Course Solutions And Notes - 28ac 31
| 307b.pdf Path: Wisconsin >> WILL >> 0065 Fall, 2009 Description: ... Date Added: 2009-06-24 09:29:03 |
| 313f.pdf Path: Wisconsin >> WILL >> 0065 Fall, 2009 Description: ... Date Added: 2009-06-24 09:29:10 |
| 313d.pdf Path: Wisconsin >> WILL >> 0065 Fall, 2009 Description: ... Date Added: 2009-06-24 09:29:10 |
| 487722b8.pdf Path: Wisconsin >> WILL >> 0085 Fall, 2009 Description: ... Date Added: 2009-06-24 09:30:18 |
| 4877207d.pdf Path: Wisconsin >> WILL >> 0085 Fall, 2009 Description: ... Date Added: 2009-06-24 09:30:32 |
| 487785cd.pdf Path: Wisconsin >> WILL >> 0114 Fall, 2009 Description: ... Date Added: 2009-06-24 09:31:37 |
| 487786ee.pdf Path: Wisconsin >> WILL >> 0114 Fall, 2009 Description: ... Date Added: 2009-06-24 09:32:02 |
| 4877858d.pdf Path: Wisconsin >> WILL >> 0114 Fall, 2009 Description: ... Date Added: 2009-06-24 09:32:23 |
| 4877860c.pdf Path: Wisconsin >> WILL >> 0114 Fall, 2009 Description: ... Date Added: 2009-06-24 09:32:26 |
| 3b9b419c.pdf Path: Wisconsin >> WILL >> 0040 Fall, 2009 Description: ... Date Added: 2009-06-24 09:33:53 |
| 3b9b423b.pdf Path: Wisconsin >> WILL >> 0040 Fall, 2009 Description: ... Date Added: 2009-06-24 09:33:57 |
| 3b9b425a.pdf Path: Wisconsin >> WILL >> 0040 Fall, 2009 Description: ... Date Added: 2009-06-24 09:33:59 |
| 4876ffba.pdf Path: Wisconsin >> WILL >> 0076 Fall, 2009 Description: ... Date Added: 2009-06-24 09:34:49 |
| 4876ffc6.pdf Path: Wisconsin >> WILL >> 0076 Fall, 2009 Description: ... Date Added: 2009-06-24 09:34:51 |
| 487753be.pdf Path: Wisconsin >> WILL >> 0099 Fall, 2009 Description: ... Date Added: 2009-06-24 09:37:08 |
| 3b9ad8c9.pdf Path: Wisconsin >> WILL >> 0016 Fall, 2009 Description: ... Date Added: 2009-06-24 09:37:18 |
| 3b9adae7.pdf Path: Wisconsin >> WILL >> 0016 Fall, 2009 Description: ... Date Added: 2009-06-24 09:38:09 |
| 3b9adbdd.pdf Path: Wisconsin >> WILL >> 0016 Fall, 2009 Description: ... Date Added: 2009-06-24 09:38:34 |
| 3b9b36ca.pdf Path: Wisconsin >> WILL >> 0037 Fall, 2009 Description: ... Date Added: 2009-06-24 09:39:08 |
| 3b9b37ed.pdf Path: Wisconsin >> WILL >> 0037 Fall, 2009 Description: ... Date Added: 2009-06-24 09:39:18 |
| 3b9b38a6.pdf Path: Wisconsin >> WILL >> 0037 Fall, 2009 Description: ... Date Added: 2009-06-24 09:39:22 |
| 3b9b388a.pdf Path: Wisconsin >> WILL >> 0037 Fall, 2009 Description: ... Date Added: 2009-06-24 09:40:11 |
| 13ae.pdf Path: Wisconsin >> WILL >> 0056 Fall, 2009 Description: ... Date Added: 2009-06-24 09:40:56 |
| 3b9b10da.pdf Path: Wisconsin >> WILL >> 0027 Fall, 2009 Description: ... Date Added: 2009-06-24 09:43:14 |
| 3b9b119b.pdf Path: Wisconsin >> WILL >> 0027 Fall, 2009 Description: ... Date Added: 2009-06-24 09:44:09 |
| 48771e77.pdf Path: Wisconsin >> WILL >> 0084 Fall, 2009 Description: ... Date Added: 2009-06-24 09:45:43 |
| 48778f5d.pdf Path: Wisconsin >> WILL >> 0117 Fall, 2009 Description: ... Date Added: 2009-06-24 09:46:04 |
| 3b9b5de9.pdf Path: Wisconsin >> WILL >> 0048 Fall, 2009 Description: ... Date Added: 2009-06-24 09:47:05 |
| 3b9b5e6a.pdf Path: Wisconsin >> WILL >> 0048 Fall, 2009 Description: ... Date Added: 2009-06-24 09:47:18 |
| 3b9b5e8c.pdf Path: Wisconsin >> WILL >> 0048 Fall, 2009 Description: ... Date Added: 2009-06-24 09:47:20 |
| 2ecb.pdf Path: Wisconsin >> WILL >> 0064 Fall, 2009 Description: ... Date Added: 2009-06-24 09:49:32 |
| 48773be8.pdf Path: Wisconsin >> WILL >> 0092 Fall, 2009 Description: ... Date Added: 2009-06-24 09:51:25 |
| 48779a16.pdf Path: Wisconsin >> WILL >> 0120 Fall, 2009 Description: ... Date Added: 2009-06-24 09:53:09 |
| 48779ab6.pdf Path: Wisconsin >> WILL >> 0120 Fall, 2009 Description: ... Date Added: 2009-06-24 09:53:29 |
| 487703e7.pdf Path: Wisconsin >> WILL >> 0077 Fall, 2009 Description: ... Date Added: 2009-06-24 09:54:56 |
| 487704c1.pdf Path: Wisconsin >> WILL >> 0077 Fall, 2009 Description: ... Date Added: 2009-06-24 09:55:08 |
| 487705d5.pdf Path: Wisconsin >> WILL >> 0077 Fall, 2009 Description: ... Date Added: 2009-06-24 09:55:28 |
| 487705f5.pdf Path: Wisconsin >> WILL >> 0077 Fall, 2009 Description: ... Date Added: 2009-06-24 09:55:34 |
| 4877032b.pdf Path: Wisconsin >> WILL >> 0077 Fall, 2009 Description: ... Date Added: 2009-06-24 09:55:40 |
| MAT204.pdf Path: Maine >> PDFS >> 204 Fall, 2009 Description: 1 0 0 1. 0 2. 0 3. 0 4. 0 5. 0 6. 0 7. 0 8. 0 9. 010. 011. 012. UNIVERSITY OF SOUTHERN MAINE STUDENT INPUT FOR TEACHING FACULTY EVALUATIONS - MATH AND STATISTICS - SPRING 2004 885 STUDENTS RESPONDED ENTIRE DEPT QUESTION MEDIAN MEAN STD. NO 1 2 DEV.... Date Added: 2009-06-24 09:57:08 |
| 3b9af170.pdf Path: Wisconsin >> WILL >> 0007 Fall, 2009 Description: ... Date Added: 2009-06-24 09:58:14 |
| ELE207GEGN.pdf Path: Maine >> PDFS >> 207 Fall, 2009 Description: STUDENT INSTRUCTIONAL REPORT II - (SIR II) Instructor: * Survey Count: 18 Subject: GEGN Course: * Not Applicable 5 Very Effective 8 44.4% 8 44.4% 9 50.0% 8 44.4% 8 44.4% 41 45.6% Term: 207 CRN: * 4 Effective 6 33.3% 10 55.6% 6 33.3% 8 44.4% 7 38.9% ... Date Added: 2009-06-24 09:58:53 |
| 3b9b0ef8.pdf Path: Wisconsin >> WILL >> 0026 Fall, 2009 Description: ... Date Added: 2009-06-24 09:59:28 |
| 3b9b0f30.pdf Path: Wisconsin >> WILL >> 0026 Fall, 2009 Description: ... Date Added: 2009-06-24 09:59:30 |
| 39a6.pdf Path: Wisconsin >> WILL >> 0067 Fall, 2009 Description: ... Date Added: 2009-06-24 10:04:06 |
| 48771a18.pdf Path: Wisconsin >> WILL >> 0083 Fall, 2009 Description: ... Date Added: 2009-06-24 10:05:02 |
| 48771b00.pdf Path: Wisconsin >> WILL >> 0083 Fall, 2009 Description: ... Date Added: 2009-06-24 10:05:40 |
| 48771bcb.pdf Path: Wisconsin >> WILL >> 0083 Fall, 2009 Description: ... Date Added: 2009-06-24 10:06:11 |
| 3b9b2bdd.pdf Path: Wisconsin >> WILL >> 0034 Fall, 2009 Description: ... Date Added: 2009-06-24 10:08:08 |
| 3b9b2c12.pdf Path: Wisconsin >> WILL >> 0034 Fall, 2009 Description: ... Date Added: 2009-06-24 10:08:30 |
| 3b9b2da6.pdf Path: Wisconsin >> WILL >> 0034 Fall, 2009 Description: ... Date Added: 2009-06-24 10:09:32 |
| 48773d92.pdf Path: Wisconsin >> WILL >> 0093 Fall, 2009 Description: ... Date Added: 2009-06-24 10:09:56 |
| 48773eb3.pdf Path: Wisconsin >> WILL >> 0093 Fall, 2009 Description: ... Date Added: 2009-06-24 10:10:52 |
| 48773f0c.pdf Path: Wisconsin >> WILL >> 0093 Fall, 2009 Description: ... Date Added: 2009-06-24 10:11:07 |
| 3b9ae2b9.pdf Path: Wisconsin >> WILL >> 0018 Fall, 2009 Description: ... Date Added: 2009-06-24 10:12:29 |
| 3b9b5621.pdf Path: Wisconsin >> WILL >> 0046 Fall, 2009 Description: ... Date Added: 2009-06-24 10:15:05 |
| 3b9b67f5.pdf Path: Wisconsin >> WILL >> 0050 Fall, 2009 Description: ... Date Added: 2009-06-24 10:16:15 |
| 4877a02f.pdf Path: Wisconsin >> WILL >> 0121 Fall, 2009 Description: ... Date Added: 2009-06-24 10:17:26 |
| 48779d5d.pdf Path: Wisconsin >> WILL >> 0121 Fall, 2009 Description: ... Date Added: 2009-06-24 10:17:51 |
| xc2frate.pdf Path: MO St. Louis >> DOCS >> 252 Fall, 2009 Description: Computer Exercise 2 Spreadsheet Factor Rating You are to use a factor rating spreadsheet to help you decide among job offers. I\'ve provided a an excel sheet you can download from the website. If you prefer, You can make your own spreadsheet, and even... Date Added: 2009-06-24 10:18:20 |
| 4876f716.pdf Path: Wisconsin >> WILL >> 0074 Fall, 2009 Description: ... Date Added: 2009-06-24 10:20:23 |
| 1a5a.pdf Path: Wisconsin >> WILL >> 0058 Fall, 2009 Description: ... Date Added: 2009-06-24 10:20:31 |
| 1aa0.pdf Path: Wisconsin >> WILL >> 0058 Fall, 2009 Description: ... Date Added: 2009-06-24 10:20:55 |
| 3b9ae8e3.pdf Path: Wisconsin >> WILL >> 0006 Fall, 2009 Description: ... Date Added: 2009-06-24 10:22:17 |
| 3b9ae985.pdf Path: Wisconsin >> WILL >> 0006 Fall, 2009 Description: ... Date Added: 2009-06-24 10:22:47 |
| 3b9aed2e.pdf Path: Wisconsin >> WILL >> 0021 Fall, 2009 Description: ... Date Added: 2009-06-24 10:23:38 |
| 35d7.pdf Path: Wisconsin >> WILL >> 0066 Fall, 2009 Description: ... Date Added: 2009-06-24 10:25:51 |
| 36a5.pdf Path: Wisconsin >> WILL >> 0066 Fall, 2009 Description: ... Date Added: 2009-06-24 10:26:00 |
| 48771619.pdf Path: Wisconsin >> WILL >> 0082 Fall, 2009 Description: ... Date Added: 2009-06-24 10:28:09 |
| 487741d1.pdf Path: Wisconsin >> WILL >> 0094 Fall, 2009 Description: ... Date Added: 2009-06-24 10:28:39 |
| 487743b1.pdf Path: Wisconsin >> WILL >> 0094 Fall, 2009 Description: ... Date Added: 2009-06-24 10:29:06 |
| 3b9afcca.pdf Path: Wisconsin >> WILL >> 0010 Fall, 2009 Description: ... Date Added: 2009-06-24 10:30:29 |
| 3b9b2f7b.pdf Path: Wisconsin >> WILL >> 0035 Fall, 2009 Description: ... Date Added: 2009-06-24 10:31:05 |
| 3b9b30b6.pdf Path: Wisconsin >> WILL >> 0035 Fall, 2009 Description: ... Date Added: 2009-06-24 10:31:46 |
| 3b9b30f4.pdf Path: Wisconsin >> WILL >> 0035 Fall, 2009 Description: ... Date Added: 2009-06-24 10:31:58 |
| 3b9b30f3.pdf Path: Wisconsin >> WILL >> 0035 Fall, 2009 Description: ... Date Added: 2009-06-24 10:31:58 |
| 3b9b32f4.pdf Path: Wisconsin >> WILL >> 0035 Fall, 2009 Description: ... Date Added: 2009-06-24 10:32:33 |
| 3b9b32f3.pdf Path: Wisconsin >> WILL >> 0035 Fall, 2009 Description: ... Date Added: 2009-06-24 10:32:33 |
| 48775b60_x1a.pdf Path: Wisconsin >> WILL >> 0102 Fall, 2009 Description: ... Date Added: 2009-06-24 10:36:33 |
| 3b9ae73f.pdf Path: Wisconsin >> WILL >> 0019 Fall, 2009 Description: ... Date Added: 2009-06-24 10:38:48 |
| 3d9b.pdf Path: Wisconsin >> WILL >> 0069 Fall, 2009 Description: ... Date Added: 2009-06-24 10:39:03 |
| 3e8b.pdf Path: Wisconsin >> WILL >> 0069 Fall, 2009 Description: ... Date Added: 2009-06-24 10:39:38 |
| 3b9b6a51.pdf Path: Wisconsin >> WILL >> 0051 Fall, 2009 Description: ... Date Added: 2009-06-24 10:41:07 |
| 3b9b6aad.pdf Path: Wisconsin >> WILL >> 0051 Fall, 2009 Description: ... Date Added: 2009-06-24 10:41:20 |
| 25ad.pdf Path: Wisconsin >> WILL >> 0061 Fall, 2009 Description: ... Date Added: 2009-06-24 10:43:16 |
| 3b9ada6a.pdf Path: Wisconsin >> WILL >> 0005 Fall, 2009 Description: ... Date Added: 2009-06-24 10:46:24 |
| 3b9ada41.pdf Path: Wisconsin >> WILL >> 0005 Fall, 2009 Description: ... Date Added: 2009-06-24 10:46:28 |
| 3b9add95.pdf Path: Wisconsin >> WILL >> 0005 Fall, 2009 Description: ... Date Added: 2009-06-24 10:47:23 |
| 3b9ae7ef.pdf Path: Wisconsin >> WILL >> 0020 Fall, 2009 Description: ... Date Added: 2009-06-24 10:47:40 |
| 3b9ae8aa.pdf Path: Wisconsin >> WILL >> 0020 Fall, 2009 Description: ... Date Added: 2009-06-24 10:47:45 |
| 3b9ae883.pdf Path: Wisconsin >> WILL >> 0020 Fall, 2009 Description: ... Date Added: 2009-06-24 10:48:42 |
| 3b9b26db.pdf Path: Wisconsin >> WILL >> 0032 Fall, 2009 Description: ... Date Added: 2009-06-24 10:49:29 |
| 3b9b2547.pdf Path: Wisconsin >> WILL >> 0032 Fall, 2009 Description: ... Date Added: 2009-06-24 10:50:37 |
| 3b9b2557.pdf Path: Wisconsin >> WILL >> 0032 Fall, 2009 Description: ... Date Added: 2009-06-24 10:50:39 |
| 3b9b53cf.pdf Path: Wisconsin >> WILL >> 0045 Fall, 2009 Description: ... Date Added: 2009-06-24 10:51:08 |
| 3b9b551d.pdf Path: Wisconsin >> WILL >> 0045 Fall, 2009 Description: ... Date Added: 2009-06-24 10:52:05 |
| 487797ab.pdf Path: Wisconsin >> WILL >> 0119 Fall, 2009 Description: ... Date Added: 2009-06-24 10:52:38 |
| 487745f8.pdf Path: Wisconsin >> WILL >> 0095 Fall, 2009 Description: ... Date Added: 2009-06-24 10:53:33 |
| 487746e9.pdf Path: Wisconsin >> WILL >> 0095 Fall, 2009 Description: ... Date Added: 2009-06-24 10:53:49 |
| 3b9afe92.pdf Path: Wisconsin >> WILL >> 0011 Fall, 2009 Description: ... Date Added: 2009-06-24 10:55:00 |
| 487793af.pdf Path: Wisconsin >> WILL >> 0118 Fall, 2009 Description: ... Date Added: 2009-06-24 10:56:14 |
| 487712c7.pdf Path: Wisconsin >> WILL >> 0081 Fall, 2009 Description: ... Date Added: 2009-06-24 10:56:57 |
| 487713c0.pdf Path: Wisconsin >> WILL >> 0081 Fall, 2009 Description: ... Date Added: 2009-06-24 10:57:13 |
| 3b9b15ae.pdf Path: Wisconsin >> WILL >> 0028 Fall, 2009 Description: ... Date Added: 2009-06-24 10:58:43 |
| 4876f045.pdf Path: Wisconsin >> WILL >> 0072 Fall, 2009 Description: ... Date Added: 2009-06-24 11:02:41 |
| 48775eda.pdf Path: Wisconsin >> WILL >> 0103 Fall, 2009 Description: ... Date Added: 2009-06-24 11:03:42 |
| 9d.pdf Path: Wisconsin >> WILL >> 0052 Fall, 2009 Description: ... Date Added: 2009-06-24 11:07:07 |
| 1fa9.pdf Path: Wisconsin >> WILL >> 0060 Fall, 2009 Description: ... Date Added: 2009-06-24 11:07:48 |
| Q09.pdf Path: St. Cloud >> CSCI >> 301 Fall, 2008 Description: CSCI 301: Introduction to Algorithms and Data Structures (Fall 2008) Instructor: Pranava K. Jha Quiz 9 (Wednesday, Nov. 12) Write a client function height that takes a binary tree T as the argument and returns the height of T. A skeleton of the class... Date Added: 2009-06-24 11:08:59 |
| 487782d4.pdf Path: Wisconsin >> WILL >> 0113 Fall, 2009 Description: ... Date Added: 2009-06-24 11:10:02 |
| 4877819e.pdf Path: Wisconsin >> WILL >> 0113 Fall, 2009 Description: ... Date Added: 2009-06-24 11:10:54 |
| 4877826c.pdf Path: Wisconsin >> WILL >> 0113 Fall, 2009 Description: ... Date Added: 2009-06-24 11:11:01 |
| 4877827b.pdf Path: Wisconsin >> WILL >> 0113 Fall, 2009 Description: ... Date Added: 2009-06-24 11:11:02 |
| 3b9b2a14.pdf Path: Wisconsin >> WILL >> 0033 Fall, 2009 Description: ... Date Added: 2009-06-24 11:11:52 |
| 3b9b2a75.pdf Path: Wisconsin >> WILL >> 0033 Fall, 2009 Description: ... Date Added: 2009-06-24 11:12:11 |
| 3b9b4f2d.pdf Path: Wisconsin >> WILL >> 0044 Fall, 2009 Description: ... Date Added: 2009-06-24 11:13:30 |
| 3b9b4fbd.pdf Path: Wisconsin >> WILL >> 0044 Fall, 2009 Description: ... Date Added: 2009-06-24 11:14:05 |
| 3b9b4fd7.pdf Path: Wisconsin >> WILL >> 0044 Fall, 2009 Description: ... Date Added: 2009-06-24 11:14:10 |
| 3b9b4fea.pdf Path: Wisconsin >> WILL >> 0044 Fall, 2009 Description: ... Date Added: 2009-06-24 11:14:14 |
| 3b9b51c0.pdf Path: Wisconsin >> WILL >> 0044 Fall, 2009 Description: ... Date Added: 2009-06-24 11:14:42 |
| 3b9b01a3.pdf Path: Wisconsin >> WILL >> 0012 Fall, 2009 Description: ... Date Added: 2009-06-24 11:15:12 |
| 3b9b01b4.pdf Path: Wisconsin >> WILL >> 0012 Fall, 2009 Description: ... Date Added: 2009-06-24 11:15:14 |
| 3b9b0198.pdf Path: Wisconsin >> WILL >> 0012 Fall, 2009 Description: ... Date Added: 2009-06-24 11:15:30 |
| 3b9b0261.pdf Path: Wisconsin >> WILL >> 0012 Fall, 2009 Description: ... Date Added: 2009-06-24 11:15:53 |
| 3b9b030e.pdf Path: Wisconsin >> WILL >> 0012 Fall, 2009 Description: ... Date Added: 2009-06-24 11:16:10 |
| 48777abd.pdf Path: Wisconsin >> WILL >> 0110 Fall, 2009 Description: ... Date Added: 2009-06-24 11:17:18 |
| 48777ac3.pdf Path: Wisconsin >> WILL >> 0110 Fall, 2009 Description: ... Date Added: 2009-06-24 11:17:19 |
| 3b9ad8d7.pdf Path: Wisconsin >> WILL >> 0004 Fall, 2009 Description: ... Date Added: 2009-06-24 11:19:01 |
| 3b9af7e9.pdf Path: Wisconsin >> WILL >> 0023 Fall, 2009 Description: ... Date Added: 2009-06-24 11:20:16 |
| 3b9af76e.pdf Path: Wisconsin >> WILL >> 0023 Fall, 2009 Description: ... Date Added: 2009-06-24 11:20:48 |
| 3b9af80b.pdf Path: Wisconsin >> WILL >> 0023 Fall, 2009 Description: ... Date Added: 2009-06-24 11:20:50 |
| 3b9af90c.pdf Path: Wisconsin >> WILL >> 0023 Fall, 2009 Description: ... Date Added: 2009-06-24 11:20:55 |
| 3b9af95e.pdf Path: Wisconsin >> WILL >> 0023 Fall, 2009 Description: ... Date Added: 2009-06-24 11:21:01 |
| 48774a1d.pdf Path: Wisconsin >> WILL >> 0096 Fall, 2009 Description: ... Date Added: 2009-06-24 11:21:34 |
| 487749d3.pdf Path: Wisconsin >> WILL >> 0096 Fall, 2009 Description: ... Date Added: 2009-06-24 11:22:51 |
| 48770ed5.pdf Path: Wisconsin >> WILL >> 0080 Fall, 2009 Description: ... Date Added: 2009-06-24 11:23:23 |
| 48770f76.pdf Path: Wisconsin >> WILL >> 0080 Fall, 2009 Description: ... Date Added: 2009-06-24 11:23:59 |
| 48772b99.pdf Path: Wisconsin >> WILL >> 0088 Fall, 2009 Description: ... Date Added: 2009-06-24 11:27:11 |
| 48772bde.pdf Path: Wisconsin >> WILL >> 0088 Fall, 2009 Description: ... Date Added: 2009-06-24 11:27:20 |
| 4876f4a9.pdf Path: Wisconsin >> WILL >> 0073 Fall, 2009 Description: ... Date Added: 2009-06-24 11:28:30 |
| 4876f5f2.pdf Path: Wisconsin >> WILL >> 0073 Fall, 2009 Description: ... Date Added: 2009-06-24 11:29:10 |
| 3b9b4b74.pdf Path: Wisconsin >> WILL >> 0043 Fall, 2009 Description: ... Date Added: 2009-06-24 11:30:06 |
| 3b9b4bb4.pdf Path: Wisconsin >> WILL >> 0043 Fall, 2009 Description: ... Date Added: 2009-06-24 11:30:16 |
| 2bee.pdf Path: Wisconsin >> WILL >> 0063 Fall, 2009 Description: ... Date Added: 2009-06-24 11:32:53 |
| 487755bc.pdf Path: Wisconsin >> WILL >> 0100 Fall, 2009 Description: ... Date Added: 2009-06-24 11:33:16 |
| 487756e0.pdf Path: Wisconsin >> WILL >> 0100 Fall, 2009 Description: ... Date Added: 2009-06-24 11:33:39 |
| 3b9b1d55.pdf Path: Wisconsin >> WILL >> 0030 Fall, 2009 Description: ... Date Added: 2009-06-24 11:34:06 |
| 3b9b1eb0.pdf Path: Wisconsin >> WILL >> 0030 Fall, 2009 Description: ... Date Added: 2009-06-24 11:34:45 |
| 3b9b1fd9.pdf Path: Wisconsin >> WILL >> 0030 Fall, 2009 Description: ... Date Added: 2009-06-24 11:35:20 |
| 48774c6e.pdf Path: Wisconsin >> WILL >> 0097 Fall, 2009 Description: ... Date Added: 2009-06-24 11:36:24 |
| 48774cfc.pdf Path: Wisconsin >> WILL >> 0097 Fall, 2009 Description: ... Date Added: 2009-06-24 11:37:05 |
| 487770f4.pdf Path: Wisconsin >> WILL >> 0108 Fall, 2009 Description: ... Date Added: 2009-06-24 11:37:47 |
| 3b9b0a65.pdf Path: Wisconsin >> WILL >> 0013 Fall, 2009 Description: ... Date Added: 2009-06-24 11:38:16 |
| 3b9b3b90.pdf Path: Wisconsin >> WILL >> 0038 Fall, 2009 Description: ... Date Added: 2009-06-24 11:40:21 |
| 48772aab.pdf Path: Wisconsin >> WILL >> 0087 Fall, 2009 Description: ... Date Added: 2009-06-24 11:41:47 |
| 48772ab7.pdf Path: Wisconsin >> WILL >> 0087 Fall, 2009 Description: ... Date Added: 2009-06-24 11:41:52 |
| 487727a2.pdf Path: Wisconsin >> WILL >> 0087 Fall, 2009 Description: ... Date Added: 2009-06-24 11:41:56 |
| 48777f06.pdf Path: Wisconsin >> WILL >> 0112 Fall, 2009 Description: ... Date Added: 2009-06-24 11:43:53 |
| 48777f9b.pdf Path: Wisconsin >> WILL >> 0112 Fall, 2009 Description: ... Date Added: 2009-06-24 11:44:02 |
| 48777fc8.pdf Path: Wisconsin >> WILL >> 0112 Fall, 2009 Description: ... Date Added: 2009-06-24 11:44:25 |
| 3b9ad2f1.pdf Path: Wisconsin >> WILL >> 0003 Fall, 2009 Description: ... Date Added: 2009-06-24 11:45:26 |
| 3b9ad12c.pdf Path: Wisconsin >> WILL >> 0003 Fall, 2009 Description: ... Date Added: 2009-06-24 11:45:48 |
| 3b9af34e.pdf Path: Wisconsin >> WILL >> 0022 Fall, 2009 Description: ... Date Added: 2009-06-24 11:47:18 |
| 9f0.pdf Path: Wisconsin >> WILL >> 0054 Fall, 2009 Description: ... Date Added: 2009-06-24 11:48:16 |
| a6b.pdf Path: Wisconsin >> WILL >> 0054 Fall, 2009 Description: ... Date Added: 2009-06-24 11:48:48 |
| a9f.pdf Path: Wisconsin >> WILL >> 0054 Fall, 2009 Description: ... Date Added: 2009-06-24 11:48:51 |
| 3b9b4aec.pdf Path: Wisconsin >> WILL >> 0042 Fall, 2009 Description: ... Date Added: 2009-06-24 11:50:05 |
| 3b9b48ed.pdf Path: Wisconsin >> WILL >> 0042 Fall, 2009 Description: ... Date Added: 2009-06-24 11:51:02 |
| YHL007C.t04.o_notor2-logo.pdf Path: UCSC >> YHL >> 007 Fall, 2009 Description: YHL007C.t04 o_notor2 4 3 2 1 M S N H NG NNMM P S N HNN NNNNNNHNN S NNNGHHHNNXSXSGXNNNSBPSGHNHGXN S G S XX X X X X XXNXN X XXXX X X X X X XX S G S S X 1 10 20 30 40 N 4 3 2 1 HN GN HN G NN NBBS B S M XXXX A P N B M B GNNNGHHNGNNNNXNNNNNN... Date Added: 2009-06-24 11:52:23 |
| Wile_E_inclinded_plane-PHY161S07.pdf Path: Mercer >> PHY >> 161 Fall, 2006 Description: Wile E Coyote Inclined Plane Problems Wile E. Coyote is trying to set up an elaborate trap to catch the Roadrunner and he needs your help. He needs to move a rock on an inclined plane, shown to the right. The plane is inclined at an angle of 35o. The... Date Added: 2009-06-24 11:53:18 |
| lect13-bt_4up.ps Path: Allan Hancock College >> CS >> 1021 Fall, 2009 Description: %!PS-Adobe-2.0 %Creator: dvips(k) 5.92b Copyright 2002 Radical Eye Software %Title: lect13-bt.dvi %Pages: 6 0 %PageOrder: Ascend %Orientation: Landscape %BoundingBox: 0 0 596 842 %DocumentFonts: Helvetica-Bold Times-Roman CMSY5 MSAM10 Symbol %+ Times... Date Added: 2009-06-24 11:53:58 |
| OpEd.StraitsTimes.Singapore.pdf Path: Yale >> PSYC >> 123 Fall, 2009 Description: November 6, 2006 ... Date Added: 2009-06-24 11:55:00 |
| test1.pdf Path: Cincinnati >> PHYS >> 202 Winter, 2008 Description: ... Date Added: 2009-06-24 11:57:55 |
| lecture11_outline-ch13.rtf Path: George Mason >> IT >> 101 Fall, 2008 Description: Chapter13:TheTelephoneSystem:WiredandWireless *AnalogTelephonesystem *Digitaltelephonesystem *Cellulartelephonesystem *Satellitetelephones Introduction *Nowthatwehavelearnedwhatinformationis,howtorepresentit,andhowtoconvertit fromanalogtodigitalform... Date Added: 2009-06-24 11:58:20 |
| Midterm2Solution.pdf Path: Bethel VA >> MATH >> 307 Spring, 2009 Description: MATH 307, SPRING QUARTER 2005, Midterm 2 SOLUTION 1. Linear Congruences (a) (6 points) Find all incongruent solutions modulo 102 of the congruence 26x 6 (mod 102). Solution. 102 = (3)(26) + 24, 26 = (1)(24) + 2, 24 = (12)(2) + 0. Hence, gcd(26, 102)... Date Added: 2009-06-24 12:05:10 |
| solution5.pdf Path: Stanford >> CS >> 154 Fall, 2009 Description: r rr r r 8 D r f\'ehfe gvdqryGv8ft8 f8j} t v h e t to 4 E bGF3 h q heetv y t ptv t o e % xeqygg88fmv Ir)~f8j} h q heetv y t ptv t o { )fd)Ixeqygg88fmv Ir)~f8j@ h t vv q hv et t ... Date Added: 2009-06-24 12:06:45 |
| 10pp.pdf Path: Nevada >> FIN >> 107 Fall, 2009 Description: Chapter 10 Stocks & Annuities Ken Long New River Community College Dublin, VA 24084 http:/www.nr.cc.va/fin107 1 What is a fee only financial advisor? An advisor who gives advice for a fee but does not make money on the products he sells 2 Does a s... Date Added: 2009-06-24 12:06:59 |
| P472SYL.pdf Path: Michigan State University >> PHY >> 472 Spring, 2008 Description: JAN FEB MAR APR MAY 8 10 12 15 17 19 22 24 26 29 31 2 5 7 9 12 14 16 19 21 23 26 28 2 5 7 9 12 14 16 19 21 23 26 28 30 2 4 6 9 11 13 16 18 20 23 25 27 1 3d QM 3d QM pp. 160-166 pp. 160-166 pp. 167-170 pp. 171-177 pp. 178-181 pp. 181-184 pp. 181... Date Added: 2009-06-24 12:07:41 |
| Ch2.ppt Path: Mary Hardin-Baylor >> CISC >> 2330 Fall, 2009 Description: Starting Out With C# Chapter 2 By James Chegwidden & Tony Gaddis Published By Scott Jones Publishing Chapter Topics Chapter 2 discusses the following main topics: The Parts of a C# Program The Write and WriteLine Methods, and the .NET Framewo... Date Added: 2009-06-24 12:16:54 |
| projectfinal.doc Path: Laurentian >> SCOM >> 5056 Fall, 2009 Description: COSC 5056 Design in Science Communication Assignment 5: Due Monday, February 11, 2008 Total marks: 100; weight 5% This week\'s topic is design of an interactive artefact. The exercise will be done in groups of three or, if necessary, four. Examine the... Date Added: 2009-06-24 12:21:11 |
| SCOM 5056 week 2.ppt Path: Laurentian >> SCOM >> 5056 Fall, 2009 Description: SCOM 5056 Design Theory in Science Communication week 2: the science content Dave Goforth FA377 (Fraser) 705-675-1151 ext 2316 dgoforth@cs. laurentian.ca Science Communication Design Process 1. Goals, objectives, constraints 2. Audience, context 1. ... Date Added: 2009-06-24 12:21:12 |
| grades.pdf Path: ASU >> STAT >> 342 Fall, 2009 Description: Sheet1 MAT 342 Final Grades Posting ID 0078 941 0110 478 0507 071 0715 225 0846 508 0886 058 0934 476 0970 707 1710 913 1812 611 2512 259 4333 938 5382 757 5531 842 5655 260 6557 633 7163 892 7212 154 7329 622 7405 200 7443 979 7964 547 8118 316 8254... Date Added: 2009-06-24 12:22:38 |
| final.pdf Path: ASU >> STAT >> 342 Fall, 2009 Description: h d Xf `p d (gy\'(D 1 gX V g)xw r 2g V (v U u y { | ~ | x z | z ~ | { z x d f X ` t `p X f X ` ` p Xf w p V x& ... Date Added: 2009-06-24 12:24:22 |
| tautologies.pdf Path: ASU >> STAT >> 300 Fall, 2009 Description: MAT 300 Notes on logic, Fall 2006 Here are some standard tautologies: 1. 2. 3. 4. 5. 6. 7. 8. 9. 10. 11. 12. 13. 14. 15. 16. 17. 18. 19. 20. 21. 22. 23. 24. 25. 26. 27. 28. 29. 30. 31. p p p p p q q p p q q p (p q) r p (q r) (p q) r p... Date Added: 2009-06-24 12:24:39 |
| test1.pdf Path: ASU >> STAT >> 342 Fall, 2009 Description: MAT 342 Linear Algebra John Quigg Test 1 Time limit: 1 hour, 15 minutes. No notes, books, calculators, etc. Write your solutions on the blank pages provided nothing on the test page(s) will be graded. Write on only one side of each page and leave re... Date Added: 2009-06-24 12:24:44 |
| Practicefinal.pdf Path: Iowa State >> STAT >> 226 Fall, 2008 Description: Practice Problems 1. A random sample of 172 marketing students was asked to rate on a scale from 1 (not important) to 5 (extremely important) health benefits as a job characteristic. The sample yielded a mean rating of 3.31 and a standard deviation o... Date Added: 2009-06-24 12:35:56 |
| 016Megalopt_Neuropt.pdf Path: UConn >> EEB >> 286 Fall, 2008 Description: General Entomology EEB 286, University of Connecticut Fall 2006 Neuropterida MEGALOPTERA NAME ORIGIN: Gk. megalo large, great; pteron a wing. INTRODUCTION: Dobsonflies & alderflies. A small endopterygote lineage with only 300 species described w... Date Added: 2009-06-24 12:41:53 |
| BIO103Fall2005.pdf Path: Calhoun CC >> BIO >> 103 Fall, 2009 Description: BIO 103 Open Lab Calendar - Fall Semester 2005 Labs 1 - 10 are considered CORE LABS that must be completed by ALL BIO 103 students at Calhoun Community College. Please note the dates that the labs are available - LABS MAY NOT BE PERFORMED AFTER THE F... Date Added: 2009-06-24 12:42:19 |
| mid1ansmt09.pdf Path: UMiami >> ECO >> 403 Spring, 2008 Description: First challenge: Solutions Eco 403, Spring 2009 Question 1 (15 points) a. A decrease in consumption means that less money must be held each day for purchases. Thus, the opportunity cost of holding money or forgone interest falls. Since the withdraw c... Date Added: 2009-06-24 12:42:30 |
| 05_Enzymes.pdf Path: Delta MI >> BIO >> 111 Fall, 2009 Description: 05 Enzymes Speed demons Today\'s Objectives How enzymes work Internal factors that affect turnover External factors that affect turnover Competition and Inhibition The Big Picture Organic catalysts keep cell from burning up Enzymes are enormous ... Date Added: 2009-06-24 12:46:23 |
| 571Unit1Handout.pdf Path: Tennessee >> STAT >> 571 Fall, 2009 Description: Unit 1: Introduction Statistics 571: Statistical Methods Ramn V. Len 5/25/2004 Unit 1 - Stat 571 - Ramn V. Len 1 What is Statistics? Statistics Science of collecting and analyzing data for the purpose of drawing conclusions and making decision... Date Added: 2009-06-24 12:46:37 |
| CIRExample2.doc Path: UMBC >> CSEE >> 345 Fall, 2009 Description: Code Inspection Report Version 1.0 Table of Contents 1.0 Introduction 1.1 Coding Conventions 1.2 Defect Checklist 1.3 Code Inspection Process 1.4 Impressions of the Process 1.5 Inspection Meetings 2.0 Code Inspection 2.1 Question Package 2.2 Database... Date Added: 2009-06-24 12:46:43 |
| hw-4-spr09.pdf Path: Maryland >> P >> 115 Fall, 2008 Description: Homework Assignment #4 Physics 115, Section 0201, Spring 2009 Due February 24, 2009 Essay 1, 10 points How would you use an ammeter to determine the amount of current flowing in a series circuit containing two batteries and two light bulbs? Draw a pi... Date Added: 2009-06-24 12:48:09 |
| lecture1_outline.doc Path: CSU Northridge >> PSY >> 420 Fall, 2009 Description: 8/23/04 Outline of Lecture 1 (Chap 1 and 2) Experimental vs. Non-Experimental designs 4 basic components of experimental designs o Random selection o Random assignment o Experimental manipulation o Experimenter control Variable o Independent ... Date Added: 2009-06-24 12:55:09 |
| psy420_lecture1_outline.doc Path: CSU Northridge >> PSY >> 420 Fall, 2009 Description: 8/23/04 Outline of Lecture 1 (Chap 1 and 2) Experimental vs. Non-Experimental designs 4 basic components of experimental designs o Random selection o Random assignment o Experimental manipulation o Experimenter control Variable o Independent ... Date Added: 2009-06-24 12:55:25 |
| smlprograms-post.xls Path: New Hampshire >> CS >> 405 Fall, 2008 Description: Calculate the total of two input numbers 00 01 02 03 04 05 06 1007 1008 2007 3008 2109 1109 4300 Read A (into 07) Read B (into 08) Load A Add B Store C Write C Halt Calculate the average of 7 numbers (input can be positive or negative) 00 01 02 03 0... Date Added: 2009-06-24 12:59:44 |
| homework4.pdf Path: WVU >> EE >> 513 Fall, 2008 Description: EE 513: Stochastic Systems Theory Homework #4: Expectation date assigned: Wednesday, Oct. 11, 2006 date due: Wednesday, Oct. 18, 2006 1 page; 5 problems On the due date, a short quiz will be given in class. You can use your homework and a calculator ... Date Added: 2009-06-24 13:03:38 |
| resumeold.pdf Path: Minnesota >> WUXX >> 0179 Fall, 2009 Description: Joel T. Wu 1596 Ridgefield Road #5 Cleveland Heights, OH 44118 Phone: 216-526-4010 Email: joel.wu@case.edu Education Case Western Reserve University, School of Law - Cleveland, OH J.D. Expected, May 2008 Activities Student Health Law Association Off... Date Added: 2009-06-24 13:03:43 |
| homework8.pdf Path: San Jose State >> EE >> 251 Fall, 2008 Description: EE 251. Spring 2006. Homework # 8 1. Haykin, problem 4.8 2. Haykin, problem 4.10 San Jos State University e Due: Wednesday 4/26/06 3. The purpose of this problem is to simulate an optimum receiver (matched-filter based) for binary transmission over... Date Added: 2009-06-24 13:04:36 |
| inthw.pdf Path: Alabama >> MATH >> 2381 Fall, 2009 Description: 238-001 Integration HW 01/28/05 dy = ex cos x dx x2 3x + 3 dy = 2. dx x2 3x + 2 1. 3. dy 1 =2 dx 2x + 3x + 5 1 Ans. y = ex (sin x cos x) + c 2 x2 Ans. y = x + ln +c x1 4x + 3 2 +c Ans. y = arctan 31 31 Ans. y = x 4 4 ln |x + 2| + c x+2 x2 ... Date Added: 2009-06-24 13:05:24 |
| minitab.pdf Path: Cal Poly >> STAT >> 321 Fall, 2009 Description: Guide to Minitab Dr. Jimmy Doi 1 Introduction to Minitab Minitab is a statistical analysis software package. The software is freely available to all students and is downloadable through the Technology Tab at my.calpoly.edu. When you rst launch Mi... Date Added: 2009-06-24 13:07:26 |
| hw2q1 Path: Middle East Technical University >> CE >> xxx Spring, 2009 Description: ... Date Added: 2009-06-24 13:07:31 |
| 16.Hormones&Repro.pdf Path: Cuyamaca College >> BIO >> 210 Fall, 2008 Description: Tu 22 Apr 03 Bio 210 Study Guide 16 Kingston Animal Hormones CD-ROM tutorials Terms: autocrine ecdysone... Date Added: 2009-06-24 13:10:59 |
| YLR244C.t2k.str2-logo.pdf Path: UCSC >> YLR >> 244 Fall, 2009 Description: YLR244C.t2k STR2 4 3 2 1 CXX Z X CC C CC EMM CYAMPPCACSSCC Z SSCACSCCCCZS S S Y Z C C Q M S S TZQCYYMYTC H H XXXTTXXXXXPQEXTCZXXQQCXSZTTT XX X X X XX XXXX X X C T C S S Y S AYZYZYCCTSCCAZMZZ A EMZYC Z Z ZYZY Q Q P Q X A A AA S ZYAAA M Q C P ... Date Added: 2009-06-24 13:13:42 |
| chapter_16au.ppt Path: SC State >> CHEMISTRY >> 307 Fall, 2009 Description: Organic Chemistry, 6th Edition L. G. Wade, Jr. Chapter 16 Aromatic Compounds Discovery of Benzene Isolated in 1825 by Michael Faraday who determined C:H ratio to be 1:1. Synthesized in 1834 by Eilhard Mitscherlich who determined molecular formula... Date Added: 2009-06-24 13:15:33 |
| chapter_12we.ppt Path: SC State >> CHEMISTRY >> 307 Fall, 2009 Description: SOLVED PROBLEM 12-1 Determine the functional group(s) in the compound whose IR spectrum appears here. Solution First, look at the spectrum and see what peaks (outside the fingerprint region) dont look like alkane peaks: a weak peak around 3400 cm-1,... Date Added: 2009-06-24 13:15:35 |
| YNL052W.t2k.dssp-ehl2-logo.pdf Path: UCSC >> YNL >> 052 Fall, 2009 Description: YNL052W.t2k DSSP-EHL2 2 1 C H H X X H X H H H H H H C C C C X X X X X X X X X H HH H X C X C X C X CCEEEC C CHCE E X X X C C C X X X X X X C C X X X CC C X X X X E C C H E E H H C C C H H H H C C H C C X X X X X X X C CCCCCCCCCC X ... Date Added: 2009-06-24 13:17:01 |
| SpeechOutline.pdf Path: University of Iowa >> C >> 010001 Fall, 2009 Description: Rhetoric 10:001Moore How to Format Your Speech Outline I. Introduction Youll need to prepare an outline for each major speech assignment this semester, and this sheet shows you what it should look like. For instance, the introduction should be labele... Date Added: 2009-06-24 13:20:03 |
| YKL021C.t2k.stride-ebghtl-logo.pdf Path: UCSC >> YKL >> 021 Fall, 2009 Description: YKL021C.t2k EBGHTL 3 2 1 C TTCCCCCECCX E E E E E TT X X X X CT TTTTC E E G X X X X 1 10 20 30 40 T 3 2 1 E T E T E T E T TEC X TCC E C C TCCC C E TEXECTXXXXXXXXXTXXXTCEEXECX C T C C C C C C C E E T C T T T T C T G G X X X X X EEE... Date Added: 2009-06-24 13:25:53 |
| Hirakawa.pdf Path: Stanford >> ERE >> 1978 Fall, 2009 Description: SYSTEM APPROACH TO GEOTHERMAL F I E L D DEVELOPMENT S e i i c h i Rirakawa The U n i v e r s i t y , o f Tokyo Department o f M i n e r a l Development E n g i n e e r i n g Faculty of Engineering 7-3-1 Hongo, Bunkyo-ku, Tokyo 113, J a p a n INTROD... Date Added: 2009-06-24 13:28:38 |
| quiz5.pdf Path: George Mason >> MATH >> 125 Fall, 2008 Description: Math Quiz 5 125 Name fo,utl l( F Y Spring 2009 Work carefully and neatly. You must show all relevant work! You may receive no credit there is insuficient work. A11 answers if can be left as a product and quotient of factorials. [3pt] 1. How m... Date Added: 2009-06-24 13:36:58 |
| CRTW Syllabus S8TR.pdf Path: Winthrop >> CRTW >> 201 Fall, 2008 Description: Critical Reading, Thinking and Writing Spring 2008 Dr. Casey Cothran Email: cothranc@winthrop.edu Office: 237 Bancroft Hall; (803) 323-4632 Office Hours: 9:30-11:30 MW, 9:30-10:30 T, and by appointment Classes: 10377 TR 2:00-3:15, Owens 210 10389 MW ... Date Added: 2009-06-24 13:41:05 |
| quiz1.pdf Path: ASU >> CHM >> 113 Fall, 2009 Description: ... Date Added: 2009-06-24 13:44:12 |
| Chapter05.pdf Path: Glendale Community College >> CHM >> 150 Spring, 2008 Description: Chapter 5: Periodicity and Atomic Structure Chapter Exercises: 5.1-5.8, 5.10, 5.12-5.15; End-of-Chapter Problems: 5.23-5.24, 5.26, 5.30, 5.32-5.34, 5.36, 5.40, 5.66, 5.71-5.72, 5.78-5.79, 5.82, 5.85 5.1 Development of the Periodic Table Dimitri Mend... Date Added: 2009-06-24 13:46:34 |
| aareadme.txt Path: Washington University in St. Louis >> MEXMRS >> 0004 Fall, 2009 Description: = MEX FK Files = Last Update: 22 MAR 2004 This \"aareadme.txt\" file describes the contents of the KERNELS/FK directory of the MEX SPICE data server. It also provides the file naming conventions used for the MEX FK kernels, and it provides id... Date Added: 2009-06-24 13:52:15 |
| parabolic_trough.pdf Path: Oakland University >> ME >> 463 Fall, 2009 Description: Hank Price National Renewable Energy Laboratory, 1617 Cole Blvd., Golden, CO e-mail: henry price@nrel.gov Eckhard Lupfert DLR Plataforma Solar de Almeria, Apartado 39, Tabernas E-04200 Almeria, Spain e-mail: e.luepfert@dlr.de David Kearney Kear... Date Added: 2009-06-24 14:01:11 |
| hand_bsr.pdf Path: Rutgers >> PHYSICS >> 601 Fall, 2008 Description: ... Date Added: 2009-06-24 14:06:01 |
| YGL256W.t2k.stride-ebghtl-logo.pdf Path: UCSC >> YGL >> 256 Fall, 2009 Description: YGL256W.t2k EBGHTL 3 2 1 TCE CTC TC C E E ETCXCCCXCCT T T H X X X X X 1 10 20 30 40 T 3 2 1 E T H T GT H TH TE C E T TC ET C CE C T T T CXXXCCEEEEEEEEEGHCCCTCXCXXXXXXXXXTTETTTTTTT C C CCEXECCCCXTCT H XCTCCCEECC C H C E G G C T H E T ... Date Added: 2009-06-24 14:07:18 |
| on_illustration.pdf Path: Harford CC >> ART >> 120 Fall, 2009 Description: ... Date Added: 2009-06-24 14:08:49 |
| Euphonium_DM_01.pdf Path: Indiana >> MUSIC >> 100 Fall, 2009 Description: School of Music Indiana University For students entering the D.M. program in the School of Music: Fall 2001 through Summer 2003 Requirements for: Doctor Of Music Euphonium Current students may obtain an up-to-date degree audit using INSITE, http:/i... Date Added: 2009-06-24 14:14:23 |
| Solution4.pdf Path: UConn >> MATH >> 1131 Fall, 2009 Description: Name: Quiz 4 Math 1131Q Section 005 Date: The mathematical sciences particularly exhibit order, symmetry, and limitation; and these are the greatest forms of the beautiful. Aristotle 1. Let y = x2 tan(x). Find dy dx . dy dx d2 [x tan(x)] dx d2 d... Date Added: 2009-06-24 14:19:21 |
| chapter4.pdf Path: Wayne State University >> ECE >> 262 Fall, 2009 Description: \' $ Chapter 4 Slide 1 Using the 6800\'s Instruction Set \' Slide 3 User-Programmable Registers $ \' Program Counter PC 2 byte register. Holds the ... Date Added: 2009-06-24 14:34:15 |
| op61.pdf Path: Stanford >> PUBS >> 22523 Fall, 2009 Description: Price and Income Responsiveness of World Oil Demand, by Product By Joyce M. Dargay, Dermot Gately, and Hillard G. Huntington EMF OP 61 Revised December 2007 Energy Modeling Forum Stanford University Stanford, CA 94305-4026 Price and Income Respons... Date Added: 2009-06-24 14:35:42 |
| on-midterm2.pdf Path: Lake County >> ECE >> 313 Fall, 2009 Description: ECE 413 Fall 2005 ANNOUNCEMENT ON MIDTERM II University of Illinois November 11, 2005 The Second Test of the semester will be held on Tuesday, November 15, 7:00 8:30 pm, in Rm 163 Everitt Lab. You are allowed to bring in one sheet of notes (both s... Date Added: 2009-06-24 14:40:31 |
| Lecture04.pdf Path: Lake County >> ECE >> 313 Fall, 2009 Description: ECE 313 Probability with Engineering Applications Fall 2000 Review of Lecture #3 We explored the consequences of the axioms of probability l We discussed the notion of a partition and how partitions can be used to calculate the probability of an e... Date Added: 2009-06-24 14:41:10 |
| GIS_Analyst_Position_April2005.doc Path: JMU >> ARCHIVE >> 0408 Fall, 2009 Description: Position: Salary: GIS Analyst from $40K to $55K per year or contractor equivalent Please review the following requirements for the GIS Analyst Position. The options for this are both contractor and full-time employment. We are looking to hire 5 peo... Date Added: 2009-06-24 14:42:38 |
| INTERNATIONAL PARTNERSHIP FOR LA GONAVE.doc Path: JMU >> ARCHIVE >> 0408 Fall, 2009 Description: INTERNATIONAL PARTNERSHIP FOR LA GONAVE GS Majors, Hello and welcome back! I hope all of you had a wonderful summer. To those of you who are new to JMU, we are happy to have you and hope you have a great experience in the GS program. This email is to... Date Added: 2009-06-24 14:42:45 |
| notes3.pdf Path: Los Angeles Southwest College >> CSCE >> 750 Fall, 2009 Description: ... Date Added: 2009-06-24 14:48:56 |
| week06.pdf Path: NSC Henderson >> GEY >> 474 Fall, 2009 Description: Week 06 Chapter 05 Groundwater Flows to Wells Flow in an unconfined aquifer From Neuman and Weathsespoon (1969) Kr 2 h K r h h 2 h + + Kv 2 = S 2 r r r z t Assumptions 1. No vadose zone influence 2. The initial instantaneous release of water from e... Date Added: 2009-06-24 14:51:51 |
| abs2.pdf Path: NSC Henderson >> GEY >> 715 Fall, 2009 Description: GEY715 Second Presentation Monday Dec. 1 Amada Brandt Development of Flood-Frequency Hydrographs Using the Curve Number and Muskingum Methods for the West Wendover Area, Elko County, Nevada Peggy E Elliott ON EVALUATING DENSITY DRIVEN GROUNDWATER FLO... Date Added: 2009-06-24 14:51:53 |
| Chpt04.pdf Path: NSC Henderson >> GEOG >> 101 Fall, 2009 Description: Chapter 04: Atmosphere and Surface Energy Balance Energy Essentials Energy Balance in the Troposphere Energy Balance at Earths Surface Energy Essentials Energy Pathways and Principles Energy Pathways and Principles Energy Transmission: Passag... Date Added: 2009-06-24 14:52:01 |
| syllabus06.pdf Path: Delaware >> GEOG >> 250 Fall, 2008 Description: Geog 250 Computer Methods in Geography Fall 2006 Syllabus Lecture: Labs: 203 Pearson Hall, 005 Penny Hall 1:25 to 2:15, Monday, Wednesday, and Friday. Section 10, 2:304:30 Wednesday. Section 11, 3:305:30 Thursday. Oce Hours: 10:3011:30 Tuesday and ... Date Added: 2009-06-24 14:52:15 |
| 03-no-analogue_veg__webb_et_al..pdf Path: UC Davis >> ATT >> 149 Fall, 2009 Description: Ecology, 82(12), 2001, pp. 33463362 2001 by the Ecological Society of America DISSIMILARITY ANALYSES OF LATE-QUATERNARY VEGETATION AND CLIMATE IN EASTERN NORTH AMERICA JOHN W. WILLIAMS,1 BRYAN N. SHUMAN, AND THOMPSON WEBB III Department of Geologi... Date Added: 2009-06-24 14:53:25 |
| Experiment6_6perpage.pdf Path: Lake County >> ECE >> 385 Fall, 2009 Description: Todays Topics ECE385 DIGITAL SYSTEMS LABORATORY Revisit Experiment 5 (due this week) Experiment 6 (due next week) Design of a Logic Unit Design of a Routing Switch State Machine for Execution Cycle Reading Assignment Introduction to VHDL Pages IVT.1-... Date Added: 2009-06-24 14:57:04 |
| r0252800961_cno.txt Path: Stanford >> EXP >> 090105 Fall, 2009 Description: #SYSTEM = acdCalib #instrument= LAT #timestamp = 2009-01-14 21:20:24 UTC #calibType = 4 #algorithm = Counting #startTime = 2.52801e+08 #endTime = 2.52807e+08 #triggers = 2012433 #DTDVersion = v3 #fmtVersion = v3 #inputHighPedFile = /afs/slac.stanf... Date Added: 2009-06-24 15:02:35 |
| 20071019CS145Notes.pdf Path: Caltech >> EECS >> 145 Fall, 2009 Description: ... Date Added: 2009-06-24 15:05:46 |
| L22_distribtransactions2_final.pdf Path: Lake County >> ECE >> 428 Fall, 2009 Description: CS 425 / ECE 428 Distributed Systems Lecture 22 Distributed Transactions Chapter 14 sayan mitra Distributed Transactions Chapter 14 Distributed Transactions a transaction (flat or nested) that invokes operations in several servers. T11 X T A T1 ... Date Added: 2009-06-24 15:05:59 |
| l-sock-ltr.pdf Path: Maine >> ECE >> 435 Fall, 2009 Description: Programming Linux sockets, Part 1 Presented by developerWorks, your source for great tutorials ibm.com/developerWorks Table of Contents If you\'re viewing this document online, you can click any of the topics below to link directly to that section. ... Date Added: 2009-06-24 15:06:57 |
| lect03small.pdf Path: Maryland >> CMSC >> 212 Fall, 2005 Description: Announcements G Make: A Tool to Compile Programs G Program #1 due one week from today (next Thursday) G Submit be careful of spelling of things like Invalid and Instruction G Problem: Compiling programs is often tedious, accident prone and was... Date Added: 2009-06-24 15:14:18 |
| outputclient.txt Path: Case Western >> MXB >> 126 Fall, 2009 Description: Script started on Mon 15 Apr 2002 03:56:19 PM EDT mxb126@kiss[~/asgn6]% ./client whitesnake Client Hostname: kiss Server will be used to solve (4*2)+(7+2)/(8+1)*(2-1) 2 - 1 = 1 8 + 1 = 9 1 * 9 = 9 7 + 2 = 9 9 / 9 = 1 4 * 2 = 8 8 + 1 = 9 The Final Cal... Date Added: 2009-06-24 15:14:58 |
| mt1.pdf Path: Lake County >> ECE >> 461 Fall, 2009 Description: ECE361 Fall 2001 Midterm 1 Instructions: 1. The midterm has total worth 50 points. Use your time judiciously; you have 1.5 hours for this exam. Good luck. 2. This is a closed notes, closed book exam. You also will not need any calculators. Please h... Date Added: 2009-06-24 15:16:55 |
| PS05.pdf Path: Lake County >> ECE >> 461 Fall, 2009 Description: U niversity of Illinois Assigned: Reading: 1. (a) (b) (c) (d) (e) (f) Problem Set #5 Page 1 of 2 ECE 361 Spring 1998 (g) 2. February 17, 1998 Blahut, Introduction to Telecommunication Theory, Chapter 3 Pursley, Introduction to Digital Communicati... Date Added: 2009-06-24 15:17:12 |
| chapter11a.pdf Path: Colorado State >> ECE >> 461 Fall, 2008 Description: ... Date Added: 2009-06-24 15:17:35 |
| Zhao_Juan.pdf Path: FIU >> KCHAT >> 001 Fall, 2009 Description: Zhao Juan Graduate University of Chinese Academy of Sciences zhaojuan@cnic.cn EDUCATION: Sep,2006-present Graduate University of Chinese Academy of Science Sep,2002-July 2006 2007.7-2007.11 Computer science and technology Bachelor Computer Scienc... Date Added: 2009-06-24 15:23:48 |
| Schedule_mat230_fa08.pdf Path: Glendale Community College >> MAT >> 230 Fall, 2008 Description: Schedule Calculus II Fall 2008 This schedule is tentative and may be changed. Week 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 Tuesday 8-26 Intro and review of Calc I 9-2 7.3, 7.4 9-9 7.6, 7.7, 7.8 9-16 Review 9-23 8.1, 8.2 9-30 8.4, 8.5 10-7 Test 2 1... Date Added: 2009-06-24 15:26:02 |
| abstract.pdf Path: NSCC >> ASTR >> 100 Fall, 2009 Description: Astronomy 100 Writing an abstract of a larger publication you have researched is a crucial skill for any profession. For the poster project, please write a short (about 75 words), one-paragraph abstract about your poster. This will be due Thursday, N... Date Added: 2009-06-24 15:26:16 |
| assignment4.pdf Path: NSCC >> GEL >> 101 Fall, 2009 Description: Geology 101, Fall 2006 Name: Assignment 4: Dating methods and structural geology Define/distinguish the following terms: relative dating vs. numerical (absolute) dating original horizontality vs. lateral continuity faunal succession vs. evolution... Date Added: 2009-06-24 15:26:56 |
| sunset.pdf Path: UMass (Amherst) >> AST >> 103 Fall, 2009 Description: AST 103: Sunset Project In this exercise you will observe the suns annual motion by marking the point on the horizon at which the sun sets (or rises). CAUTION: For this project, you are required to observe the sunset at least once a week. We will be ... Date Added: 2009-06-24 15:28:41 |
| AST105-Chapter14a.pdf Path: SUNY Stony Brook >> AST >> 105 Summer, 2008 Description: Outline Discovery of Uranus Composition Internal Heat Source Magnetic fields Rings Uranus Rotational Axis Discovery of Uranus by William Herschel (1781) with a 7-inch telescope, while mapping the sky a curious... Date Added: 2009-06-24 15:29:31 |
| hw11.pdf Path: SUNY Stony Brook >> MAT >> 511 Fall, 2008 Description: MAT 511 Fundamental Concepts of Math Problem Set 11 due Thursday, Dec 4 Please prove all your answers. Short and elegant proofs are encouraged but not required. Please do questions 3bcd, 9abd, 10bd (see below for the explanation of projection funct... Date Added: 2009-06-24 15:31:50 |
| hw11_320.pdf Path: SUNY Stony Brook >> MAT >> 320 Fall, 2008 Description: MAT 320 Introduction to Analysis Homework 11 due Friday, December 8 1. Suppose f : R R is a function which satises |f (x) f (y )| C |x y |2 for all x, y R. Here C is some positive constant. Show that f is a constant function. (Hint: Verify tha... Date Added: 2009-06-24 15:31:52 |
| UFO.pdf Path: SUNY Stony Brook >> AST >> 248 Fall, 2008 Description: Alien Visitations U FO s What is a UFO? All are indeed unidentified. Most are Venus. Almost certainly none are alien spacecraft P ic tu r e fr o m R o b e r t S h e a ffe r : http:/www.debunker.com/ufo.html Extraordinary Claims Require Extraordina... Date Added: 2009-06-24 15:39:08 |
| peer.doc Path: SUNY Buffalo >> ENG >> 566 Fall, 2009 Description: Peer Evaluation Guidelines 1. Review each presentation. On the scale of 0-10, provide a score for each presentation. If you didn\'t attend the presentation and feel uncomfortable in evaluating the presentation, you may skip it without entering a score... Date Added: 2009-06-24 15:40:52 |
| Homework_4.pdf Path: SUNY Stony Brook >> MAT >> 312 Fall, 2008 Description: Section 2.1 1b) The four symmetries, and the associated permutations of the vertices, are as follows: The identity map (A A, B B , C C , D D); rotation through 180 degrees (A C , B D, C A, D B ); reection through the horizontal axis (A D, B ... Date Added: 2009-06-24 15:41:03 |
| midterm3.pdf Path: Johns Hopkins >> C >> 171 Fall, 2008 Description: pd qp ttr f d d p dg f z` d ` p d q p ` q p n f b p m n y p d d g f` d p d ` h6%ihcitrviee ttuh6u8cg s f x n ` pg d z p d f f ` d ` d p d q ` sg d g f p` f ` z f p stitatuc3i4ke4 hkcfctvcuhucuy f ... Date Added: 2009-06-24 15:45:05 |
| result_laser_side_534664.ps Path: Stanford >> SOI >> 070828 Fall, 2009 Description: %!PS-Adobe-3.0 %BoundingBox: 0 0 566 765 %Title: Graphics produced by IDL %For: couvidat@n02.Stanford.EDU, /auto/scr20/couvidat/HMI/CPT %Creator: IDL Version 6.3 (linux x86_64 m64) %CreationDate: Sat Sep 1 14:28:04 2007 %DocumentData: Clean7bit %Requ... Date Added: 2009-06-24 15:46:23 |
| detune_phases_contrasts_98888.ps Path: Stanford >> SOI >> 070228 Fall, 2009 Description: %!PS-Adobe-3.0 %BoundingBox: 0 0 566 765 %Title: Graphics produced by IDL %For: couvidat@n12.Stanford.EDU, /auto/scr20/couvidat/HMI %Creator: IDL Version 6.3 (linux x86_64 m64) %CreationDate: Thu Mar 1 16:05:08 2007 %DocumentData: Clean7bit %Requirem... Date Added: 2009-06-24 15:46:31 |
| YJL062W-A.t2k.str2-logo.pdf Path: UCSC >> YJL >> 062 Fall, 2009 Description: YJL062W-A.t2k STR2 3 2 1 CC C B H Z H H Z S XXX CS S H C S C T S T T C H H G H H S S X X X X X X X XXXXXXXX H H T GHCCC H C HCHTSCCZ TG CHHHH XX 20 H Z Y H Z HHZA AHHYYHTCTTCYHYZHZ H H SZC C P YMPTZASCAHCMCCC C Y H Z C C C Y Z C C M E C M S ... Date Added: 2009-06-24 16:03:10 |
| YJL095W.t2k.dssp-ebghstl-logo.pdf Path: UCSC >> YJL >> 095 Fall, 2009 Description: 3 2 1 HH HHHHEX X E E E X X X X H H H C E C ECCCCCH E C E C S C H C C H S T T G X X X S T X H H X X X X H H XXXXXXXXX EE EE E X X X X X X H C H H H HH HHHHHHHHHHTTHHHHH HXXXXXXXXXXXXXXXXX C H H H H X X X X T 3 2 1 T TS E H H S ... Date Added: 2009-06-24 16:04:03 |
| YJL083W.t2k.w0.5-logo.pdf Path: UCSC >> YJL >> 083 Fall, 2009 Description: YJL083W.t2k w0.5 6 5 4 3 2 1 L 1 10 20 30 40 T 6 5 4 3 2 1 S E H T T L I V T L K R T F D M I V E X XXXXXX L I L X XXXXXXXX L D V E L K R S M P R I L L V P P F L P XXXXXXXXXXXXXXXXXXXXXXXXX P S D N I E K G L R R L K Q L ... Date Added: 2009-06-24 16:04:03 |
| YJL026C-A.t2k.str2-logo.pdf Path: UCSC >> YJL >> 026 Fall, 2009 Description: YJL026C-A.t2k STR2 3 2 1 C C CSTT TS SSS Z H S CCSS HTTHCCSYSCCCCCCCTHCBSGCHHC HHTT H S HHHXXHTH S T H C H HC Z S S XXXXXHXXXXXXTXGGXXXXXXXXXXXXXXXZXXHGXXXXXXXXXHHCHX X X X H C H C Z H C HHH HHH H CC C X C H T S H A GGGCC HTT X TT X X CC... Date Added: 2009-06-24 16:04:23 |
| Gertler_slides.pdf Path: UC Davis >> ECN >> 135 Fall, 2008 Description: Financial Factors in Business Fluctuations by M. Gertler and R.G. Hubbard Professor Kevin D. Salyer UC Davis May 2009 Professor Kevin D. Salyer (UC Davis) Gertler and Hubbard article 05/09 1/8 Summary of Gertler and Hubbard article Modern Mac... Date Added: 2009-06-24 16:08:24 |
| FINC645_Guatemala.pdf Path: Texas A&M >> FINC >> 645 Fall, 2008 Description: Finance 645/Fall/Graduates FINC 645-600 or IBUS 646-600: INTERNATIONAL FINANCE Print Here! Dr. Julian E. Gaspar, Director Center for International Business Studies, and Clinical Professor of Finance Office Hours, Wehner 483D: MW 2:00-4:00 p.m. and ... Date Added: 2009-06-24 16:09:58 |
| St_Vincent1.pdf Path: Allan Hancock College >> ISYS >> 3400 Fall, 2009 Description: Information System Project Proposal Name of Proposer: Sally Weston Name of Organisation: St Vincents Hospital Project Title: Online Training Contact Person: Sally Weston Phone: 8382-3631 Address: St Vincents Hospital, 1 Leichhardt St Darlinghurs... Date Added: 2009-06-24 16:15:33 |
| T0411.t06.str4-logo.pdf Path: UCSC >> T >> 0411 Fall, 2009 Description: T0411.t06 str4 4 3 2 1 10 20 30 40 H 4 3 2 1 SVTVSGSUSGVSGUVRV SH SG USGRQP Q VSG HSEDEVSG 4 3 2 1 QRV S GVSGS V SH G SVUV SGRQP RG 101 110 120 S H IGTUQR PRQSGUSH 130 GKRGGEAQKVASSHGYSNTSLYPGSMNDWVSHGGDKLDL G TV S GS 1... Date Added: 2009-06-24 16:16:44 |
| 320_ch08_mod.ppt Path: Western Washington >> MIS >> 320 Fall, 2008 Description: Chapter 8 Organizational Information Systems Copyright 2007 John Wiley & Sons, Inc. Chapter 8 1 Chapter Outline 8.1 Transaction Processing Systems 8.2 Functional Area Management Information Systems 8.3 Enterprise Resource Planning Systems 8.4... Date Added: 2009-06-24 16:17:06 |
| ass1.ps Path: Toledo >> STA >> 247 Fall, 2009 Description: %!PS-Adobe-2.0 %Creator: dvips(k) 5.92b Copyright 2002 Radical Eye Software %Title: ass1.dvi %Pages: 2 %PageOrder: Ascend %BoundingBox: 0 0 612 792 %DocumentFonts: CMR17 CMR12 CMTI12 CMMI12 CMBXTI10 CMBX12 CMSY10 %EndComments %DVIPSWebPage: (www.radi... Date Added: 2009-06-24 16:17:28 |
| Ob11 .ppt Path: Charleston Law >> BU >> 604 Fall, 2009 Description: CHAPTER 11 Leadership 11-1 The ability to influence a group toward the achievement of goals. 1999 Prentice-Hall Canada Inc., Scarborough, ON CHAPTER 11 11-2 Chapter Outline What is Leadership? A Brief History of Leadership Theories Trait Th... Date Added: 2009-06-24 16:19:50 |
| Lecture 9- hydraulic head, energy of a fluid, density.doc Path: CSU Sacramento >> GEOL >> 127 Fall, 2009 Description: Hydrogeology Lecture #9 - Last time: talked about (aquifer characteristics): transmissivity, storativity, compressibility, leakage, (homogeneity, isotropy) - Today: will talk about an old concept (hydraulic head) from a new perspective: will lead i... Date Added: 2009-06-24 16:20:47 |
| MT235 Part 2.pdf Path: UMBC >> MT >> 235 Fall, 2009 Description: Make-or-Buy Decision: Janders Calculators The Janders Company markets various business and engineering products. Currently, Janders is preparing to introduce two new calculators: one for the business market called the Financial Manager and one for th... Date Added: 2009-06-24 16:24:46 |
| syll.ps Path: NJIT >> CS >> 667 Fall, 2009 Description: %!PS-Adobe-2.0 %Creator: dvips(k) 5.86 Copyright 1999 Radical Eye Software %Title: hand1.dvi %Pages: 3 %PageOrder: Ascend %BoundingBox: 0 0 612 792 %DocumentFonts: CMCSC10 CMR10 CMBX10 CMBX12 CMTT10 CMSY10 CMSL10 CMMI10 %+ CMTT8 %EndComments %DVIPSWe... Date Added: 2009-06-24 16:25:56 |
| 20916.txt Path: UNC >> DOCS >> 20916 Fall, 2009 Description: The Project Gutenberg EBook of The Arabian Nights, by Unknown This eBook is for the use of anyone anywhere at no cost and with almost no restrictions whatsoever. You may copy it, give it away or re-use it under the terms of the Project Gutenberg Li... Date Added: 2009-06-24 16:26:55 |
| 20919.txt Path: UNC >> DOCS >> 20919 Fall, 2009 Description: The Project Gutenberg EBook of The Status Civilization, by Robert Sheckley This eBook is for the use of anyone anywhere at no cost and with almost no restrictions whatsoever. You may copy it, give it away or re-use it under the terms of the Project... Date Added: 2009-06-24 16:27:54 |
| Introductions.ppt Path: UCF >> BUS >> 3301 Fall, 2009 Description: Introductions What have you accomplished that makes you proud? Your favorite class at UCF. Why? How will you contribute to your teams success? Something memorable about you (season you were born): Your most embarrassing moment (Spring, March 21 ... Date Added: 2009-06-24 16:31:56 |
| T0398.t2k.near-backbone-11-logo.pdf Path: UCSC >> T >> 0398 Fall, 2009 Description: T0398.t2k near-backbone-11 3 2 1 1 10 20 30 40 DGAIEGJIK 3 2 1 G EKG KG IGFIG GAGDKDIGDIADA DG DGIGEJDG 51 60 70 80 90 DA 3 2 1 DID GDI G AGA DIDG A IG KGDAG GA DG I 101 110 120 130 140 G 3 2 1 JGAGJG GI G GJG ... Date Added: 2009-06-24 16:35:25 |
| lunar_time.pdf Path: ASU >> GEO >> 110 Fall, 2009 Description: Lunar Time Scale Copernican 0 to 1.0 by Rayed craters Eratosthenian 1.0 to 3.2 by More impacts, last gasp volcanism Imbrian 3.2 to 3.85 by Most mare volcanism Nectarian 3.85 to 3.92 by Pre-Nectarian 3.92 to 4.6 by Compare to simplified Earth... Date Added: 2009-06-24 16:35:56 |
| 161HW1.pdf Path: Concordia Chicago >> MATH >> 161 Fall, 2008 Description: Math 161 Section 33 Fall 2007 Problem Set 1 Due Monday October 1st Assigned Monday 1. 1-1 (i), (ii) 2. 1-3 (Start with (iii) Note: Only have to turn in even parts. 3. 1-4 (i), (iii), (iv), (vii) 4. 1-5 (all except not (iv) and (x) Note: Only have to ... Date Added: 2009-06-24 16:54:16 |
| HW7Ned.pdf Path: Concordia Chicago >> MATH >> 162 Fall, 2008 Description: HW 7 Comments Ned Ruggeri March 17, 2008 1. 20-6 (7pt): Most students had little diculty with part (a). The key, of course, is to realize that 4 arctan 1/5 = 2(arctan 1/5 + arctan 1/5). The second part was a little trickier than I expected. Even if y... Date Added: 2009-06-24 16:54:21 |
| slaa223.pdf Path: University of Illinois, Urbana Champaign >> GE >> 423 Spring, 2008 Description: Application Report SLAA223 November 2004 MSP430 Stepper Motor Controller Greg Morton . MSP430 ABSTRACT This application report shows how to implement a controller for a stepper motor having bipolar windings using the MSP430F123 along with a pair o... Date Added: 2009-06-24 16:54:47 |
| YPL165C.t2k.dssp-ehl2-logo.pdf Path: UCSC >> YPL >> 165 Fall, 2009 Description: YPL165C.t2k DSSP-EHL2 2 1 CCCCCCCC X X X X CXEE H H H H X X X X X 1 10 20 30 40 T 2 1 CCCCC X X E S T E T E E C C H H H X X X X X 51 60 70 80 90 T 2 1 C X E T T T T H T T 2 1 H H H HHHHHHH 151 H C C C C H H H C C C C E... Date Added: 2009-06-24 17:09:02 |
| YPL101W.t2k.dssp-ebghstl-logo.pdf Path: UCSC >> YPL >> 101 Fall, 2009 Description: YPL101W.t2k EBGHSTL 3 2 1 CC B X 1 10 20 30 40 T 3 2 1 T E S H HHHHH C T XXXXXX H E S T H H T C E C T S H E T S T C C S H H H S T S C H T S T S S S T T S X X X X X X X X X X X C C H XXX X C CS CCE CCCEECEEESTSCSECCCESTSG C C S CT E... Date Added: 2009-06-24 17:09:28 |
| GB_Interferometry.ppt Path: UNC Charlotte >> MEGR >> 6181 Fall, 2008 Description: Gage Block Interferometry Gage Block Calibration Gage Block comparator Differential measurement Gage Block Interferometer Gage Block Comparator Gage Block Interferometer S Source I, V Slits P Plate L1, L2 Lenses CD Prism(constant deviati... Date Added: 2009-06-24 17:11:05 |
| pracexam1.pdf Path: Utah >> MATH >> 1180 Fall, 2008 Description: Practice Exam 1 Problems MATH 1180, Spring 2008 Show all your work. Simplify as much as possible. 1. Find the left hand, right hand, and average estimates of the integral of f (t) = 3t2 from 0 to 2 using 10 subintervals. (Hint: Remember Riemann sums... Date Added: 2009-06-24 17:16:52 |
| p230_hw_cover_sheet_wk2.doc Path: Centre >> P >> 230 Fall, 2009 Description: Homework Cover Sheet Name: _ Homework for Week 2 (2/11-2/16).due 2/18 Wednesday 2/11: Ch. 24 Q: 2,3; P: 3,4,6,8,11,15 [Read 24.3-24.4] Friday 2/13: Ch.24 Q: 5,6,7,14; P: 22,23,25,27,33,34,35,39,40,47,50,64 [Read 25.125.3] Monday 2/16: Ch. 24 Con... Date Added: 2009-06-24 17:17:12 |
| hw5.pdf Path: Ohio State >> LING >> 384 Fall, 2009 Description: Assignment 5 Dialogue systems DUE: Tuesday, March 8, 2005 1. http:/www.manifestation.com/neurotoys/eliza.php3 has a version of ELIZA you can play with. Record an interaction you had with ELIZA (minimum of 5 interchanges i.e. 5 sentences of yours wit... Date Added: 2009-06-24 17:19:24 |
| Final-fall05.doc Path: Auburn >> COMP >> 6320 Spring, 2008 Description: Final-fall05 COMP 6320 Design and Analysis of Computer Networks Final (December 10, 2005) 200 points 1 hour Error Control Part I ( 10 points) : True of false For the following statements, circle T (true) of F (false) to state whether the statement is... Date Added: 2009-06-24 17:20:44 |
| dsf10k.pdf Path: Toledo >> ECE >> 352 Fall, 2009 Description: Includes FLEX 10KA FLEX 10K Embedded Programmable Logic Device Family Data Sheet January 2003, ver. 4.2 Features. The industry\'s first embedded programmable logic device (PLD) family, providing System-on-a-Programmable-Chip (SOPC) integra... Date Added: 2009-06-24 17:26:40 |
| 5370.txt Path: UNC >> DOCS >> 5370 Fall, 2009 Description: The Project Gutenberg EBook of Richard Carvel, Volume 6, by Winston Churchill This eBook is for the use of anyone anywhere at no cost and with almost no restrictions whatsoever. You may copy it, give it away or re-use it under the terms of the Proj... Date Added: 2009-06-24 17:27:22 |
| rnsnc10.txt Path: UNC >> DOCS >> 2398 Fall, 2009 Description: The Project Gutenberg Etext of The Renaissance, by Walter Pater Copyright laws are changing all over the world, be sure to check the copyright laws for your country before posting these files! Please take a look at the important information in this... Date Added: 2009-06-24 17:29:32 |
| soln.jan24.ps Path: Kentucky >> PHY >> 211 Fall, 2008 Description: %!PS-Adobe-2.0 %Creator: dvips(k) 5.86 Copyright 1999 Radical Eye Software %Title: soln.jan24.dvi %Pages: 2 %PageOrder: Ascend %BoundingBox: 0 0 596 842 %EndComments %DVIPSWebPage: (www.radicaleye.com) %DVIPSCommandLine: dvips soln.jan24.dvi -o jan24... Date Added: 2009-06-24 17:36:37 |
| 115 ch 9.xls Path: Drexel >> ACCT >> 115 Fall, 2009 Description: Ex. 9.2 a. b. c. d. e. f. Ex. 9.3 Capital expenditure Revenue expenditure Revenue expenditure Capital expenditure Revenue expenditure (too small in amount to capitalize regardless of length of useful life) Capital expenditure a. Straight-Line (Half... Date Added: 2009-06-24 17:37:36 |
| Websites.doc Path: N. Georgia >> MESUBL >> 2834 Fall, 2009 Description: MeganSublett January30,2006 Websites www.bravenet.comThiswebsitehadalotofadditionsforawebsitesuchas clipart,calendars,sounds,andcounters. www.4teachers.orgThiswebsitehasalotofquizzes,games,andactivitiesto useintheclassroom. www.glc.k12.ga.us/qcc/home... Date Added: 2009-06-24 17:37:38 |
| lec16_normPOST.pdf Path: Dallas >> CS >> 4347 Fall, 2008 Description: Deficiencies of E-R Designs Theory of Relational DB Design and Normalization Provides a set of guidelines, does not result in a unique database schema Does not provide a way of evaluating alternative schemas Normalization theory provides a mechani... Date Added: 2009-06-24 17:38:39 |
| gcnR_flux.txt Path: Berkeley >> ASTRO >> 00113120 Fall, 2009 Description: 27.648 5.729948e-04 1.055496e-04 none no 27.648 1.439298e-03 2.651285e-04 none yes 490.752 2.501213e-04 4.607405e-05 none yes 1186.27 1.578159e-04 2.907076e-05 ... Date Added: 2009-06-24 17:47:41 |
| CTP_notes.pdf Path: UCSB >> G >> 191 Fall, 2009 Description: Geog 191/291 Introduction to Optimization for Geographic Problems Classical Transportation Problem Construct an initial BF solution (e.g. Northwest Corner Rule) Intialization Optimality Test Derive Ui and Vj by selecting the row having the largest ... Date Added: 2009-06-24 17:48:03 |
| HW1.pdf Path: Wisconsin >> ECE >> 468 Fall, 2009 Description: ECE 468- Fall 2002 Homework # 1 (Due: Thursday, Sep 26, 2002) For homework 1 we are going to build upon what has been covered in class. You will have to design a VI that will generate a set of 50 random numbers ranging between 0 and 100 every 2 secon... Date Added: 2009-06-24 17:51:43 |
| f51mb_0350_CLR_2112_tab_ECDF.txt Path: N.C. State >> CPLEX >> 090 Fall, 2009 Description: @file f51mb_0350_CLR_2112_tab_ECDF.txt @date 2007-02-09-01-37-06 (Fri Feb 09 01:37:06 UTC 2007) @author stats_util @remarks . @BeginTabular Labels CliqueCuts CliqueCuts_ CoverCuts CoverCuts_ Iterations Iterations_ Nodes Nodes_ NumOnes NumOnes_ Obje... Date Added: 2009-06-24 17:52:16 |
| Lecture 13 - Esherichia coli.ppt Path: UNLV >> BIOL >> 251 Summer, 2008 Description: Esherichiacoli Gramnegativerod Facultativeanaerobe NamedforTheodorEscherich Germanphysician(ca.1885) Demonstratedthatparticularstrainswereresponsiblefor infantdiarrheaandgastroenteritis Normalfloraofthemouthandintestine Protectstheintestinaltractfrom... Date Added: 2009-06-24 17:54:00 |
| Taxicab Geometry.ppt Path: Boise State >> MATH >> 547 Fall, 2008 Description: The Elements of Taxicab Geometry A Non-Euclidean Geometry Taxicab geometry Taxicab geometry was developed by Hermann Minkowski in the 19th century and is a form of geometry in which the usual metric of Euclidean geometry is replaced by a new metric ... Date Added: 2009-06-24 17:54:49 |
| mousemetabolism2.pdf Path: Bethel MN >> BIO >> 113 Fall, 2009 Description: Lab #2- Small Metabolism Chambers BIO113D Introduction to Organismic Biology Name _ P.O._ Lab partner _ Due date: 30 September Analyzing the data and developing hypotheses 1. Record BMR (gram calories/hour/cm2) CLASS DATA for control mice from all la... Date Added: 2009-06-24 17:58:03 |
| summarysheet.pdf Path: Wisc Stevens Point >> SSTEI >> 693 Fall, 2009 Description: ... Date Added: 2009-06-24 17:59:56 |
| Project description.doc Path: Lehigh >> FIN >> 324 Fall, 2008 Description: The Security Analysis Project What is this project? This project provides an opportunity to get some hands-on experience applying investment theory and models to real firms. In the process, participants will get a chance to: evaluate the risk p... Date Added: 2009-06-24 18:04:06 |
| GEOG586_Project1.pdf Path: Penn State >> BMS >> 586 Fall, 2009 Description: Brad M. Shirey GEOG 586 PSU MGIS Program Lesson 1 Deliverable Why Spatial Data is Special Problems and Opportunities Deliverable 1 - Republican Margin of Victory in Texas Congressional Districts, 2002 During my review, analysis and spatial manipu... Date Added: 2009-06-24 18:04:20 |
| Chem 116 practice final unkey fall 2008.doc Path: Grossmont >> CHEMISTRY >> 116 Fall, 2009 Description: Grossmont College - Chem 116 PRACTICE FINAL EXAM Instructor: Martin Larter NAME _ 1. The presence of a carbon-carbon double bond in a molecule results in a (an) _arrangement for the three atoms attached to the carbons of the double bond. A. tetrah... Date Added: 2009-06-24 18:05:51 |
| YBL113W-A.t2k.w0.5-logo.pdf Path: UCSC >> YBL >> 113 Fall, 2009 Description: YBL113W-A.t2k w0.5 2 1 M M L L V V I I 1 10 20 30 40 H 2 1 FVPV L Y I V I T H T E G HE XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX L I L L V Q Q I I K VL L L H RY I I I V V V V L CL A F L Q I T A V II PYFLL V V F L L Y I V... Date Added: 2009-06-24 18:10:41 |
| arm-glossary.pdf Path: Virgin Islands >> CSC >> 200905 Fall, 2009 Description: GLOSSARY OF FREQUENTLY USED INDUSTRY ACRONYMS AND TERMINOLOGY GLOSSARY OF TERMS This glossary details the more frequently used industry acronyms and terminology Acceptance Test Algorithm ANSI A procedure defined in a hardware or software contract... Date Added: 2009-06-24 18:12:26 |
| engr191_291g_syllabus.pdf Path: UCSB >> ENGR >> 191 Fall, 2009 Description: University of California, Santa Barbara College of Engineering Engineering 191/291G Professional Seminar: Legal and IP Issues in New Ventures Susan Block Winter 2008 Time: Location: 5:00-6:50PM Givertz 1116 COURSE DESCRIPTION An intellectual proper... Date Added: 2009-06-24 18:13:11 |
| Paper I graded Path: Cornell >> HIST >> 2830 Spring, 2009 Description: Balloga, 1 Abram Balloga HIST 2830 Professor Hyams Short Paper I Bayeux Tapestry The conquest of Anglo Saxon England in 1066 by the Normans was a pivotal and defining moment in the development of the island. The invaders, under William the Conqueror... Date Added: 2009-06-25 15:36:26 |
| notas-aprox.pdf Path: UPR Mayagüez >> INEL >> 4206 Fall, 2009 Description: Notas Aproximadas * A B C Examen 1 Examen 2 Global 93 a . 73 a 92 52 a 72 83 a 63 a 82 44 a 62 84 a 70 a 83 54 a 69 ... Date Added: 2009-06-25 18:35:22 |
| jcrpr11.txt Path: UNC >> DOCS >> 2962 Fall, 2009 Description: The Project Gutenberg Etext of Return to Paris, by Jacques Casanova #12 in our series by Jacques Casanova de Seingalt Copyright laws are changing all over the world. Be sure to check the copyright laws for your country before distributing this or an... Date Added: 2009-06-25 18:36:10 |
| jcspn10.txt Path: UNC >> DOCS >> 2976 Fall, 2009 Description: *The Project Gutenberg Etext of Spain, by Jacques Casanova* (#26 in our series by Jacques Casanova) Copyright laws are changing all over the world, be sure to check the laws for your country before redistributing these files! Please take a look at ... Date Added: 2009-06-25 18:36:15 |
| wheel-chair-final.pdf Path: CUNY Baruch >> EE >> 59866 Fall, 2009 Description: Chapter Number X A 4WD Omnidirectional Mobile Platform and its Application to Wheelchairs Masayoshi Wada Dept. of Human-Robotics, Saitama Institute of Technology Japan 1. Introduction The aging of society in general and the declining birth rate have... Date Added: 2009-06-25 18:43:01 |
| ParadigmInternship-0001.pdf Path: Washington >> MAILMAN >> 20070316 Fall, 2009 Description: ... Date Added: 2009-06-25 18:43:56 |
| assignment3.pdf Path: Washington >> ESS >> 102 Fall, 2008 Description: ESS 102 - Week 3: Due January 26 Reading Chapters 3 and 4 Lab Work 3 There are various forms of radiation in our environment. These sources can be man-made, part of the terrestrial environment or have their origins from the Sun and the stars. (1) On... Date Added: 2009-06-25 18:45:49 |
| syllabus.pdf Path: E. Kentucky >> MATH >> 122 Fall, 2009 Description: Math 122 Fall 2007 Line #22785 1300-1350 M-F Mallott 3092 Instructor: Manoj Kummini E-mail: kummini@math.ku.edu Oce: Snow 547 Phone: 864-7117 Hours: TBA. Web Pages: Co-coordinator: http:/www.math.ku.edu/nualart/122-students.shtml This class (incl. ... Date Added: 2009-06-25 18:45:52 |
| chicago.pdf Path: Kentucky >> ENG >> 203 Fall, 2008 Description: USING CHICAGO STYLE A. You have used information from page 38 of the 1989 edition of the book entitled Citizens: A Chronicle of the French Revolution by Simon Schama. Alfred A. Knopf of New York published the book. B. In two consecutive places you h... Date Added: 2009-06-25 18:46:15 |
| demo-dijkstra.pdf Path: Bowdoin >> CS >> 231 Fall, 2009 Description: Dijkstra\'s Shortest Path Algorithm Find shortest path from s to t. 9 2 24 3 s 14 18 6 30 15 5 20 2 6 5 11 4 6 19 16 7 44 1 t Dijkstra\'s Shortest Path Algorithm S={ } PQ = { s, 2, 3, 4, 5, 6, 7, t } 0 s 9 24 2 3 14 18 6 30 ... Date Added: 2009-06-25 18:46:28 |
| 313hw8.pdf Path: George Mason >> MATH >> 313 Fall, 2008 Description: o, =\'/ - E /Z -{r4;* n sW\'- atl*;@S +,r#;(trJ- re W ... Date Added: 2009-06-25 18:48:10 |
| Hadza voice article.pdf Path: Sveriges lantbruksuniversitet >> BISC >> 800 Fall, 2009 Description: Biol. Lett. (2007) 3, 682684 doi:10.1098/rsbl.2007.0410 Published online 25 September 2007 Evolutionary biology Voice pitch predicts reproductive success in male hunter-gatherers C. L. Apicella1,*, D. R. Feinberg2 and F. W. Marlowe3 Department of A... Date Added: 2009-06-25 18:48:57 |
| rad.ppt Path: Cal Poly Pomona >> CIS >> 406 Fall, 2009 Description: Rapid Application Development Rad.ppt Overivew What is RAD? What are the four pillars of Rapid Development? Efficient Development Schedule-oriented practices What is RAD? Schedule-oriented set of effective practices RAD is used when project r... Date Added: 2009-06-25 18:51:45 |
| solhw3.pdf Path: Stanford >> STATS >> 306 Fall, 2009 Description: Modern Applied Statistics Spring 2009 Solutions for HW 3 Instructor: Professor Trevor Hastie solutions by Yuxue Jin, Rahul Mazumder Problem 1 Part a) Consider the problems: max u M v subjectto u = 1; v = 1 u,v (1) (2) max u,v u Mv uv Take any u,... Date Added: 2009-06-25 18:51:57 |
| Mandatos.pdf Path: Macalester >> HISP >> 204 Fall, 2009 Description: Estudios hispnicos 204, Espaol intermedio II Los mandatos formales e informales: Un repaso Los mandatos formales (Ud./Uds. Cundo se usan?) Solicitar Solicite No solicite Soliciten No soliciten Resolver Resuelva Resuelvan No resuelva No resuelvan Mor... Date Added: 2009-06-25 18:52:11 |
| 3SolPrelim.pdf Path: Cornell >> WEB >> 2940 Fall, 2009 Description: ... Date Added: 2009-06-25 18:56:00 |
| Assign3Solutions.pdf Path: Virgin Islands >> MECH >> 335 Fall, 2009 Description: ... Date Added: 2009-06-25 18:59:03 |
| lab2.pdf Path: Wisconsin Milwaukee >> CEAS >> 565 Fall, 2009 Description: - - LAB 2 LASER AND PHOTODETECTOR PROPOSE: This lab is designed to familiar you with the use of laser and photodetector in the laboratory. You will learn to adjust the position of a laser and photodetector to perform measurements as well as develop... Date Added: 2009-06-25 19:04:04 |
| _Filters.doc Path: Utah >> ECE >> 2260 Fall, 2008 Description: ELECTRICAL AND COMPUTER ENGINEERING CONCEPTUA L TOOLS , nd a a TIFF QuickTimesee this picture. (Uncompressed) decompressor are needed to by Neil E. Cotter Research Assistant Professor Last Updated: 6/19/2009 ( = MISSING, * = ARTICLE) FILTERS ... Date Added: 2009-06-25 19:05:48 |
| Sum170syl.doc Path: ASU >> MAT >> 274 Fall, 2009 Description: MATHSCIENCEHONORSPROGRAM ARIZONASTATEUNIVERSITY SUMMERSESSION12002 PRECALCULUS MAT 170 SYLLABUS *Disclaimer: All items on this syllabus are subject to change. Any in-class announcement, verbal or written, is considered official addendum to this syll... Date Added: 2009-06-25 19:11:39 |
| ch13.ppt Path: CSU Long Beach >> CECS >> 274 Spring, 2008 Description: Chapter Thirteen: Recursion Big Java by Cay Horstmann Copyright 2008 by John Wiley & Sons. All rights reserved. Chapter Goals To learn about the method of recursion To understand the relationship between recursion and iteration To analyze proble... Date Added: 2009-06-25 19:15:56 |
| hw1.pdf Path: Texas Tech >> ME >> 4356 Fall, 2008 Description: ME 4356 Aerodynamics Homework Assignment 1 Standard Atmosphere Fall, 2007 An aircraft preparing to take off from the Denver International Airport (h = 5280 ft = 1609 m) is instructed to set the altimeter with a sea level barometric pressure of 105.... Date Added: 2009-06-25 19:16:13 |
| Chapter_2_carbon_cycle_July7.doc Path: UCSB >> GEOG >> 135 Fall, 2009 Description: To appear in Oil, Water and Climate C. Gautier 2007 Chapter 2 Carbon Cycle Draft Abstract 1. Introduction Life on Earth profoundly influences the distribution of the planets most basic chemical constituents: carbon, nitrogen, oxygen, phosphorus, and... Date Added: 2009-06-25 19:18:52 |
| projections_handout.pdf Path: Colorado >> ASTR >> 5550 Fall, 2008 Description: 1 LARGE-AREA SKY SURVEYS After obtaining your survey data. . . ? CARL HEILES Astronomy Department, UC Berkeley Adapted from a slideshowsorry for the wierd format Perhaps the most important part of this document is the last two pages! They talk ab... Date Added: 2009-06-25 19:19:29 |
| C1S5.pdf Path: Illinois State >> CHE >> 220 Fall, 2008 Description: CHE 220 Chapter 1 Sheet 5 Functional Groups 1) Name all the functional groups in the following molecules. H N O O Cl H O NH2 OH N O C O O O HO ... Date Added: 2009-06-25 19:20:47 |
| unit1bk.pdf Path: Nevada >> CS >> 674 Fall, 2008 Description: U nit 1. Introduction to Images 1.1 Images Images and Pixels. An image is a rectangular array of dots called pixels (picture elements) where the number of rows M and number of columns N of dots in an image are specified. At each row-column intersecti... Date Added: 2009-06-25 19:24:44 |
| finalPoster.pdf Path: Penn State >> MMS >> 5119 Fall, 2009 Description: Correlating Mean Sea Ice Concentration and Surface Melt Magnitude In Coastal Greenland Using AMSR-E Sea Ice Data and MODIS Melt Magnitude Grids Mark Smithgall and Kaitlin Walsh GEOG/GEOSC 597K Spring 2009 BACKGROUND As climate change becomes an inc... Date Added: 2009-06-25 19:24:47 |
| m310_experiments_audio_all.ppt Path: NMSU >> M >> 310 Fall, 2009 Description: Experiments in Marketing Research (Click icon for audio) Dr. Michael R. Hyman, NMSU Criteria for Establishing Causal Relationships Concomitant variation Temporal ordering of variables Control over other possible causal factors 2 Preliminary Defi... Date Added: 2009-06-25 19:30:10 |
| HW10_solutions.pdf Path: Utah >> PHYS >> 3150 Fall, 2008 Description: 1. Massofuraniumundergoingfissioninayear:29000kg0.023=667kg; Massofuraniumundergoingfissioninanhour:667kg/365/24=0.076kg; Massofuraniumundergoingfissioninasecond:0.076kg/3600s =0.000021kg/s; 82TJ/kg0.000021kg/s=1.7GW; Thesourceofthediscrepancybetwee... Date Added: 2009-06-25 19:32:33 |
| lab5.pdf Path: Utah >> PHYS >> 6771 Fall, 2008 Description: gv z $rThf V f w V g |V n V f g l pX k kXe Vfv V n p jXfv p gf i f n p yvyq}XpY$iedayV$aifm1qy$yYovqtaqotqXtjqyX$yVaov `$rThqfyv\'y}X\'u$iV$YuTigiiyqaoCYhuaqY\"ywqiXhhfqyqyyx$aYV gv z V f w f p ge V iv kfX p Vfv fVf p jXe iv p g fX uXf g fV... Date Added: 2009-06-25 19:32:43 |
| Looping.ppt Path: SUNY Albany >> KG >> 356766 Fall, 2009 Description: LoopinginC+ WhyUseLoops? WhyUseLoops? LoopinginC+allowsyoutorepeatprogramminginstructionsmultiple timeswithoutactuallyrepeatingthecodeitself. Therearethreetypesofloops:for,while,anddowhile. ConditionalstatementsusedforC+loopingmechanismsarei... Date Added: 2009-06-25 19:35:18 |
| Marlin.pdf Path: Sveriges lantbruksuniversitet >> CMNS >> 425 Fall, 2009 Description: ... Date Added: 2009-06-25 19:38:41 |
| Williams (1986).pdf Path: Sveriges lantbruksuniversitet >> CMNS >> 428 Fall, 2009 Description: ... Date Added: 2009-06-25 19:39:01 |
| Division%2010.doc Path: Purdue >> CE >> 221 Spring, 2008 Description: Checklist Division 10: Specialities CHECKLIST DIVISION 10: SPECIALTIES Access flooring Chair rails Flagpole Scales Wall guards Control boards Fireplace accessories Protection screens Vending machines Wardrobes Coat rack Hospital type Chalkboards Bla... Date Added: 2009-06-25 19:43:25 |
| barnes.pdf Path: MD University College >> INSS >> 690 Fall, 2009 Description: Implementation of VoIP IS IMPLEMETATION OF VOICE OVER INTERNET PROTOCOL (VOIP) MORE ECONOMICAL FOR BUSINESSES WITH LARGE CALL CENTERS? by Zachary A. Barnes A Graduate Research Report Submitted for INSS 690 in Partial Fulfillment of the Requirements... Date Added: 2009-06-25 19:43:39 |
| INSS 690 Final Presentation.ppt Path: MD University College >> INSS >> 690 Fall, 2009 Description: Network Management Software Ted Shelton INSS 690 Professional Seminar Outline l Thesis/Abstract l History of Networking l Forces of Change l Network Management Solutions l Future of Network Management l Conclusions Abstract l Enterprise network ma... Date Added: 2009-06-25 19:43:47 |
| 26170.txt Path: UNC >> DOCS >> 26170 Fall, 2009 Description: The Project Gutenberg EBook of Diaries of Sir Moses and Lady Montefiore, Volume I, by Sir Moses Montefiore and Judith Montefiore This eBook is for the use of anyone anywhere at no cost and with almost no restrictions whatsoever. You may copy it, gi... Date Added: 2009-06-25 19:49:06 |
| simsek.ps Path: Berkeley >> EE >> 290 Spring, 2004 Description: %!PS-Adobe-2.0 %Creator: dvips(k) 5.86 Copyright 1999 Radical Eye Software %Title: project.dvi %CreationDate: Tue Dec 14 21:25:32 1999 %Pages: 7 %PageOrder: Ascend %BoundingBox: 0 0 612 792 %EndComments %DVIPSWebPage: (www.radicaleye.com) %DVIPSComma... Date Added: 2009-06-25 19:50:52 |
| ACCircuits.pdf Path: Columbia >> C >> 1493 Fall, 2009 Description: 1 A.C. CIRCUITS Introduction Consider the circuit in Figure 1 consisting of a resistance R, a capacitance C, and an inductance L, connected in series and driven by a time-varying voltage source. Figure 1. The differential equation for the current ... Date Added: 2009-06-25 19:51:53 |
| page007.pdf Path: Sveriges lantbruksuniversitet >> ACA >> 320 Fall, 2009 Description: conceptembodiment relationship to Participants interact with our installation without any knowledge or rules, so they can either work together or against each other to keep the environments balanced/imbalanced Emphasizes participant interaction and c... Date Added: 2009-06-25 19:53:45 |
| FET8610-A3-rubric.xls Path: Allan Hancock College >> FET >> 8610 Fall, 2009 Description: Rubric for Assignment 3 FET8610: Semester 1, 2008 Name: Preferred Name Website - see following worksheet Report - see following worksheet Total Mark Out of 0 out of 40 0 out of 10 0 out of 50 31d79d4d818e241659dad45216b5b5a99f3d7c27.xls Assignment... Date Added: 2009-06-25 19:53:49 |
| Lesson plan.pdf Path: TCNJ >> ELEM >> 690 Spring, 2008 Description: ... Date Added: 2009-06-25 19:54:53 |
| hw_ass_2.pdf Path: Kentucky >> MA >> 077 Fall, 2009 Description: [MA 352 001 Homework Assignment # 2, Date Due: January 14] 1 Let X and Y be topological spaces, f : X Y a function and A X any subset. The restriction g = f |A of f to A is dened to be the function g : A Y given by g (a) = f (a) for all a A (in... Date Added: 2009-06-25 20:05:49 |
| IDS 496 Module 1.docx Path: Academy of Art >> IDS >> 321 Fall, 2009 Description: IDS 496 Module 1 Introduction to advanced modeling and animation Introduction- Where we will end up What is the purpose of yet another Alias modeling class surely in a studio course you can generate a nice Alias model for the project. You can envisio... Date Added: 2009-06-25 20:07:49 |
| CANM600_Mod12.doc Path: Academy of Art >> MOD >> 600 Fall, 2009 Description: Module 12 Line Quality and Grayscale Introduction We will continue to working on editorial political satire illustration in this module. Here we will explore techniques to create powerful grayscale illustrations with the digital tools we have. We wil... Date Added: 2009-06-25 20:09:05 |
| m06s07_5.pdf Path: Academy of Art >> M >> 600 Fall, 2009 Description: ... Date Added: 2009-06-25 20:09:32 |
| iconografiateotihuacana.pdf Path: Holy Cross College >> SPAN >> 409 Fall, 2009 Description: ... Date Added: 2009-06-25 20:15:14 |
| 496498 Fall 2007 8.doc Path: UNLV >> FACULTY >> 496498 Fall, 2009 Description: 1 Psy 496 Independent Study and Psy 498 Independent Research Psy 766 Independent Study Kim Barchard Fall 2007 Students enrolled: Psy 496 Gizelle Romero (2 credits), Jenna Scott (2 credits), Jocie Bartlett (3 credits), Ashleigh Thompson (3 credits), S... Date Added: 2009-06-25 20:18:00 |
| Ranching_Dee.pdf Path: Arizona >> ECOL >> 406 Fall, 2008 Description: Ranching in SE AZ and the Sonoran Desert Conservation Plan Compromise - Consensus - Balance Culture and History Open space, vastness of land defines and symbolizes Arizona. Maintaining ranching and the ranching way of life is to maintain the tradi... Date Added: 2009-06-25 20:30:28 |
| handout_NMR2_CHEM460Aau05.pdf Path: Washington >> CHEM >> 460 Fall, 2008 Description: ... Date Added: 2009-06-25 20:32:06 |
| Software.pdf Path: Washington >> DXARTS >> 200 Fall, 2008 Description: ... Date Added: 2009-06-25 20:32:34 |
| Assn03.doc Path: Evansville >> EE >> 411 Fall, 2009 Description: EE 411 Assignment 03 October 2, 2002 Due: October 9, 2002 1. From Chapter 4 Problems pp 147-153: problems 5, 6, 9, 20, 22, 29, and 30. 2. From Chapter 5 Problems pp 191-198: problems 1, 6, 14, 18, 22, 32, and 36. ... Date Added: 2009-06-25 20:35:37 |
| Assn05.doc Path: Evansville >> EE >> 411 Fall, 2009 Description: EE 411 Assignment 05 October 28, 2002 Due: Nov. 11, 2002 A .wav file on the WEB site has a few seconds of Beethoven\'s 9th symphany on it. This file is called Beet9th.wav and has sharp frequency spikes at approximately 300Hz, 400Hz, and 500Hz. 1. Cr... Date Added: 2009-06-25 20:35:38 |
| ds077.pdf Path: New Hampshire >> ECE >> 523 Fall, 2009 Description: 0 R Spartan-IIE 1.8V FPGA Family: Complete Data Sheet 0 0 DS077 July 9, 2003 Product Specification This document includes all four modules of the SpartanTM-IIE FPGA data sheet. Module 1: Introduction and Ordering Information DS077-1 (v2.1) July... Date Added: 2009-06-25 20:38:07 |
| Homework 5.xls Path: Illinois State >> POS >> 138 Fall, 2009 Description: Table with row headersand column A and column headers Sex and Age Groups: November 1964 to 2006 Table A-1. Reported Voting in Registration by Race, Hispanic Origin, in rows 5 through 7. (Numbers in thousands) Total percent Year Voted 2006 2004 2002 ... Date Added: 2009-06-25 20:41:45 |
| ADC0820.pdf Path: Appalachian State >> PHY >> 4635 Fall, 2009 Description: ADC0820 8-Bit High Speed mP Compatible A D Converter with Track Hold Function February 1995 ADC0820 8-Bit High Speed mP Compatible A D Converter with Track Hold Function General Description By using a half-flash conversion technique the 8-bit ADC08... Date Added: 2009-06-25 20:44:23 |
| om480_SIM_Project_Assign#1_2003.doc Path: Clarkson >> OM >> 480 Fall, 2009 Description: OM480 - PROJECT MANAGEMENT FALL 2003 SIM PROJECT ASSIGNMENT #1 NAME: _ (Print Legibly) Directions: As you (re)play SIMProject starting today (Friday, November 14th), you will save/print a baseline MSProject Schedule and a results MSProject schedule f... Date Added: 2009-06-25 20:46:20 |
| HoleTempandDepthVs.Time-ThreeDays-current.pdf Path: Wisconsin >> MEDIA >> 0103 Fall, 2009 Description: Hole Temp and Depth Vs. Time From 1/1/2007 9:34:59 to 1/4/2007 9:34:59 100 Depth by Pres Hole Temp 80 0 500 60 Hole Temp C 1000 40 1500 20 2000 0 2500 1.5 2 2.5 3 3.5 4 DOY Created by pjplots Thu Jan 04 09:40:05 2007 doy 004 Depth by Pressure ... Date Added: 2009-06-25 20:52:53 |
| PHY2054_F05_exam2_with_solutions.pdf Path: UF >> PHY >> 2054 Summer, 2008 Description: 77777 Instructor(s): J.R. Buchler, A. Korytov PHYSICS DEPARTMENT PHY 2054 Name (print, last rst): 2nd Exam Signature: On my honor, I have neither given nor received unauthorized aid on this examination. 77777 Fall, 2005 YOUR TEST NUMBER IS THE 5-D... Date Added: 2009-06-25 20:56:41 |
| Memory_Hierarchy.doc Path: UF >> CAP >> 4403 Spring, 2008 Description: Memory Hierarchy Model a Physical mapping by James Slentz and Kristofer Eisenmenger Group and Responsibilities Group: Kristofer Eisenmenger and James Slentz Concept: James Slentz and Kristofer Eisenmenger Concept Elaboration: James Slentz Material P... Date Added: 2009-06-25 20:56:47 |
| Chapter.ppt Path: IUPUI >> CPT >> 388 Fall, 2009 Description: Pre-test Loops condition True Steps to repeat if True condition False Steps to repeat if False False True Do While condition Steps to repeat if condition is true Loop Do Until condition Steps to repeat if condition is false Loop 1999, by Que Ed... Date Added: 2009-06-25 20:57:05 |
| Chapter7.ppt Path: IUPUI >> CPT >> 388 Fall, 2009 Description: Pre-test Loops condition True Steps to repeat if True condition False Steps to repeat if False False True Do While condition Steps to repeat if condition is true Loop Do Until condition Steps to repeat if condition is false Loop 1999, by Que Ed... Date Added: 2009-06-25 20:57:06 |
| 3f.sk2.systematic.ps Path: Duke >> RAW >> 20090602 Fall, 2009 Description: %!PS-Adobe-2.0 %Title: systematic.ps ( A 4) %Pages: (atend) %Creator: ROOT Version 5.20/00 %CreationDate: Mon Jun 1 10:42:28 2009 %Orientation: Landscape %EndComments %BeginProlog /s {stroke} def /l {lineto} def /m {moveto} def /t {translate} def /sw... Date Added: 2009-06-25 21:08:27 |
| Assignment_4_Solutions.pdf Path: UMass (Amherst) >> CONTENT >> 270 Fall, 2009 Description: 136.270 Solutions Assignment 4 (Sections 16.1-16.4) 1. [8 marks] Evaluate 2 (4 xy D 3 - 4 x 2 y ) dA where D is the region bounded by y = - 1 - x , y = 1 - x and y = 1 + x . Sketch D. Solution. The parabolas y = 1 - x and y = 1 + x intersect at... Date Added: 2009-06-25 21:12:06 |
| output2.txt Path: Dickinson State >> CSCI >> 061 Fall, 2009 Description: b(0.20): array of [0 . 1]. Maximum length for a balanced section of b is 6 The number of balanced sections of length 6 is 3 Segments: [12, 18), [13, 19), [14, 20) b longest segments are marked [], [], ., : 1 0 0 0 0 0 0 1 0 0 0 0 [0 [0 [0 1 1 1] 0] ... Date Added: 2009-06-25 21:21:44 |
| DS-KEY-PARTA-DEC06.pdf Path: UCF >> CH >> 629133 Fall, 2009 Description: Computer Science Foundation Exam December 15, 2006 Section II A DISCRETE STRUCTURES SOLUTION KEY Question # 1 2 3 4 ALL Category PRF (Induction) PRF (Contradiction) PRF (Counter-Example) PRF (Logic) -Score Max Score 20 10 10 10 50 Page 1 of 6 Discr... Date Added: 2009-06-25 21:22:39 |
| k124-qz8-fig2.ps Path: Washington >> MATH >> 124 Fall, 2008 Description: ... Date Added: 2009-06-25 21:26:33 |
| IntellectualCAP.txt Path: Ill. Chicago >> ACTG >> 516 Fall, 2008 Description: vti_encoding:SR|utf8-nl vti_timelastmodified:TR|20 Mar 1998 19:46:54 -0000 vti_extenderversion:SR|5.0.2.2623 vti_lineageid:SR|{C85256CE-6279-41AA-BE06-F5D91EED80EF} vti_cacheddtm:TX|20 Mar 1998 19:46:54 -0000 vti_filesize:IR|33417 vti_backlinkinfo:VX... Date Added: 2009-06-25 21:28:11 |
| Home in Moab.ppt Path: Uni. Westminster >> KST >> 1020 Fall, 2009 Description: Waste Management Two Things to Take into Consideration Central Landfill There is one main landfill in Moab, due to the fact that it is such a small city. Problematic in some cases Smelly-depending on the direction of the wind. Could overflow, et... Date Added: 2009-06-25 21:29:22 |
| Chapter 1 to 8 Review.doc Path: UF >> STA >> 3024 Summer, 2008 Description: Review of Chapters 1 - 8 Chapter 1 Introduction What? Who? Why? Some Jargon o o o o o o o o Subject: A unit (a person, animal, plant, etc.) on which we make observations or measurements.) Population: Set of all subjects of interest Sample: Pa... Date Added: 2009-06-25 21:32:09 |
| participatory design carroll.pdf Path: University of Baltimore >> IDIA >> 612 Fall, 2009 Description: The Development of Cooperation: Five Years of Participatory Design in the Virtual School John M. Carroll1, George Chin2, Mary Beth Rosson1, and Dennis C. Neale1 1 Center for Human-Computer Interaction and Department of Computer Science Virginia Tech... Date Added: 2009-06-25 21:35:31 |
| Lists.ppt Path: Cal Poly Pomona >> ECE >> 304 Fall, 2009 Description: Lists 06/19/09 Meng-Lai Yin ECE304 1 Basics Alistisafinitesequence(probablyempty)ofelements. BasicOperations: Construction:Createanemptylist Empty:Checkifthelistisempty Traverse:Gothroughthelistorapartofit,accessingandprocessing theelementsi... Date Added: 2009-06-25 21:35:52 |
| Problem Set-3.pdf Path: Sveriges lantbruksuniversitet >> C >> 340 Fall, 2009 Description: ... Date Added: 2009-06-25 21:36:24 |
| 1473exam2review.pdf Path: Southern Oregon >> MATH >> 1473 Fall, 2009 Description: MATH 1473: Review Sheet for Exam #2 Chapter 2: Sections 2.1 - 2.4 Section 2.1: Be able to write and know the meanings of the denitions of the following terms: cardinal number/cardinality, equal sets, empty set, universal set, subset, improper subset... Date Added: 2009-06-25 21:38:43 |
| mtsol.pdf Path: W. Alabama >> AM >> 455 Fall, 2009 Description: AMATH 455/655 Midterm Winter 2007 Solutions 1. a) The system can be described by k 1 0 0 k 2 0 x = k3 0 x + 0 k3 u. 0 10 0 0 b) With C = (0 0 1) we nd 001 O(A, C ) = 0 1 0 k 3 0 which has full rank. Thus the system is controllable by ... Date Added: 2009-06-25 21:41:07 |
| cs1713exam2f2007s.pdf Path: Texas San Antonio >> CS >> 1713 Fall, 2008 Description: CS 1713 Exam 2 Solutions Fall 2007 1) (10 points) public boolean moreAsThanBs(String s) { int aCount = 0; int bCount = 0; for (int i=0;i<s.length();i+) { if (s.charAt(i) = A) aCount+; if (s.charAt(i) = B) bCount+; } return aCount > bCount; } 2) (10 ... Date Added: 2009-06-25 21:45:48 |
| masa_07.ppt Path: N. Arizona >> D >> 486 Fall, 2009 Description: M.A.S.A. M.A.S.A. Photovoltaic Panel Photovoltaic Deployment Deployment Prometheus Systems, LLC Overview Overview Introduction Problem Statement Project Requirements Project Project Deliverables State of the Art Research (S.O.T.A) Design... Date Added: 2009-06-25 21:49:09 |
| potassium_chromate.pdf Path: Air Force Academy >> MSDS >> 115 Fall, 2009 Description: J.T.BAKER CHEMICAL CO. - POTASSIUM CHROMATE = MSDS Safety Information = FSC: 6810 NIIN: 00-241-8422 MSDS Date: 03/09/1992 MSDS Num: BTSDY Product ID: POTASSIUM CHROMATE MFN: 01 Responsible Party Cage: DO870 Name: J.T.BAKER CHEMICAL CO. Address: 222 R... Date Added: 2009-06-25 21:50:39 |
| potassium_chromate.pdf Path: Air Force Academy >> MSDS >> 112 Fall, 2009 Description: J.T.BAKER CHEMICAL CO. - POTASSIUM CHROMATE = MSDS Safety Information = FSC: 6810 NIIN: 00-241-8422 MSDS Date: 03/09/1992 MSDS Num: BTSDY Product ID: POTASSIUM CHROMATE MFN: 01 Responsible Party Cage: DO870 Name: J.T.BAKER CHEMICAL CO. Address: 222 R... Date Added: 2009-06-25 21:50:40 |
| LEC12.doc Path: Furman >> CMURPHY >> 1586 Fall, 2009 Description: Leccin12Lavivienda Temasprincipales: 1. elvocabulario 2. pronombresrelativos 3. losmandatosformales 4. elsubjuntivo 5. elsubjuntivoconciertosverbos Conversacionesdelvocabulario (subjuntivoestsubrayada) Ququieresenunacasa? Quierounacasaque tenga . ... Date Added: 2009-06-25 21:51:02 |
| YTurnOnTotal.ps Path: Stanford >> MEETING >> 050802 Fall, 2009 Description: %!PS-Adobe-2.0 %Title: /a/bbrnfs03/det/trg/trg/dwalker/RELEASES/18.0.4/workdir/newTurnOnPlots/YTurnOnTotal.ps: c1 %Creator: ROOT Version 4.03/02 %CreationDate: Tue Aug 2 13:20:46 2005 %EndComments %BeginProlog /s {stroke} def /l {lineto} def /m {move... Date Added: 2009-06-25 21:55:59 |
| Flyrod.pdf Path: Portland >> ME >> 488 Fall, 2008 Description: Fly Rod Frequency During the casting of a fly rod in fly fishing, a rods ability to deliver long, accurate casts is directly correlated to its fundamental frequency of vibration. Rods from different manufacturers exhibit many different designs and e... Date Added: 2009-06-25 21:59:08 |
| index2.txt Path: Berkeley >> ASTRO >> 00207281 Fall, 2009 Description: 9.80000 31.5000 -0.0141307 0.369272 155.631 275.425 -4.46198 0.211240 275.425 636.478 -1.76060 0.310094 636.478 16371.8 -1.19820 0.0655665 16371.8 85697.4 -0.44432... Date Added: 2009-06-25 21:59:40 |
| ps1.pdf Path: Columbia >> ITC >> 3025 Fall, 2009 Description: BARNARD COLLEGE Department of Economics Financial Economics V 3025 Rajiv Sethi Phone: 854 5140 Problem Set 1 1. Access the TreasuryDirect website and click on Recent Auctions: Bills. What was the price paid for a 91-day T-bill with face value 10,000 ... Date Added: 2009-06-25 22:02:16 |
| arf_pc.txt Path: Berkeley >> ASTRO >> 00150139 Fall, 2009 Description: ;instrument XRT ;exposure 49084.255 ;xunit kev ;bintype counts 0.0000000 0.0049999999 13.862960 1.00000 0.0049999999 0.0099999998 13.912385 1.00000 0.0099999998 0.015000000 13.961811 1.0... Date Added: 2009-06-25 22:03:35 |
| quiz06-content.pdf Path: Washington >> TQS >> 125 Fall, 2009 Description: Name: TQS 125 Winter 2008 Calculus & Analytic Geometry II Quiz 6 February 21, 2008 1. Values for f (x) are in the table. Which of the numerical approximation methods is 12 likely to give the best estimate of 0 f (x)dx? Estimate the integral using... Date Added: 2009-06-25 22:04:21 |
| genetic_figure_russell_norvig.pdf Path: Uni. Worcester >> CS >> 539 Fall, 2009 Description: 24748552 32752411 24415124 32543213 (a) Initial Population 24 31% 23 29% 20 26% 11 14% (b) Fitness Function 32752411 24748552 32752411 24415124 (c) Selection 32748552 24752411 32752124 24415411 (d) CrossOver 32748152 24752411 32252124 24415417 (e... Date Added: 2009-06-25 22:07:35 |
| YDL061C.t06.stride-ebghtl-logo.pdf Path: UCSC >> YDL >> 061 Fall, 2009 Description: YDL061C.t06 stride-ebghtl 3 2 1 1 10 20 30 40 T 3 2 1 T E T E H 51 GFHKYR E 50 MAHENVWFSHPRRFGKGSRQCRVCSSHTGLVRKYDLNICRQCFREKANDI ... Date Added: 2009-06-25 22:13:03 |
| YDL083C.t2k.CB_burial_14_7-logo.pdf Path: UCSC >> YDL >> 083 Fall, 2009 Description: YDL083C.t2k CB_BURIAL_14_7 3 2 1 AAAAA C X X 1 10 20 30 40 A 3 2 1 B E D E D F D E B A E E B A D B D B D E F FF GG X B E D D C CDCADD E C E D G A C E D B F C EFEDCA D ED EE EDXXXEDCAXDDFXXCEFDXX X FE F B X X X X A B BBE C X X X ... Date Added: 2009-06-25 22:13:09 |
| L09.ppt Path: UMBC >> PUB >> 104 Fall, 2009 Description: Arithmetic Operators Topics Arithmetic Operators Operator Precedence Evaluating Arithmetic Expressions In-class Project Incremental Programming Reading Section 2.5 L09 Arithmetic Operators in C Name Operator + * / % Example num1 + num2 initia... Date Added: 2009-06-25 22:15:00 |
| L01Introduction.ppt Path: UMBC >> PUB >> 104 Fall, 2009 Description: CMSC104 Problem Solving and Computer Programming Spring 2009 Sections 0201 & 0301 Ms. Dawn Block Contact Information Who am I? Best way to contact me? Office hours: Email! dblock@umbc.edu Where? ITE 208 Dawn Block When? Tuesday and T... Date Added: 2009-06-25 22:15:09 |
| L08VariablesInC.ppt Path: UMBC >> PUB >> 104 Fall, 2009 Description: Variables in C Topics Naming Variables Declaring Variables Using Variables The Assignment Statement Reading Sections 2.3 - 2.4 1 What Are Variables in C? Variables in C have the same meaning as variables in algebra. That is, they represen... Date Added: 2009-06-25 22:15:12 |
| Introduction to History of Anthropological Thought.ppt Path: Laurentian >> ANTH >> 3000 Fall, 2009 Description: Introduction to History of Anthropological Thought Judy Whitehead TH 218 Telephone: 329-2011 Office Hours: Thursday 2-5 p.m. or by appointment. E-mail: whitja01@uleth.ca. 06/19/09 1 Why a Theory Course? The main, unifying course that provi... Date Added: 2009-06-25 22:16:24 |
| Design milestone 4.doc Path: Union College >> MER >> 419 Fall, 2009 Description: DESIGNMILESTONEMEMORANDUM TO: DR.ANDREWRAPOFF(PROFESSOROFMECHANICALENGINEERING) FROM: TEAMTOUGHNESS;CRAIGAVALONE(TEAMCAPTAIN) SUBJECT: DESIGNMILESTONE#4 DATE: 5/01/2007 CC: BRENDONKEINATH;MICHAELGUIGLI;JUSTINMOLE FOODFRACTURETESTING Togetabetter... Date Added: 2009-06-25 22:17:34 |
| Lecture1018.ppt Path: Missouri S&T >> CS >> 307 Fall, 2009 Description: CS307 CS307 Software Testing And Software Quality Assurance Quality Frank Liu Lesson Title: Software Total Lesson Quality Management Three factors for Quality Improving using TQM TQM The following three elements are key The elements for achieving so... Date Added: 2009-06-25 22:19:10 |
| Lecture1017.ppt Path: Missouri S&T >> CS >> 307 Fall, 2009 Description: CS307 CS307 Software Testing And Software Quality Assurance Quality Frank Liu Lesson Title: Software Total Lesson Quality Management Three factors for Quality Improving using TQM TQM The following three elements are key The elements for achieving so... Date Added: 2009-06-25 22:19:22 |
| YKL128C.t2k.w0.5-logo.pdf Path: UCSC >> YKL >> 128 Fall, 2009 Description: YKL128C.t2k w0.5 5 4 3 2 1 L X 1 10 20 30 40 T 5 4 3 2 1 XXX G D G S H G E T H Y K C Q L XXXX T L I V II F V MAQ L H L GQ V I X V F M T X LK R XXAXXXXXXXX X S T K H 51 60 70 80 90 T 5 4 3 2 1 E S H T T T H RE V V A I ... Date Added: 2009-06-25 22:20:37 |
| restofesto.pdf Path: Washington >> EHUF >> 362 Fall, 2009 Description: ... Date Added: 2009-06-25 22:22:12 |
| The pursuit to happiness.docx Path: Uni. Westminster >> WVJ >> 0805 Fall, 2009 Description: William Jemison Marketing 303 Selling Portrayal Assignment Background Information The movie I chosen to write my paper on is The Pursuit to Happyness. It debut in theatre on December 16, 2006. The main character, Chris Gardner, is played by Will Smit... Date Added: 2009-06-25 22:24:05 |
| James_Tsai.ppt Path: W. Alabama >> ME >> 100 Fall, 2009 Description: Camshaft, Rocker Arms, Pushrods (Valve Train) NAME: JAMES TSAI Objective: -To learn about valve trains and its components. -Alternatives to a pushrod system -Advantages/Disadvantages of SOHC and DOHC What is a Valve Train? What is a Valve Train? D... Date Added: 2009-06-25 22:25:58 |
| Stuart_Johns.doc Path: W. Alabama >> ME >> 100 Fall, 2009 Description: What is an Internal Gear Pump? An internal gear pump is used for the displacement of liquids, or transfer from one place to another. Often pressurized What is it used for? Boiler Burner Lubricating parts Locomotive and barge engines Types In... Date Added: 2009-06-25 22:26:01 |
| CCTM41_E0102.pdf Path: East Los Angeles College >> CCT >> 741 Fall, 2009 Description: CCMT41: Real-Time Systems Page 1 of 7 UNIVERSITY OF WESTMINSTER Harrow School of Computer Science CCTM41: Real-Time Systems (3hr) Second Semester 2001 - 2002 Instructions Choose and answer FOUR questions only Calculators are allowed University o... Date Added: 2009-06-25 22:26:42 |
| handoutpharm492_drugdistribution_2006.pdf Path: Washington >> WEEK >> 492 Fall, 2009 Description: Drug Distribution Services for Long Term Care Facilities Susan L. Lakey, PharmD 1/11/06 Drug distribution The process: Receipt / transcription of order Interpretation / evaluation of order Filling and packaging order and checking it Delivery Adminis... Date Added: 2009-06-25 22:29:02 |
| 23_Lists.ppt Path: UNC >> COMP >> 114 Fall, 2005 Description: Lists COMP 114 Tuesday March 27 Lastra, 2001 Slide 1 Announcements Dont wait to get started on Program 4! Test next Tuesday Review Thursday Lastra, 2001 Slide 2 Topics Last Time Sorting Counting sort Radix Sort This Class Linked Lists... Date Added: 2009-06-25 22:30:44 |
| matrices_03.xls Path: VCU >> MGMT >> 171 Fall, 2008 Description: Matrices are essentially boxes filled with numbers organized in rows and columns. Hence matrices are easily represented on an Excel worksheet. Letters such as A, B, C, D, etc. are generally used as names for matrices. The size of a matrix is determin... Date Added: 2009-06-25 22:31:18 |
| Comparison of Limit Laws.doc Path: Idaho >> MATH >> 175 Summer, 2008 Description: A Comparison of Limit Laws for functions and sequences The following limit laws apply when the limits exist. If lim f x ( x) = L, then If lim f x ( x) lim an = L , if an = f ( n ) n n N. (Note that we sometimes start n at zero.) DNE, then we s... Date Added: 2009-06-25 22:35:23 |
| cs410slides13bresenham2.pdf Path: Colorado State >> CS >> 410 Fall, 2008 Description: Rasterization (part Rasterization 2) 2) Lecture #23 Wednesday, September 24th, 2008 Bresenhams Algorithm Bresenham noted that at each step along the line, there are only two choices for the next pixel to be filled in. ? ? The set of which two pixe... Date Added: 2009-06-25 22:41:21 |
| mat14504.pdf Path: Stetson >> MAT >> 145 Fall, 2009 Description: HIVER 2009 MAT-145, groupe 04 Examen final corrig sur : 100 Code permanent pondration : 30% 01078609 01088105 01118706 02038406 03028600 04108805 05028705 05038809 05068605 05068705 06078609 07108701 07108701 10048506 13038705 14088505 15098604 1806... Date Added: 2009-06-25 22:44:53 |
| mat26501.pdf Path: Stetson >> MAT >> 265 Fall, 2009 Description: HIVER 2009 MAT-265, groupe 01 Examen final 100 35% 85 77 42 54 26 75 70 80 55 47 53 64 42 71 56 87 100 0 81 65 40 82 55 49 43 75 90 58 50 43 65 64 63 70 93 74 62 65 90 69 51 64 51 93 64 68 49 moyenne : cart-type : 64,6 16,5 Prof : Chantal Trottier ... Date Added: 2009-06-25 22:44:54 |
| Midterm 2 Key.pdf Path: Washington >> CEE >> 320 Fall, 2008 Description: CEE 320 Midterm Examination II (50 minutes) Please write your name on this cover. Please write you last name on all other exam pages This examination is open-book, open-note. There are 5 questions worth a total of 200 points. Each question... Date Added: 2009-06-25 22:46:04 |
| Problem Set 3 2008.doc Path: Cornell >> DEA >> 4550 Fall, 2009 Description: DEA 455 /656 Research Methods in Human-Environment Relations WRITE YOUR NAME ON THE BACK OF THE FIRST PAGE! Problem Set #3 N. Wells 1. Imagine a study of the effects of hard-walled offices (as opposed to open cubicles) on office communication. Vb ... Date Added: 2009-06-25 22:53:37 |
| DEBEVALbp.pdf Path: NSUOK >> ALEXA >> 001 Fall, 2009 Description: Debate Comment Sheet PS2313 - International Relations James Alexander 1. Preparation -Is the position clearly argued? -Does the presenter \"know\" the topic? 2. Staying in character -Does the presenter argue \"his/her\" position? 3. Logical presentatio... Date Added: 2009-06-25 22:53:50 |
| submission.pdf Path: Columbia >> WW >> 2040 Fall, 2009 Description: ENGINEERING SOLUTION OF A BASIC CALL-CENTER MODEL by Ward Whitt Department of Industrial Engineering and Operations Research Columbia University, New York, NY 10027 Abstract An algorithm is developed to rapidly compute approximations for all the stan... Date Added: 2009-06-25 23:02:54 |
| parseval.pdf Path: New Mexico >> EECE >> 314 Fall, 2009 Description: F 826($! b9sf2!(9 6b 26sB( b(# ! t s v s v u u w v t s t x w v u t (2x (`V@VTQ... Date Added: 2009-06-25 23:03:23 |
| BGPfromIRR-4toAPage.pdf Path: UMass (Amherst) >> ECE >> 697 Fall, 2009 Description: BGP Configuration from the IRR BGP Configuration Cengiz Alaettinoglu Packet Design Inc. cengiz@packetdesign.com Too many routers Too detailed, large & tedious Consistency Heavy consequences of mistakes http:/www.isi.edu/ra/rps/training http:/www.i... Date Added: 2009-06-25 23:07:31 |
| Lecture_TransLogisticsI_ho.pdf Path: Midwestern State University >> ECONS >> 451 Fall, 2009 Description: Marketing Bill and Farm Value, 1970-1996 EconS 451: Lecture Farm Value and Marketing Bill of U.S. Retail Food Expenditures 600 Total Marketing Bill 500 Farm Value Transportation and Logistics Billion Dollars $ Understand the type of utility t... Date Added: 2009-06-25 23:08:55 |
| Env543 Laboratory Assignment 2 Fall 2006.pdf Path: Washington University in St. Louis >> ENV >> 543 Fall, 2009 Description: Env 543 Aquatic Chemistry Laboratory: Solubility of Aluminum Hydroxide Laboratory Session: Tuesday October 31 at 8:30AM in Urbauer Room 1 (Jens Lab) Laboratory report due Thursday November 9 Laboratory Objectives: The objective of this laboratory a... Date Added: 2009-06-25 23:12:58 |
| Rsum.pdf Path: University of Louisiana at Lafayette >> KJS >> 9870 Fall, 2009 Description: Kyle Suire 705 Johnston St. Lafayette, LA 70501 337-207-1992 kyles3406@bellsouth.net Objective Education To obtain a full-time entry level employment position designing computers. University of Louisiana at Lafayette, Lafayette, LA Bachelor of Scie... Date Added: 2009-06-25 23:18:40 |
| Crab_pix.txt Path: RIT >> PHYS >> 231 Fall, 2009 Description: Laboratory Exercise in Astronomy The Crab Nebula. You should bring this offprint with you to the lab. Read the exercise and use the worksheet below to answer questions posed in the exercise. Throughout the lab, express your answer with the numb... Date Added: 2009-06-25 23:18:50 |
| fujinaga06mpeg7.ppt Path: McGill >> MUMT >> 621 Fall, 2009 Description: MPEG7 Audio Overview Ichiro Fujinaga MUMT 611 McGill University Content MPEG7 overview Objectives and scope Main elements and organization Lowlevel features Highlevel features and tools MPEG7 audio MUMT611 Fujinaga 2 / 18 Introduction ... Date Added: 2009-06-25 23:19:09 |
| Lecture10_02022007.pdf Path: Acton School of Business >> PHYS >> 102 Fall, 2008 Description: GoBack PHYS102 - Gausss Law. Dr. Suess February 2, 2007 PHYS102 Gausss Law - Conductors slide 1 Question #1 PRS Questions Question #1 Answer to Question #1 Question #2 Answer to Question #2 Consider the Gaussian surface of a cube which en... Date Added: 2009-06-25 23:26:03 |
| Lecture12.ppt Path: Oregon >> EC >> 390 Fall, 2008 Description: ECON 390 ISSUES AND PROBLEMS IN DEVELOPING ECONOMIES Lecture 12: Population growth and economic development; Human capital Goals for today Class update? Population growth and economic development Becker model of fertility Human capital What ... Date Added: 2009-06-25 23:26:50 |
| Chapt8_Craig.pdf Path: University of Illinois, Urbana Champaign >> AE >> 451 Fall, 2008 Description: ... Date Added: 2009-06-25 23:27:32 |
| Introduction.pdf Path: East Los Angeles College >> OPEN >> 7162 Fall, 2009 Description: Spaces of Democracy Geography and Democracy An Introduction 1 Clive Barnett and Murray Low Where is Democracy? Amidst debates about globalization, neo-liberalism, and anti-capitalism, it is easy to forget that probably the most significant global ... Date Added: 2009-06-25 23:30:31 |
| 2008A_phys202_grade_Exam3_v7_080328.pdf Path: Texas A&M >> PHYS >> 202 Fall, 2008 Description: Exam 1 + Bonus after Exam 3 after Exam 2 Y Your S Score (AVG) 107.1 101.8 106.4 100.2 103.3 103 3 101.1 103.9 99.6 101.3 97.0 99.5 99.0 93.8 94.7 96.6 89.8 97.4 86.8 90.5 92.3 87.8 84.9 89.3 89.3 81.8 81.8 83.8 84.2 79.8 85.1 85.3 98.9 81.8 85.2 89.7... Date Added: 2009-06-25 23:31:41 |
| TestCoverageTools_Features.doc Path: W. Florida >> STUPRES >> 200301 Fall, 2009 Description: Products Product Feature C0 Statement Coverage C1 Branch Coverage S0 Module Coverage S1 Call-Pair Coverage Object Instrumentation Source Technology Instrumentation Base Fixed Runtime Dynamic Runtime Instrumentation Speed (% of compile) Compilation Ov... Date Added: 2009-06-25 23:31:53 |
| Syllabus.pdf Path: Rutgers >> CHEM >> 162 Fall, 2009 Description: GENERAL CHEMISTRY (01:160:162) SOLID GEMS SYLLABUS - SPRING 2007 HOMEWORK PROBLEMS LEC# DATE ASSGNMNT REC 1/16 T Math. Sheet 1 1/17 W 12.1-12.3 12: 21, 27, 29, 33, 35, 39, 43, 81 REC 1/18 Th Lecture 1 2 1/19 F 12.3-12.5 12: 41, 45, 51, 84, 86 --3 1/... Date Added: 2009-06-25 23:32:52 |
| course outline W09.pdf Path: St. Mary MD >> SOCSERV >> 762 Fall, 2009 Description: ECON 762 Econometrics II: Course Outline L. Magee instructor: oce: phone: email: web site: oce hours: lecture times: textbook: Lonnie Magee KTH-402 525-9140, ext.23805 magee@mcmaster.ca http:/socserv.mcmaster.ca/magee/ Wednesdays 10:30-11:30 and Fr... Date Added: 2009-06-25 23:33:03 |
| 231_Chapter10_Final.ppt Path: St. Francis IL >> MARCH >> 231 Fall, 2009 Description: Marketing: An Introduction Ch 10 Pricing Products: Pricing Considerations and Strategies March 9th, 2006 Marketing: An Introduction Agenda Quiz Factors affecting a firms pricing decisions General approaches to price setting Major strategies ... Date Added: 2009-06-25 23:33:27 |
| SealRite_B.xls Path: St. Francis IL >> MARCH >> 435 Fall, 2009 Description: Annual Selling Operating Customer Number of Number of Sales (% Gross Profit Expense (% Profit (% of Volume Accounts Calls of Total) (% of Sales) of sales) sales) 200 4 256 11 16 4 12 100-200 4 274 3 24 10 14 50-99.9 32 1344 12 20 10 10 40-49.9 24 101... Date Added: 2009-06-25 23:33:30 |
| fa08L30.txt Path: UF >> CISE >> 3023 Fall, 2009 Description: Rational Numbers (n1/d1) / (n2/d2) n2 = 0 class Account { / . you create all of the other elements public void deposit(int amount) throws NegativeAmountException { if (amount < 0) { throw new NegativeAmountException(); } ... Date Added: 2009-06-25 23:43:20 |
| t2ss01key.pdf Path: University of North Carolina, Wilmington >> CHM >> 211 Fall, 2008 Description: CHM 211 Test 2 (Ch. 3, 4) Name _Answer Key_ May 31, 2001 1. (6) Place the appropriate letter of the family name on the line next to each structure based on the functional group present. O A. aldehyde E B. ketone G CH3COCH2CH3 CH3CH2SH C. carboxylic... Date Added: 2009-06-25 23:45:12 |
| Basic Math-Pharm Text 7th Ed_page 8.pdf Path: Schreiner >> FMA >> 1103 Fall, 2009 Description: ... Date Added: 2009-06-25 23:50:06 |
| mts1d.pdf Path: Sveriges lantbruksuniversitet >> JUNK >> 1011828 Fall, 2009 Description: ... Date Added: 2009-06-25 23:52:22 |
| 01.pdf Path: San Diego State >> ART >> 448 Spring, 2008 Description: About type and type layers When you create type, a new type layer is added to the Layers palette. Important: Type layers aren\'t created for images in Multichannel, Bitmap, or Indexed Color mode, because these modes don\'t support layers. In these mode... Date Added: 2009-06-25 23:55:04 |
| MarxEtAl2002.pdf Path: Columbia >> G >> 9600 Fall, 2009 Description: REPORTS Requirement of a Macromolecular Signaling Complex for Adrenergic Receptor Modulation of the KCNQ1KCNE1 Potassium Channel Steven O. Marx,* Junko Kurokawa,* Steven Reiken, Howard Motoike, Jeanine DArmiento, Andrew R. Marks, Robert S. Kass Symp... Date Added: 2009-06-25 23:57:34 |
| MurphyProjectOutline.pdf Path: Johns Hopkins >> APL >> 525759 Fall, 2009 Description: Project Outline I. Introduction a. Description of challenges inherent in compressing images with a large data content or in applications where retention of resolution is critical i. medical imagery 1. image sizes can exceed ~20MB 2. compression limit... Date Added: 2009-06-26 00:01:17 |
| 09springP3ans.pdf Path: Cornell >> CS >> 1110 Fall, 2009 Description: Sample answers, CS1110 Prelim 3, Spring 2009 Q1. /* = number of digits for n, with no leading 0s. */ public static int length(int n) { if (n = 0) return n; return 1 + length(n/10); } Q2. (a) /* Constructor: an instance for n. */ public BigInt(int n) ... Date Added: 2009-06-26 00:06:28 |
| hmwk5.pdf Path: Wisconsin >> ECE >> 353 Fall, 2008 Description: HOMEWORK ASSIGNMENT #5 Due April 8th, 2005 1. (10 points) PCB Do Problem 26 from page 322, Chapter 10 of the text. 2. (10 points) Address Decoding Given the below 80C188EB memory system and decoding logic, draw the system memory map. All memory devic... Date Added: 2009-06-26 00:07:51 |
| Fractions_Assessment.pdf Path: UNL >> TEAC >> 880 Summer, 2008 Description: TEAC880K Assessment Project Fraction Assessments 6.1 Notes for Teaching: Meanings of a b Do the Fractions of a Rectangle activity from Session 1 of the DCA Describe one of the interpretations of a b Present exercises at the board 6.2 Equivalent (E... Date Added: 2009-06-26 00:13:51 |
| week5.pdf Path: Drake >> ECON >> 180 Fall, 2009 Description: MEASURES OF INDUSTRY CONCENTRATION Page 1 Industry concentration: definition MEASURES OF INDUSTRY CONCENTRATION What is concentration? How is it measured? An industry is concentrated if one or a few firms have large market shares. If an industry... Date Added: 2009-06-26 00:14:29 |
| HA3.pdf Path: Toledo >> CSC >> 165 Fall, 2009 Description: CSC 165 H1S Worth: 8% Homework Assignment # 3 Winter 2009 Due: By 6pm on Wednesday 1 April 1. Consider the Selection Sort algorithm below, that sorts an input array A into non-decreasing order. SS(A): i=0 while i < len(A): s=i j =i+1 while j < le... Date Added: 2009-06-26 00:14:39 |
| 1206_Matlab_Coversheet.pdf Path: Virginia Tech >> MATH >> 1206 Fall, 2008 Description: 1206 Matlab Worksheet # CRN: Class Time: Lab Partners Names: ID #: Names: ID #: Names: ID #: HONOR PLEDGE: As per the Virginia Tech Honor System, I/we have neither given nor received any unauthorized assistance on this Matlab assignment. We did not... Date Added: 2009-06-26 00:14:47 |
| soln_12p6.pdf Path: Colorado >> MATH >> 4520 Fall, 2008 Description: ... Date Added: 2009-06-26 00:15:14 |
| lec05h.pdf Path: Berkeley >> EECS >> 12202 Fall, 2009 Description: Fall & Walrand Lecture 5 Where we are now EECS 122, Lecture 5 Kevin Fall kfall@cs.berkeley.edu Jean Walrand wlr@eecs.berkeley.edu Notions of network design Internet naming and addressing Internet service model But, how to transfer actual data? EEC... Date Added: 2009-06-26 00:16:11 |
| 04111203.pdf Path: Wisconsin >> SH >> 041112 Fall, 2009 Description: ... Date Added: 2009-06-26 00:16:21 |
| 114s09fe-hist.pdf Path: Duke >> STA >> 114 Spring, 2008 Description: Range: 30.62% 97.5%, 49 Students Median = 113, Quartiles = [95, 132] Mean = 113.35, Std Dev = 24.33 Students 0 2 4 6 8 0 50 100 150 Statistics: STA 114 = MTH 136 Final Examination, Spring 2009 ... Date Added: 2009-06-26 00:21:08 |
| Lecture19.pdf Path: University of Toronto >> STA >> 0405 Fall, 2009 Description: 9 Tk? /+ln- htT, ? toe W 9r* -b^\"Ll fi.Jatth.l D\'z+Otm\" nl[f | 6]) fu>Uh^friv\' 1k (t\': a \'lw r { , - -.rxr,i dr(. .,t\'t fu\'w*C. *n+ v\"ntg l -\"{,l\'Afri-\'t{ hr*0 L v wr*ol f ufrh\'uftT- l^ Wtrt^ouLtt I t N u(r,) lu* Z ;= Zr\'try W4va- f 4; - N(o... Date Added: 2009-06-26 00:22:41 |
| Q3Sol.pdf Path: UF >> PHY >> 2054 Summer, 2008 Description: ... Date Added: 2009-06-26 00:28:11 |
| thesis_xinping.pdf Path: Berkeley >> EECS >> 619 Fall, 2009 Description: |zzy xwv {$pp$u k u y y u k y r u y 8TRlStSw(sTy y q ys y oRT7(YSr jS r yr yr sysy q qy aS8h a`(ihgTST77n`( v u s ` plhR o(nlm yTRljSihg(8R8u y k y s y r su s r ffvSTe(S(TaS( u y du y u y sy yvy Ra(... Date Added: 2009-06-26 00:28:52 |
| PP_CH004.ppt Path: FGCU >> FIN >> 3504 Fall, 2009 Description: Mutual Funds and Other Investment Companies 2007 The McGrawHill Companies, Inc., All Rights Reserved. McGrawHill/Irwin CHAPTER 4 Services of Investment Companies Administration divisibility Professional m... Date Added: 2009-06-26 00:30:21 |
| zPS1.pdf Path: Mt. Hood Community College >> CH >> 223 Spring, 2008 Description: CH 223 Problem Set #1 Covering: Chapter Fifteen and Chapter Guide One Important Tables and/or Constants: none 1. Write equilibrium constant expressions for the following reactions. For gases use either pressures or concentrations. a. 3 O2(g) 2 O3(g... Date Added: 2009-06-26 00:31:02 |
| homework5.pdf Path: Colorado >> AMATH >> 4350 Fall, 2009 Description: APPM 4350/5350: Fourier Series and Boundary Value Problems Homework #5 Monday October 27, 2008 Due: Monday, November 10, 2008 1. 5.5.1 b,d 2. 5.5.8 a,b,c,e 3. Review: 5.5A: 2a,b; 4b; 6a,b 4. 5.6.2 5. 5.8.6a,c 6. 5.9.1a,c 7. 5.9.2 8. 5.10.3 9. 5.10.6 ... Date Added: 2009-06-26 00:31:15 |
| 7-DefectRemovalMetrics.ppt Path: RIT >> SE >> 450 Fall, 2009 Description: Defect Removal Metrics June 19, 2009 RIT Software Engineering Swami Natarajan Defect removal metrics: concepts All defect removal metrics computed from the measurements identified last time Inspection reports, test reports, field defect reports... Date Added: 2009-06-26 00:31:41 |
| ProjectManage.pdf Path: San Jose State >> ISE >> 165 Fall, 2009 Description: Project Management Instructor: Dr. Jerry Gao Project Management - The Management Spectrum - People - The Players - Team Leaders - The Software Team - Coordination and Communication Issues - The Problem - Software Scope - Problem Decomposition - The... Date Added: 2009-06-26 00:32:32 |
| 200509-exam03.pdf Path: The University of Akron >> ME >> 203 Fall, 2009 Description: Engineering Mechanics-Dynamics: 4600203 Name: Fall 2005-Exam III This quiz is closed book. Please denote your answers clearly, i.e., box in, star, etc., and write neatly. There are no points for small, messy, unreadable work. . . please use lots of... Date Added: 2009-06-26 00:33:13 |
| Paying down mtg = investing.xls Path: High Point >> BUA >> 234 Fall, 2009 Description: 15 vs 30 Year: The concept of investing by paying down a loan 15 year mtg $300,000 $20,000 10% 30 yr mtg $300,000 $10,000 10% Loan Annual Principal Reduction Interest Rate Loan Balance at the end of the first year Interest Interest Expense, year tw... Date Added: 2009-06-26 00:33:31 |
| NAT-and-ACLs.doc Path: UH Clear Lake >> ISAM >> 5439 Fall, 2008 Description: NAT AND ACLs EXPERIMENT In this experiment you will combine your Extended ACL knowledge with your NAT knowledge. You will work with the same network arrangement in \"Standard and Extended ACLs\" experiment. First setup the network and test for connec... Date Added: 2009-06-26 00:36:21 |
| 4Meteroids.pdf Path: Wisc Stevens Point >> EBOUC >> 592 Fall, 2009 Description: Junk in Space: Meteoroids Physical Education, Science Grade: 4 Rationale: It is important for students to understand that in space there are more than just planets, stars, and moons. There is also a lot of tiny debris which are known as meteoroids. L... Date Added: 2009-06-26 00:37:45 |
| nartenquestions.pdf Path: Duke >> X >> 182 Fall, 2009 Description: H2O - CPS182S-Fall03 http:/h2o.law.harvard.edu/viewRotisserie.do?view=allex. Guest: login Overview CPS182S-Fall03 > IETF/Narten question(s) ROTISSERIE QUESTION What question(s) would you ask of Thomas Narten, area director for the Int... Date Added: 2009-06-26 00:50:21 |
| GrabPage.c.txt Path: Allan Hancock College >> INFT >> 063 Fall, 2009 Description: #include <stdio.h> #include <stdlib.h> #include <string.h> #include <unistd.h> #include <sys/types.h> #include <sys/socket.h> #include <netinet/in.h> #include <netdb.h> /* GrabPage.c: a C version of the GrabPage client. * * (c) 2001, Warren Toomey... Date Added: 2009-06-26 01:08:33 |
| m158otln.pdf Path: Rappahannock Community College >> M >> 158 Fall, 2009 Description: TIDEWATER COMMUNITY COLLEGE VIRGINIA BEACH CAMPUS DIVISION OF NATURAL SCIENCES AND MATHEMATICS ASSOCIATE PROFESSOR MAYNARD COURSE PLAN FOR MTH 158-College Algebra Lecture Hours 4 Lab Hours 0 Credit Hours 3 In Effect Beginning And Continuing Thro... Date Added: 2009-06-26 01:24:09 |
| sec1_8.pdf Path: University of Dayton >> MATH >> 310 Fall, 2009 Description: 1.8 Introduction to Linear Transformations Another way to view Ax b: Matrix A is an object acting on x by multiplication to produce a new vector Ax or b. EXAMPLE: 2 3 1 4 6 2 2 3 8 12 4 2 3 1 4 6 2 2 1 0 0 0 Suppose A is m n. Solving Ax b amou... Date Added: 2009-06-26 01:41:17 |
| 01.pdf Path: San Diego State >> ART >> 344 Fall, 2008 Description: About type and type layers When you create type, a new type layer is added to the Layers palette. Important: Type layers aren\'t created for images in Multichannel, Bitmap, or Indexed Color mode, because these modes don\'t support layers. In these mode... Date Added: 2009-06-26 02:06:47 |
| dm2part2.pdf Path: UF >> CIS >> 4930 Fall, 2008 Description: University of Florida CISE department Gator Engineering Data Preprocessing Dr. Sanjay Ranka Professor Computer and Information Science and Engineering University of Florida, Gainesville ranka@cise.ufl.edu University of Florida CISE department G... Date Added: 2009-06-26 02:36:31 |
| mid2000FSoln.pdf Path: University of Toronto >> CSC >> 148 Fall, 2009 Description: %#! f q w w% Hwt f%w o n l } hk h l j 2r4m% 0rw8f o jn y j 2f#f r o i j hk 8crsw{ z o i }k i 8crWuzr# %wQ4wd d wwHdt u%d$%Q$gudvwuzsw% d dtw$dc$ dutwd% ddt % v ... Date Added: 2009-06-26 02:42:51 |
| HA3.pdf Path: University of Toronto >> CSC >> 165 Fall, 2009 Description: CSC 165 H1S Worth: 8% Homework Assignment # 3 Winter 2009 Due: By 6pm on Wednesday 1 April 1. Consider the Selection Sort algorithm below, that sorts an input array A into non-decreasing order. SS(A): i=0 while i < len(A): s=i j =i+1 while j < le... Date Added: 2009-06-26 02:43:08 |
| attachment.pdf Path: Texas A&M University, Corpus Christi >> SCI >> 20080919 Fall, 2009 Description: 6 RE AC 0604 Observing Signs of Chemical Reaction Prepared by M. L. Gillette, Indiana University Kokomo, and H. A. Neidig, Lebanon Valley College PURPOSE OF THE EXPERIMENT Observe and record the physical characteristics of solids and solutions. Ob... Date Added: 2009-06-26 02:47:35 |
| exam2F08ans.pdf Path: Montana >> WEB >> 105 Fall, 2009 Description: ... Date Added: 2009-06-26 03:01:13 |
| hw4.ps Path: UMBC >> PUB >> 603 Spring, 2009 Description: %!PS-Adobe-2.0 %Creator: dvips 5.47 Copyright 1986-91 Radical Eye Software %Title: t603.dvi %Pages: 1 1 %BoundingBox: 0 0 612 792 %EndComments %BeginProcSet: tex.pro /TeXDict 200 dict def TeXDict begin /N /def load def /B{bind def}N /S /exch load def... Date Added: 2009-06-26 03:20:58 |
| Syed.doc Path: Middlebury >> ECON >> 0428 Fall, 2009 Description: Abdur-Rahim Syed 2nd Short Paper EC 428 Horlacher Fall 2001 \"Julian Simon and the Population Growth Debate\" by Dennis A. Ahlburg, \"A Cross-Section Model of Economic Growth\" by Paul M. Sommers and Daniel B. Suits, and \"A Simple Cross-Section Model of... Date Added: 2009-06-26 03:38:45 |
| dcs-turnitin-guide.pdf Path: East Los Angeles College >> COM >> 1070 Fall, 2009 Description: University of Sheffield Department of Computer Science Submitting Your Work Via Turnitin Last Updated: April 17, 2007 1 Creating Your Profile Initial Use Only Before you can use the Turnitin system, you need to create an account and associate you... Date Added: 2009-06-26 04:11:52 |
| 46.txt Path: Grinnell >> CSC >> 153 Spring, 2009 Description: CSC153 2004S, Class 46: Implementing Lists with Nodes, Revisited Admin: * DingDongs * Picnic * No homework yet. Sorry Overview: * Linked lists: Implementing lists with nodes. * Implementing basic methods * Implementing ordered methods * Cool trick... Date Added: 2009-06-26 04:34:25 |
| Ostrom_ch45_1990.pdf Path: Toledo >> EC >> 313 Fall, 2009 Description: ... Date Added: 2009-06-26 04:43:28 |
| proposal.pdf Path: WVU >> CS >> 480 Fall, 2008 Description: Final Proposal Damian Christey, Anthony Fucello II, Younus Khan, Nathaniel Sapp December 4, 2006 Contents 1 Introduction 1.1 Background . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1.1.1 1.1.2 1.2 1.2.1 1.2.2 1.2.3 1.2.4 1.2.5 1.2.6 ... Date Added: 2009-06-26 05:01:18 |
| chapt9.ppt Path: Duke >> X >> 006 Fall, 2009 Description: Using enums to model cards q Consider the declaration below from card.h, simulate playing card class Card { public: enum Suit {spades, hearts, diamonds, clubs}; Card(); Card(int rank, Suit s); / default, ace of spades bool SameSuitAs(const Card& c... Date Added: 2009-06-26 05:26:00 |
| inheritance.ppt Path: Duke >> X >> 006 Fall, 2009 Description: Object oriented programming q q PreOOP Programmer\'s duty to devise and enforce logical groupings of the data types and the functions that operate on them. OOP Functionality is officially and tightly grouped with the type that it operates on. ... Date Added: 2009-06-26 05:26:03 |
| lab1.doc Path: Bergen CC >> CS >> 150 Fall, 2009 Description: University of California at Berkeley College of Engineering Department of Electrical Engineering and Computer Science EECS 150 Spring 2000 Lab 1 Introduction to Xilinx Design Software 1 Objectives In this lab you will learn how to use a schematic c... Date Added: 2009-06-26 05:42:13 |
| EE222Lecture11.pdf Path: Bergen CC >> EE >> 222 Spring, 2009 Description: ... Date Added: 2009-06-26 05:44:17 |
| Study Guide for text - Linear Algebra And Its Applications - David C Lay - 3rd ed.0040 Path: Penn State >> MATH >> 220 Fall, 2008 Description: ... Date Added: 2009-06-28 08:13:56 |
| Study Guide for text - Linear Algebra And Its Applications - David C Lay - 3rd ed.0129 Path: Penn State >> MATH >> 220 Fall, 2008 Description: ... Date Added: 2009-06-28 09:45:30 |
| Study Guide for text - Linear Algebra And Its Applications - David C Lay - 3rd ed.0157 Path: Penn State >> MATH >> 220 Fall, 2008 Description: ... Date Added: 2009-06-28 09:50:05 |
| Blb_Chptthermochem Path: Palomar >> CHEM >> 76251 Fall, 2008 Description: Thermochemistry David P. White University of North Carolina, Wilmington Chapter 5 Copyright 1999, PRENTICE HALL Chapter 5 1 The Nature of Energy Kinetic and Potential Energy From Physics: Force is a push or pull on an object. Work is the product o... Date Added: 2009-06-28 20:53:54 |
| Mari Influence Path: Kaplan University >> ACCT >> Payroll Fall, 2009 Description: I wish I could say there are more positive influences then negative, but I am not sure. One positive influence is church. Church helps you stay off the street and keeps you busy. Also, in church you have people there that support you and want you to ... Date Added: 2009-06-30 16:26:30 |
| chapter 17 - 3 Path: NYU >> PSYCH >> V89.0001 Spring, 2009 Description: ... Date Added: 2009-07-02 18:34:08 |
| iterate Path: Acadia >> HGF >> polo Fall, 2007 Description: ... Date Added: 2009-07-03 18:21:54 |
| Ch3-1a Path: Universidad Nacional de Asuncion >> CEC >> 353 Spring, 2009 Description: ... Date Added: 2009-07-06 15:56:54 |
| quanda07 Path: 東京大学 >> BUS >> BAM303 Spring, 2009 Description: Chapter 7 1. The following information describes the value Lauren Landlord places on having her five houses repainted. She values the repainting of each house at a different amount depending on how badly it needs repainting. a. Plot Lauren Landlord... Date Added: 2009-07-06 22:44:26 |
| quanda14 Path: 東京大学 >> BUS >> BAM303 Spring, 2009 Description: Chapter 14 1. a. Are the following markets likely to be perfectly competitive? Explain. The market for petrol Answer: Yes, many buyers and sellers and the product of different sellers is nearly identical. b. The market for blue jeans Answer: Prob... Date Added: 2009-07-06 22:44:44 |
| topic018.pdf Path: SMU - Cox School of Business >> ENGR >> 8361 Fall, 2009 Description: Helgason EMIS 8361 Spring 2009 [Topic 18] 1 PROJECT SELECTION METHODOLOGY Techniques for Independent Mutually Exclusive Groups of Projects In many cases the atomic projects fall naturally into mutually exclusive groups of projects for which projec... Date Added: 2009-07-08 06:08:09 |
| ch06.ppt Path: CSU Long Beach >> IS >> 300 Fall, 2009 Description: Chapter 6 Supply Chain Management & ERP 1 Learning Objectives Understand the concept of the supply chain, its importance and management. Describe the problems of managing the supply chain and some innovative solutions. Trace the evolution of sof... Date Added: 2009-07-08 06:30:34 |
| L01Introduction.ppt Path: UMBC >> CMSC >> 104 Fall, 2006 Description: CMSC104 Problem Solving and Computer Programming Spring 2009 Sections 0201 & 0301 Ms. Dawn Block Contact Information Who am I? Best way to contact me? Office hours: Email! dblock@umbc.edu Where? ITE 208 Dawn Block When? Tuesday and T... Date Added: 2009-07-08 07:04:42 |
| 5311.A7.WS.Sec.pdf Path: SMU - Cox School of Business >> CSE >> 5311 Fall, 2009 Description: CSE 5311 Foundations of Computing Great Ideas Summer, 2006 Assignment 7 [the last assignment] Answer the following three questions: (1) In your opinion, what are the five most significant great ideas in computing? List the five ideas and then select ... Date Added: 2009-07-08 07:28:00 |
|
|
Get Started With Course Hero Today!
Get study guides, join study groups, and more!
Sign up in seconds with your Facebook account!
Course Hero is a Facebook Application Partner.
Click below to sign-up for FREE.
Our Social Learning Network was built to provide students and key learning partners like professors a platform to share, meet and collaborate while accelerating their comprehension of course-related theories and concepts. We are committed to providing you immediate access to a growing wealth of study materials and an unparalleled academic network of students, professors and other key partners. Why do you care? Because you want the best grade possible and at times need a 24/7 resource that’s responsive to your needs. |
|
What People Are Saying About Course Hero
|
|||
|
|||
|
Explore the benefits of joining Course Hero's social learning network.
|
|||
 |
Get millions of study materials now!Need lecture notes for a missed class or want insightful explanation of the theories and concepts you learn in class? Look no further, Course Hero’s Study Materials empowers you to find a broad and deep set of materials that can help you right now!
Click below to sign-up for FREE.
|
||
 |
Get over 200,000 textbook solutions now!Having difficulty with your homework and need documents that are relevant for your Textbook? Don't be frustrated. Course Hero's Textbook Help presents you study materials from many college courses.
Click below to sign-up for FREE.
|
||
 |
Meet over 300,000 students and your fellow classmates now!Want to meet your current classmates or those that took the class last year? Don’t worry or have anxiety. Course Hero’s Study Groups gives you the seamless opportunity to develop both anonymous or direct relationships with those classmates whom you want to meet and get help from right now!
Click below to sign-up for FREE.
|
||
