 2009-08-10 20:27:18 |
| Bldg_PC_I_and_II.pdf Path: Chesapeake College >> CIS >> 109 Fall, 2009 Description: CIS 109, Building a PC Due at classtime on Wed. April 2, 2008 for the Cambridge section. Due at classtime on Thurs. April 3, 2008 for the Wye Mills Section. Go to the Web site for your textbook: www.computing2008.com. In the Features list on the left... Date Added: 2009-08-10 20:27:19 |
| orangeExam2.pdf Path: CUNY Baruch >> CIS >> 228 Fall, 2009 Description: Exam II CIS 228: The Internet Prof. St. John Lehman College City University of New York 7 November 2007 NAME (Printed) NAME (Signed) E-mail Exam Rules Show all your work. Your grade will be based on the work shown. The exam is closed book and clos... Date Added: 2009-08-10 20:28:03 |
| HW_2.pdf Path: University of Illinois, Urbana Champaign >> ECE >> 460 Fall, 2008 Description: ECE 460 Fall 2008 Homework 2 Due in class on September 18, 2008 1. A linearly polarized light is normally incident on a polarizer that rotates with angular frequency w. (The axis of rotation is parallel to the direction of light propagation. ) a... Date Added: 2009-08-10 20:29:41 |
| TeachingNotesCase10ImpairmentFLEETBOSTONCh5.doc Path: Ill. Chicago >> ACTG >> 593 Fall, 2008 Description: vti_encoding:SR|utf8-nl vti_timelastmodified:TR|09 Mar 2007 01:51:00 -0000 vti_extenderversion:SR|6.0.2.6551 vti_author:SR|CBA\ am vti_modifiedby:SR|CBA\ am vti_timecreated:TR|09 Mar 2007 01:51:00 -0000 vti_cacheddtm:TX|09 Mar 2007 01:51:00 -0000 vti... Date Added: 2009-08-10 20:29:52 |
| ex1.pdf Path: NSCC >> CHE >> 236 Fall, 2009 Description: Chemistry 236, Spring 2006 Name: Exercise 1: Saponification Saponification is the process used to make soap (which are salts of carboxylic acids) from vegetable and animal fats (which are triesters of glycerol, or, more compactly, triglycerides). A... Date Added: 2009-08-10 20:30:44 |
| schaberg_etal_2003.pdf Path: Tennessee >> PLSC >> 348 Fall, 2009 Description: Tree Physiology 23, 325333 2003 Heron Publishing-Victoria, Canada Factors influencing red expression in autumn foliage of sugar maple trees P. G. SCHABERG,1,2 A. K. VAN DEN BERG,3 P. F. MURAKAMI,1 J. B. SHANE4 and J. R. DONNELLY 4 1 2 3 4 USDA For... Date Added: 2009-08-10 20:30:56 |
| p25.pdf Path: Utah State >> ECE >> 5800 Fall, 2008 Description: ECE 5800 Due: 10/24/08 PROBLEM No. 25 Validation Problem Problem: Derive Equation 76 from Equation 75 ... Date Added: 2009-08-10 20:31:13 |
| lec4.PPT Path: Washington >> CM >> 420 Fall, 2008 Description: CM 420 Temporary Structures Wall Form Design Part II Lecture 4 CM 420 Temporary Structures Wall Form Design Example (Continued) Design forms for 14 ft high wall to be concreted at the rate of 3 ft per hour, internally vibrated. Assume the mi... Date Added: 2009-08-10 20:31:31 |
| L28S06.pdf Path: University of Hawaii - Hilo >> BIOLOGY >> 101 Fall, 2009 Description: Lecture 28 How Does a Species Change? Hereditary changes occur within a species. Normally, species do not cross, but hybrids do exist: Beefalo = Cattle + Buffalo Liger = Lion + Tiger Zedonk = Zebra + Donkey Mendel & Genetics Rare or artificially p... Date Added: 2009-08-10 20:31:47 |
| GeneRegulation160.pdf Path: Bellevue College >> BIOLOGY >> 160 Fall, 2009 Description: Gene Regulation - 1 Regulating Genes We have been discussing the structure of DNA and that the information stored in DNA is used to direct protein synthesis. We\'ve studied how RNA molecules are used to transcribe and translate DNA information to dire... Date Added: 2009-08-10 20:32:12 |
| Presentation_Schedule.doc Path: Midwestern State University >> ECON >> 503 Fall, 2009 Description: EconS 503: Presentation Schedule Spring 2007 Mar 22, Thu 3:00 pm, Hulbert 23 Scott Colby, Pauly\'s paper #2 (discussant Nicole Choi) Qiujie Zheng, Hori\'s paper #3 (discussant Tim Graciano) Hayk Khachatryan, Karantininis\' paper #4 (discussant Sean Balc... Date Added: 2009-08-10 20:33:18 |
| h44.pdf Path: UPenn >> CSE >> 220 Fall, 2009 Description: s tj y j w n l w j w mptswm%4S%rp%Sp4r\"u%Wr%6xW$6Vvp%\"%er} Sfq8(fHqiki b q(f\" XSH@Si%q\"Si(ffqiS i(S q Y x b Y @ fHi%k\"(ffS8\"q %2q%q%Si ( q(if(i q\"i%(Sqq(\" (f\"2 ( ... Date Added: 2009-08-10 20:33:49 |
| lab1_tutorail5.txt Path: E. Michigan >> IS >> 624 Fall, 2008 Description: Script started on Sat Feb 11 20:29:11 2006 (bloch) ls -ks[K[Kl total 1388 drwxr-x- 2 nw6241 is6241 512 Apr 24 2003 bin -rw-r- 1 nw6241 is6241 253952 Feb 11 20:28 lab1.txt -rw-r- 1 nw6241 is6241 0 Feb 11 20:29 lab1_tutora... Date Added: 2009-08-10 20:33:49 |
| FAA Final writeup v15-Tyler.doc Path: Minnesota >> WATS >> 0172 Fall, 2009 Description: University of Minnesota Duluth Department of Mechanical and Industrial Engineering FAA Airport Design Competition Final Report for Federal Aviation Administration FAA Airport Design Competition David Aarsvold Drew Hauck Elpiniqi Martopullo Tyler Wa... Date Added: 2009-08-10 20:34:36 |
| writ2.pdf Path: Iowa State >> PDIM >> 1306 Fall, 2009 Description: TO: FROM: DATE: W. S.Thune Peter Dimpfl August 7, 2008 SUBJECT: Writing Skills Self Assessment II This is my second writing skills self assessment of basic skills. In this memo, I will review my first writing skills self assessment, completed earli... Date Added: 2009-08-10 20:36:31 |
| proj5sub.txt Path: Sonoma >> CS >> 215 Fall, 2008 Description: -rw-rw- 1 mcdonald tiawatts 2157 May 14 23:59 cs215/cs215grade5/McdonaldP5.cpp -rw-r- 1 tiawatts tiawatts 108 May 5 21:30 cs215/cs215grade5/P5.in -rw-r- 1 tiawatts tiawatts 25 May 5 21:31 cs215/cs215grade5/P5.out -rw-rw- 1 sampsonw tiawatts ... Date Added: 2009-08-10 20:38:34 |
| probability_refresher1.pdf Path: University of Toronto >> CSC >> 310 Fall, 2009 Description: ... Date Added: 2009-08-10 20:40:27 |
| hw4.pdf Path: South Alabama >> CSC >> 433 Fall, 2008 Description: CSC 433 - Artificial Intelligence Homework 4 (100pts) Due: Oct. 16, 2008 All questions are from the textbook in section 5 of Chapter 6 and section 6 of Chapter 7. 1. 6.3 (20pts) 2. 6.5 (20pts) 3. 6.8 (20pts) 4. 7.3 (only translate to conceptual gra... Date Added: 2009-08-10 20:41:00 |
| Maps.ppt Path: Arizona >> CS >> 227 Fall, 2008 Description: vti_encoding:SR|utf8-nl vti_timelastmodified:TR|28 Apr 2006 16:51:43 -0000 vti_title:SR|Computing Fundamentals with C+ vti_assignedto:SR| vti_author:SR|mercer vti_syncwith_localhost\ \\:/r\\:TR|28 Apr 2006 16:51:43 -0000 vti_syncwith_localhost\\p\\:/p\\:T... Date Added: 2009-08-10 20:42:49 |
| hw4.pdf Path: Kentucky >> MA >> 213 Fall, 2008 Description: e I e | e dpv x s xpqyx p k p p s pq s i kw f d y{q~tyvlvtky5ylt)nvuy3F}lktsygqXnmtslcihgS v s 6 g sp p w v x k w p i p x s qyxp p xq w s q p k o kw f d qitbylwkptsplbyglkSwlwk5gvkxuytqytbytplbnmtslcihg... Date Added: 2009-08-10 20:43:38 |
| review3.pdf Path: Kentucky >> MA >> 213 Fall, 2008 Description: dt WU d Y di U s bYtg XcxaescalXtpWXujd`bXepWeccQaXem t WU d c`Xajscam q evpbxXaesQypscpaeYpbpt2ehySx`taXexgXcasrWepaeYpbpt2ejXpvcx`taXem fi d bU f f W s b f Y WYt d vt t f f W s b s Y WYtg dcrceYrbt\'`bXpWpcwdpWexXXcew`dgWXXt`W&m a f W f ... Date Added: 2009-08-10 20:43:42 |
| cse642_090707.pdf Path: SUNY Stony Brook >> CSE >> 642 Fall, 2008 Description: An open problem on greetings CSE 642 - Algorithms reading group Stony Book University Scribes: Giordano Fusco, Mohammad T. Irfan ({fusco, mtirfan}@cs.) September 7, 2007 1 Introduction An interesting open problem was introduced by Professor Micha... Date Added: 2009-08-10 20:44:14 |
| Strikeflyer.pdf Path: Michigan State University >> MILLE >> 515 Fall, 2009 Description: BORDERS WORKERS ARE ON STRIKE! Please do not cross our picket line. Why are Borders workers striking beginning November 8, 2003? In the words of long-time employee Hal Brannan: \"After working at Borders for 18 years and trying to negotiate for nearly... Date Added: 2009-08-10 20:44:29 |
| Riemann_Zeta_in_Function_Fields.pdf Path: W. Alabama >> MATH >> 145 Fall, 2009 Description: ... Date Added: 2009-08-10 20:44:50 |
| C475-decision-table.pdf Path: Winthrop >> CSCI >> 475 Fall, 2008 Description: CSCI 475 Chapter 4 Exercise: Creating a Decision Table Construct a decision table from the following narrative that specifies part of a billing system for an electric utility. If the customer account is billed using a fixed rate method, a minimum m... Date Added: 2009-08-10 20:45:02 |
| tiechorpt.pdf Path: Georgia Tech >> ECE >> 4025 Fall, 2009 Description: Disclaimer: This document was part of the DSP Solution Challenge 1995 European Team Papers. It may have been written by someone whose native language is not English. TI assumes no liability for the quality of writing and/or the accuracy of the inform... Date Added: 2009-08-10 20:45:16 |
| moonmercury.pdf Path: Alaska Anch >> GEOS >> 294 Fall, 2009 Description: Ratio of Satellite(s) Mass to Planet Mercury 0 Venus 0 Earth 0.012 Mars 2.00E-08 Jupiter 2.10E-04 Saturn 2.50E-04 Uranus 1.70E-04 Neptune 1.30E-03 Pluto 0.12 Capture Lunar size Earth-moon angular momentum Volatile depletion Fe depletion O isotopes S... Date Added: 2009-08-10 20:45:48 |
| WSECh2_lastslide.pdf Path: Washington >> LING >> 233 Fall, 2009 Description: Why dialects? Linguistic + social = millions of possibilities BUT: a highly structured process ... Date Added: 2009-08-10 20:45:50 |
| dp3.pdf Path: Washington University in St. Louis >> CSE >> 260 Fall, 2009 Description: CSE 260M Design Problem 3 Due December 6, 2006 Extend your \"color bar\" generator from Design Problem 2 to display a more elaborate pattern stored in a block RAM inside the Spartan 3 FPGA. Initialize your pattern in the block RAM using a .coe file wh... Date Added: 2009-08-10 20:46:00 |
| HCP.ppt Path: Allan Hancock College >> ENGN >> 4545 Fall, 2009 Description: V1 V+ I+ Z I1 IZ I2 V- V2 ... Date Added: 2009-08-10 20:46:15 |
| LCO Package Eval.doc Path: USC >> CSCI >> 577 Fall, 2009 Description: Christ Shakhmalian CS577A Fall 2004 IV&V Homework LCO Package Evaluation A. Management Overview - List any features of the problem and solution described in this artifact that are particularly good, of which a nontechnical customer should be aware. ... Date Added: 2009-08-10 20:46:45 |
| MOM_Lec_18.ppt Path: Washington >> ME >> 354 Fall, 2009 Description: Mechanics of Materials Lab Lecture 18 Fatigue Mechanical Behavior of Materials Sec. 9.6-9.7 Jiangyu Li University of Washington 1 Jiangyu Li, University of Washington S-N Diagram 2 Jiangyu Li, University of Washington S-N Diagram Endurance li... Date Added: 2009-08-10 20:46:52 |
| robocopy.doc Path: New Hampshire >> CIS >> 620 Fall, 2009 Description: <?xml version=\"1.0\" encoding=\"UTF-8\"?> <Error><Code>NoSuchKey</Code><Message>The specified key does not exist.</Message><Key>2c1c45d0cd13e67e3585ebea344af86007716a6f.doc</Key><RequestId>F F6E0D0C74F82941</RequestId><HostId>LADUGyHNJkzIRQAgDfJuEbHIUp2... Date Added: 2009-08-10 20:46:54 |
| L08-JavaBeans.pdf Path: SUNY Stony Brook >> CSE >> 336 Fall, 2008 Description: Session 8 Java Beans Session 8 JavaBeans 1 Reading & Reference Reading Head First Chapter 3 (MVC) p Reference JavaBeans Tutorialjava.sun.com/docs/books/tutorial/javabeans/ Robert Kelly, 2001-2009 2 2/18/2009 Robert Kelly, 2001-2009 1 S... Date Added: 2009-08-10 20:46:57 |
| brd08081990.pdf Path: Purdue >> MIN >> 1990 Fall, 2009 Description: ASSOCIATION AMERICAN OF PESTICIDE CONTROLOFFICIALS, INC. 2 7 199P AAPCO BOARD MEETING August 8, 1990 Greensboro, N .C. Board members present: President Art Losey, President-elect Phil Benedict, Bud Paulson, Billy Walls, Von McCaskill, Mike Fresvik, ... Date Added: 2009-08-10 20:47:15 |
| README.txt Path: Old Dominion >> CS >> 555 Fall, 2008 Description: NAME: MANOHER SHATHA CS LOGIN: mshatha to compile program: * javac simulation.java to run program: * java simulation... Date Added: 2009-08-10 20:47:37 |
| Synaptic_transmission2.pdf Path: Washington >> ZOOL >> 448 Fall, 2009 Description: Zool 448 Jan 21, 2003 Today\'s plan Review of basic synaptic mechanisms Role of calcium Differences between NMJ and CNS synapses Summation: spatial and temporal Key steps in chemical transmission Action potential in presynaptic terminal Depola... Date Added: 2009-08-10 20:48:10 |
| PAE1642.t06.bys-logo.pdf Path: UCSC >> I >> 1642 Fall, 2009 Description: PAE1642.t06 bys 4 3 2 1 12 20 30 40 50 E 4 3 2 1 H Y E H E H G H D P H P E G T P E P H P E G E 100 P E G T P E 4 3 2 1 P T P E P E Y P T P E H E 112 E 110 62 70 80 90 RY R VNAKG AVQYTVDGNIVKILAGPGE L EI V FE A W GF L D... Date Added: 2009-08-10 20:48:13 |
| 24ps6.pdf Path: Laurentian >> CHEM >> 2410 Fall, 2009 Description: Chemistry 2410: Problem Sheet 6 1. The acid dissociation constant for chloroacetic acid is 1.36 x 10-3. Calculate [H3O+] for a solution containing 0.0200 M chloroacetic acid, neglecting the small amount of H3O+ produced from the dissociation of H2O. ... Date Added: 2009-08-10 20:48:34 |
| spec_pc_bg.txt Path: Berkeley >> ASTRO >> 00261664 Fall, 2009 Description: # tmin tmax 10.0000 1081.6157 [ksec] ;instrument XRT ;exposure 140876.67 ;xunit kev ;bintype counts 0.000000 0.010000 0.000000 0.000000 0.010000 0.020000 0.000000 0.000000 0.020000 0.030000 0.000000 0.000000 0.030000 0.040000 0.00000... Date Added: 2009-08-10 20:48:58 |
| hibernate.ppt Path: Towson >> TRITON >> 617 Fall, 2009 Description: Object/Relational Mapping HIBERNATE Report SHAOJIAN ZHU | CHIH-HUNG CHO HIBERNATE What do RDBs do well? Work with large amounts of data Searching, sorting Work with sets of data Joining, aggregating Sharing Concurrency (Transactions) Ma... Date Added: 2009-08-10 20:49:01 |
| Topic II lecture 2.ppt Path: Maryland >> GEOG >> 342 Fall, 2008 Description: Topic II lecture 2 Modeling populations Read (p133177), (p120160) in the textbook in one sitting. Models and modeling. What is a model? A verbal or mathematical statement of a hypothesis (p13) (p5) Types of models: conceptual, diagrammatic, mathem... Date Added: 2009-08-10 20:49:51 |
| Chapter9.pdf Path: W. Carolina >> CS >> 150 Fall, 2008 Description: CS 150.01 (Fall 2008) Lecture Notes Lecture Notes for CS 150 Fall 2008; Version 0.5 Copyright 2001-2008 by Mark Holliday Comments, corrections, and other feedback appreciated holliday@email.wcu.edu Chapter 9: Arrays Section 1: Array Basics Sectio... Date Added: 2009-08-10 20:50:23 |
| TitansAnalysis.doc Path: Bethel VA >> BD >> 163100 Fall, 2009 Description: Introduction The movie Remember the Titans takes place in a Virginia town in the middle of the civil rights movement. Coach Boone comes to town with the presumption of being coach Yost\'s assistant coach. The school board later decides that Coach Boon... Date Added: 2009-08-10 20:50:35 |
| blowdown.txt Path: Carnegie Mellon >> STAT >> 707 Fall, 2009 Description: D S y SPP 9.0 0.0217509 0 BA 14.0 0.0217509 0 BA 18.0 0.0217509 0 BA 23.0 0.0217509 0 BA 9.0 0.0217509 0 BA 16.0 0.0217509 0 BA 10.0 0.0217509 0 PB 5.0 0.0242120 0 BA 6.0 0.0242120 0 BA 9.0 0.0242120 0 BA 6.0 0.0242120 0 BA 9.0 0.0242120 0 BA 21.0 0.... Date Added: 2009-08-10 20:51:47 |
| Dolch Words.doc Path: E. Kentucky >> STUDENTWEB >> 445 Fall, 2009 Description: Dolch Words The Dolch words are the 220 most frequently found words in books that children read. The lists are in order of frequency. These lists are studied in first and second grade; children who learn these words have a good base for beginning... Date Added: 2009-08-10 20:51:51 |
| CA2Invoice.pdf Path: Portland >> CAS >> 325 Fall, 2009 Description: Gerbing BA 325 Summer `08 Computer Project #2: Invoicing Database The purpose of this project is to generate a simple but functional invoicing database. The database contains 4 tables: Customers, Orders, Order Lines, and Products. These tables coul... Date Added: 2009-08-10 20:52:36 |
| 6896.doc Path: Texas A&M >> JLG >> 4551 Fall, 2009 Description: Jeffrey L. Given GEOG 689 Essay #5 The philosophy of realism is based on 3 components or domains, that of the empirical, the actual, and the real. The domain of the empirical is concerned with how the world is perceived through experiences exclusivel... Date Added: 2009-08-10 20:53:04 |
| chp9.pdf Path: Tennessee >> MSE >> 201 Fall, 2009 Description: 9-13 9.11 Upon heating a lead-tin alloy of composition 30 wt% Sn-70 wt% Pb from 150C and utilizing Figure 9.8: (a) The first liquid forms at the temperature at which a vertical line at this composition intersects the eutectic isotherm-i.e., at 183C.... Date Added: 2009-08-10 20:54:07 |
| hw03.pdf Path: Maine >> COS >> 598 Fall, 2008 Description: COS 598-004 Spring 2007 c Sudarshan S. Chawathe 2007 HW03 (100 pts.) Due 2007-04-19 11:00 The main task in this assignment is implementing a program, calctrans, that maps calculus queries to algebra queries, using the method described in the textb... Date Added: 2009-08-10 20:54:17 |
| PEPII_bd_final_modification_checklist_v0.doc Path: Stanford >> E >> 158 Fall, 2009 Description: VXI CLOCK MODULE PC-340-306-01-R2 PEP-II Model Final Design Modification List (assembled board) JED/SLAC/12-16-2002 The document is a checklist for verifying completion of the final rework and modifications required for Production release of the R2 c... Date Added: 2009-08-10 20:54:31 |
| vxi_clk_r2_final_added_changes.doc Path: Stanford >> E >> 158 Fall, 2009 Description: John Dusatko SLAC/ESD July 19, 2002 LLRF VXI_CLK_R2 p/n 340-306-01-R2 7-19-2002 Additional Changes and Corrections Purpose This document provides a description of the final changes and correction made to the VXI_CLK_R2 board after inspection of the... Date Added: 2009-08-10 20:54:38 |
| born.pdf Path: Penn State >> PHYS >> 412 Fall, 2008 Description: Born simulation report Name: The atoms in a solid are in constant thermally induced motion. In \"born\" we study the dynamics of a linear chain of atoms. We assume that the atomic arrangement that has minimum energy is the periodic array discussed in ... Date Added: 2009-08-10 20:55:04 |
| 13g-bondfund.pdf Path: Ohlone >> ORG >> 20060208 Fall, 2009 Description: FY05-06 2nd Qtr Bond Fund 12/31/05 Report as of 12/31/2005 ip scr De tion t ed vis udge Re B 24,109,999.00 5,946,246.79 63,683,441.21 5,500,000.00 99,239,687.00 ps ve le ce Ex lati lab mu ctual vai Balan u A C A 23,992,081.78 5,538,436.05 4,247,... Date Added: 2009-08-10 20:55:58 |
| final-exam-comments.txt Path: UMBC >> CMSC >> 491 Fall, 2009 Description: Point structure: Each lettered problem is worth 5 points. 1A. Apache has a configuration file or files which is used tell the Apache server what capabilities it should offer. What lines of configuration are needed to support CGI? The bare... Date Added: 2009-08-10 20:56:15 |
| a1roomgrid1.pdf Path: University of Hawaii - Hilo >> ICS >> 606 Fall, 2009 Description: 0 0 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 0 V 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 0 1 2 3 4 5 6 C... Date Added: 2009-08-10 20:56:59 |
| CHEM445_Schedule of Experiments_02S.xls Path: Delaware >> CHEM >> 445 Fall, 2008 Description: Schedule of Experiments Group Student 1 Kathryn Durant 1 Stephen Ekatan 2 Britton Fink 2 Jessica Jennings 3 Nathan Jovanelly 3 Jessica Karacz 4 Kenneth Knudsen 4 Amee LaBonte 5 Mali Liu 5 Christopher Page 6 Eric Pickert 6 Randall Press Monday, 230-6... Date Added: 2009-08-10 20:57:03 |
| Chapter11_phys107.pdf Path: Ole Miss >> PHYSSCI >> 107 Fall, 2009 Description: Chapter 11: The Atomic Nature of Matter 1. All matter is made up of atoms. Individual atoms are made up of protons, electrons, and neutrons. There are only 88 (or 92) naturally occurring types of atoms. These types are called elements. The number of ... Date Added: 2009-08-10 20:57:13 |
| PS2_F04.pdf Path: Carleton >> CHEM >> 234 Fall, 2009 Description: Chemistry 234 G. E. Hofmeister Fall 2004 PS 2 Due by 5 PM 9-17-04 This is from your Techniques in Organic Chemistry (lab book) book, by Mohrig, et. al. Reading: Problems: Read Technique 20, pp 290-298 p 299: 4, 5 p 300: 1, 5, 6 (you do not need the... Date Added: 2009-08-10 20:57:15 |
| mtsamples_crito.pdf Path: Virginia Tech >> PHIL >> 2115 Fall, 2008 Description: PAPER #1-CRITO The problem to be addressed in this paper is whether Socrates was successful in his conclusion that we have an unconditional, moral obligation to obey the laws and lawful decisions of the state. In this paper, I will defend the view t... Date Added: 2009-08-10 20:58:42 |
| spec_pc.txt Path: Berkeley >> ASTRO >> 00293587 Fall, 2009 Description: # tmin tmax 57.418835 3564.30 [ksec] ;instrument XRT ;exposure 15056.062 ;xunit kev ;bintype counts 0.000000 0.010000 0.000000 0.000000 0.010000 0.020000 0.000000 0.000000 0.020000 0.030000 0.000000 0.000000 0.030000 0.040000 0.00000... Date Added: 2009-08-10 20:58:48 |
| LIS48802SU09syllabus.pdf Path: Simmons >> LIS >> 488 Fall, 2009 Description: Summer 2009 Technology for Information Professionals Simmons GSLIS LIS 488-02 (Summer 2009) Technology for Information Professionals Linnea Johnson 617-521-2834 Office: P-204W linnea@simmons.edu aim: linneagslis ... Date Added: 2009-08-10 20:59:05 |
| ms122NW19930930f.pdf Path: Southern Utah >> MS >> 122 Fall, 2009 Description: LEAVITT, MILITARY BRASS DEDICATE GARN COMPLEX Steve Fidel The Deseret News. Salt Lake City, Utah: Sept 30, 1993. pg.B.15. Copyright The Deseret News Sept. 30, 1993 Eighteen Apache attack helicopters and the hundreds of soldiers who fly and support th... Date Added: 2009-08-10 20:59:44 |
| Measurements_Notes.pdf Path: E. Michigan >> PSCI >> 110 Fall, 2008 Description: Measurements Hints for answering some of the lab manual\'s questions Q1: Water is available at the sinks between the lab stations. Q5-B: Do not actually measure. Use your textbook as a reference. Q6-A: Recall that 12 inches = 1 foot. Q6-B: Recall ... Date Added: 2009-08-10 21:01:43 |
| 102midanswers.pdf Path: CUNY Baruch >> JPN >> 102 Fall, 2009 Description: Elementary Japanese II Mid-term (100 points total) March 20, 2003 Name: Part I Fill in all blanks in the following table. The first line is filled in completely as an example. [36 points] English buy eat swim come wake up have, exist wrap write be,... Date Added: 2009-08-10 21:01:50 |
| logdensity_logz.pdf Path: Concordia Chicago >> A >> 482 Fall, 2009 Description: Log [energy density (GeV )] 4 -36 -40 radiation -44 matter dark energy -48 4 3 2 1 0 -1 Log [1+z] ... Date Added: 2009-08-10 21:01:50 |
| figure-3.7.pdf Path: Purdue >> IXP >> 1200 Fall, 2009 Description: 0 SOURCE PORT MESSAGE LENGTH 16 DESTINATION PORT CHECKSUM 31 BEGINNING OF PAYLOAD . . . ... Date Added: 2009-08-10 21:02:20 |
| E40NE-E-MadF0.7.xls Path: Air Force Academy >> GES >> 125 Fall, 2009 Description: Cluster # CM R-L (orig) CM A-P (orig) CM I-S (orig) CM R-L (tlrc) CM A-P (tlrc) 1 -50.3 -22.3 -15.4 -48 22 2 52.7 -19.9 -15.4 52 24 3 -55.3 -6.6 -5.6 -54 35 4 62.1 -14.9 -15.4 62 28 5 -38.2 -3.5 -5.6 -37 38 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21... Date Added: 2009-08-10 21:02:32 |
| HW8P3-S.pdf Path: Maryland >> PHYS >> 374 Spring, 2001 Description: HW8P3-S.nb 1 Physics 374 Fall 2004 Prof. E. F. Redish HW8, Problem 3 a. We are given that at time = 0, the shape of the pulse is given by F(X) = Ae-H b L , and that this pulse is moving in the positive x direction with a speed vo . We have shown in... Date Added: 2009-08-10 21:02:55 |
| syllabus.doc Path: UNL >> MYWEB >> 105 Fall, 2009 Description: CHEMISTRY 105 Summer I, 2003 Course Syllabus Instructor : Office: Phone No.: E-mail: Office Hours: Course Details: Class Meetings: Web site address: Dr. Gayle Nicoll 326 Hamilton Hall 472-3301 nicoll8@cox.net T 11:00 am to 12:00 noon, F 11:00 am to ... Date Added: 2009-08-10 21:03:59 |
| exam1b.doc Path: UNL >> MYWEB >> 116 Fall, 2009 Description: Name: _ ID #: _ Group Name:_ 100 Exam #1 Instructions: 1. Write your name, ID number, and Group Name at the top of this sheet. 2. This exam consists of 8 questions, worth a total of 100 points. Make sure you have all the pages: you should have a to... Date Added: 2009-08-10 21:03:59 |
| exam1b.doc Path: UNL >> MYWEB >> 110 Fall, 2009 Description: Name: _ ID #: _ Group Name:_ 100 Exam #1 Instructions: 1. Write your name, ID number, and Group Name at the top of this sheet. 2. This exam consists of 8 questions, worth a total of 100 points. Make sure you have all the pages: you should have a to... Date Added: 2009-08-10 21:04:01 |
| ps06sol.pdf Path: Cal Poly Pomona >> PHY >> 235 Fall, 2009 Description: Physics 235 Problem Set #6 Guide and Answers Professor Mallinckrodt Please note that (except where otherwise noted) these are decidedly not intended to model \"good\" solutions; you would need to add figures and lots of words of explanation. They ar... Date Added: 2009-08-10 21:04:12 |
| add4cont.pdf Path: Central Washington University >> CHEM >> 345 Fall, 2009 Description: ... Date Added: 2009-08-10 21:04:40 |
| 3.12_2.pdf Path: New Mexico >> ME >> 306 Fall, 2008 Description: ... Date Added: 2009-08-10 21:04:50 |
| arf_pc.txt Path: Berkeley >> ASTRO >> 00202505 Fall, 2009 Description: ;instrument XRT ;exposure 51696.391 ;xunit kev ;bintype counts 0.0000000 0.0049999999 13.979585 1.00000 0.0049999999 0.0099999998 14.029441 1.00000 0.0099999998 0.015000000 14.079297 1.0... Date Added: 2009-08-10 21:05:10 |
| hw11_sol.pdf Path: Texas >> PGE >> 381 Fall, 2008 Description: 1 PGE 381L FALL 2002 ADVANCED PETROPHYSICS Solution to Homework 11 Problem 1: Calculation of a waterflood performance. The data set and calculations for this problem are shown in Table 1 and Table 2, respectively. Table 1 Data Set for Problem 1 In... Date Added: 2009-08-10 21:05:37 |
| subjectIndexing.ppt Path: Drexel >> I >> 300 Fall, 2009 Description: INSYS 300 Subject Indexing Subject Indexing a A human analytic process for identifying, selecting, and representing document concepts Create indexing languages Using standardized, limited vocabularies for index purposes. Assign indexing terms ... Date Added: 2009-08-10 21:05:49 |
| MATH407GradesA.xls Path: Washington >> MATH >> 407 Fall, 2008 Description: Student Number Quiz 1 Quiz 2 Quiz 3 Quiz 4 Quiz 5 Quiz 6 Quiz 7 Quiz Tot 21 13 13 15 10 11 13 13.5 320221 Asplund,Steven Michael 1 14 13 14 10 14 11 13.75 325344 Cho,Christopher Jayong0 10 11 13 15 10 15 15 14.5 113618 Do,Laurence 10 7 13 15 13 11 5... Date Added: 2009-08-10 21:06:11 |
| Traj_run_user.doc Path: Purdue >> AAE >> 450 Fall, 2009 Description: User\'s Guide to Running the Trajectory Code Using AAE450_Trajectory_run.m (and AAE450_Trajectory_run_distribute.m) Input/Output modules. Revision 1.3 Written by Elizabeth Harkness 13 February 2008 Description: The function AAE450_Trajectory_run.m is ... Date Added: 2009-08-10 21:06:27 |
| projreqs.ps Path: RPI >> ECSE >> 35678 Spring, 2009 Description: %!PS-Adobe-2.0 %Creator: dvips 5.47 Copyright 1986-91 Radical Eye Software %Title: projreqs.dvi %Pages: 2 1 %BoundingBox: 0 0 612 792 %EndComments %BeginProcSet: tex.pro /TeXDict 200 dict def TeXDict begin /N /def load def /B{bind def}N /S /exch load... Date Added: 2009-08-10 21:07:11 |
| 640_DBMS_Solution.doc Path: University of Baltimore >> INSS >> 640 Fall, 2009 Description: Solution OPC Project INSS 640 Management Summary OPC is experiencing problems with product mix and has provided January data for us to provide guidance on product mix. OPC deals with office supplies and typically has low margins. Currently they have ... Date Added: 2009-08-10 21:07:40 |
| project1.ps Path: Concordia Chicago >> CS >> 117 Spring, 2009 Description: %!PS-Adobe-2.0 %Creator: dvipsk 5.58f Copyright 1986, 1994 Radical Eye Software %Title: project1.dvi %Pages: 5 %PageOrder: Ascend %BoundingBox: 0 0 612 792 %EndComments %DVIPSCommandLine: dvips -o project1.ps project1 %DVIPSParameters: dpi=300, comme... Date Added: 2009-08-10 21:09:41 |
| pspice_ac_analysis.pdf Path: Brookdale >> ENGI >> 242 Spring, 2008 Description: ENGI 242 ELEC 222 PSpice AC Analysis Created 4 March 2003 Professor Andrew H. Andersen, Jr. AC Sweep Example Getting started 1. Start the Orcad schematic capture program 2. Start a new project (or open an existing one) (File New) 3. Save the new p... Date Added: 2009-08-10 21:09:45 |
| elec111general_info.pdf Path: Brookdale >> ELEC >> 111 Spring, 2008 Description: Brookdale Community College Engineering and Technology Department ELEC 111 - Instructor Information Spring 2005 Instructor Name - Professor Andrew H. Andersen, Jr. Office - ATC 107 Office Hours - See http:/www.brookdalecc.edu/fac/engtech/aandersen/of... Date Added: 2009-08-10 21:10:10 |
| hypothalamohypophyseal.ppt Path: Kent State >> BIOLOGY >> 40432 Fall, 2009 Description: <?xml version=\"1.0\" encoding=\"UTF-8\"?> <Error><Code>NoSuchKey</Code><Message>The specified key does not exist.</Message><Key>2cf75c2ce79afaeb9b8a013a467bdb401bb2f41a.ppt</Key><RequestId>4 6831EDDE456BE98</RequestId><HostId>2w4A+x9/4D78+b3AT+kTisZNMjF... Date Added: 2009-08-10 21:11:30 |
| 220MT2S04ANSWERS.doc Path: CSU Northridge >> HCBUS >> 008 Fall, 2009 Description: FOUNDATIONS OF ACCOUNTING - ACCT 220 _ NAME SECOND MIDTERM EXAMINATION _ SPRING 2004 STUDENT ID NUMBER VERSION 1 INSTRUCTIONS: Print your name and CSUN student ID number in the box at the upper right corner of this test paper. Print your name in the ... Date Added: 2009-08-10 21:11:34 |
| 00600030.pdf Path: Nevada >> PUB >> 0060 Fall, 2009 Description: ... Date Added: 2009-08-10 21:12:22 |
| fastfoodfacts2.doc Path: Fond du Lac >> PED >> 209 Fall, 2009 Description: McDonald\'s Sweet \'N Sour Sauce (28 g) zero mg. Cholesterol 140 mg. Sodium zero g Protein 10 g Sugar 50 Calories zero g Fat zero Calories zero g 11 g zero g from Fat Saturated Fat Carbohydrates Dietary Fiber Panera Plain bagel zero mg. Cholesterol ... Date Added: 2009-08-10 21:12:46 |
|
|
Get Started With Course Hero Today!
Get study guides, join study groups, and more!
Sign up in seconds with your Facebook account!
Course Hero is a Facebook Application Partner.
Click below to sign-up for FREE.
Our Social Learning Network was built to provide students and key learning partners like professors a platform to share, meet and collaborate while accelerating their comprehension of course-related theories and concepts. We are committed to providing you immediate access to a growing wealth of study materials and an unparalleled academic network of students, professors and other key partners. Why do you care? Because you want the best grade possible and at times need a 24/7 resource that’s responsive to your needs. |
|
What People Are Saying About Course Hero
|
|||
|
|||
|
Explore the benefits of joining Course Hero's social learning network.
|
|||
![]() |
Get millions of study materials now!Need lecture notes for a missed class or want insightful explanation of the theories and concepts you learn in class? Look no further, Course Hero’s Study Materials empowers you to find a broad and deep set of materials that can help you right now!
Click below to sign-up for FREE.
|
||
![]() |
Get over 200,000 textbook solutions now!Having difficulty with your homework and need documents that are relevant for your Textbook? Don't be frustrated. Course Hero's Textbook Help presents you study materials from many college courses.
Click below to sign-up for FREE.
|
||
![]() |
Meet over 300,000 students and your fellow classmates now!Want to meet your current classmates or those that took the class last year? Don’t worry or have anxiety. Course Hero’s Study Groups gives you the seamless opportunity to develop both anonymous or direct relationships with those classmates whom you want to meet and get help from right now!
Click below to sign-up for FREE.
|
||


