Course Solutions And Notes - paulamer-in-ASCII 36
| pipelining1.pdf Path: Alaska Anch >> CS >> 448 Fall, 2009 Description: What is Pipelining? Like an Automobile Assembly Line for Instructions Pipelining Part I CS448 Each step does a little job of processing the instruction Ideally each step operates in parallel Simple Model Instruction Fetch Instruction Decode ... Date Added: 2009-04-23 17:51:18 |
| aci03b1.property.pdf Path: Alaska Anch >> SERIES >> 03 Fall, 2009 Description: ANCHORAGE COMMUNITY INDICATORS A PUBLICATION July 2004 OF THE JUSTICE CENTER Series 3B, No. 1 UNIVERSITY of ALASKA ANCHORAGE An Examination of Police Service Deployment: Serious Property Crime Elmendorf AFB N KN I AR K M Government Hill Down... Date Added: 2009-04-23 17:52:29 |
| sqlunit17example4.doc Path: Alaska Anch >> UNIT >> 17 Fall, 2009 Description: B+-Trees, Example 4 1 B+-Trees, Example 4 assume 3 values and 4 pointers per node insert 3, 8, 6, 9, 15, 20, 4, 25, 30, 13, 11, 7 then delete 20, 7 insert 3, 8, 6: (3, 6, 8) insert 9: (8, _, _) (3, 6, _) insert 15: (8, _, _) (3, 6, _) insert 20: (8... Date Added: 2009-04-23 17:53:27 |
| esm_605_syllabus.pdf Path: Alaska Anch >> ESM >> 605 Fall, 2009 Description: ESM 605 ENGINEERING ECONOMY Spring 2004 Class: To find me: Engr 228 Mondays 6:00-8:45 email: Home: Fax: Secretary: aftge@uaa.alaska.edu or ted1@alaska.net 333-7817 337-2928 786-1900 Dr. Ted Eschenbach Office Hours: M & W 4-5:30 Textbook: Eschenbach,... Date Added: 2009-04-23 17:53:38 |
| cs320ch5answers.doc Path: Alaska Anch >> CS >> 320 Fall, 2009 Description: 1 CS 320 Answers, Ch. 5: CPU Scheduling 1. Maximize CPU usage. 2. CPU bound, I/O bound. 3. CPU burst, I/O wait (burst). 4. High. 5. Ready = ready to be scheduled. Waiting = in the system but not ready to be scheduled due to need for I/O, etc. 6. In t... Date Added: 2009-04-23 17:53:41 |
| 2009.01.26.Introduction.ppt Path: UH Clear Lake >> PSYC >> 4731 Spring, 2008 Description: Introduction PSYC 4731 January 26, 2009 Case Study #1 Ducks study A real study that we need to be able to critically evaluate What do you think-Good study/Bad studywhy? What does it tell us? This is an example of basic science Answering ques... Date Added: 2009-04-23 17:54:17 |
| non-regular.pdf Path: Alaska Anch >> CS >> 351 Fall, 2009 Description: Extra on Regular Languages and Non-Regular Languages CS 351 Decision Properties of Regular Languages Given a (representation, e.g., RE, FA, of a) regular language L, what can we tell about L? Since there are algorithms to convert between any two r... Date Added: 2009-04-23 17:55:05 |
| installation.pdf Path: University of Hawaii - Hilo >> BES >> 3 Fall, 2009 Description: Installation of the BESIII software A. Zhemchugov Dubna BESIIICollaborationMeeting16July2007 What is the goal? Onehavetoinstall CMT LCG(ROOT,BOOST,GSL,CERNLIB,.) Gaudi Moreexternalpackages(BesGDML,EvtGen,fox,MySQL,PostgreSQL, Geant4,XercesC,... Date Added: 2009-04-23 17:55:15 |
| H-U8-L11-Stess_Anx_Music.doc Path: University of Hawaii - Hilo >> UNIT >> 08 Fall, 2009 Description: Lesson # 11-Stress & Anxiety with Music Materials: C.D. or cassette with a variety of songs C.D. or cassette player Folder paper or blank sheet of paper Colored markers, pencils or crayons Handout Take a stress break/relax! Unit 8 Mental Health... Date Added: 2009-04-23 17:59:42 |
| group-participation.doc Path: University of Hawaii - Hilo >> ICS >> 667 Fall, 2009 Description: CONFIDENTIAL ICS 667 Advanced HCI Design Methods Fall, 2003 INDIVIDUAL EFFORT RATING FOR GROUP MEMBERS Adapted by permission from R.M. Felder, 1997 Your Name_ Please write the names of all of your group members, INCLUDING YOURSELF, and rate the de... Date Added: 2009-04-23 18:01:17 |
| GraphsDS.pdf Path: University of Hawaii - Hilo >> ICS >> 311 Fall, 2009 Description: DATA STRUCTURES FOR GRAPHS Edge list Adjacency lists Adjacency matrix E NW 35 DL 247 AA 49 DL 335 AA 1387 AA 523 AA 411 UA 120 AA 903 UA 877 TW 45 BOS LAX DFW JFK MIA ORD SFO V Data Structures for Graphs 1 Data Structures for Graphs A ... Date Added: 2009-04-23 18:01:35 |
| LILT-HCI-Lab-99.pdf Path: University of Hawaii - Hilo >> ICS >> 691 Fall, 2009 Description: LILT Observation Lab Setup December 1999 Experiment PC with Composite Video Output Card The television has a composite video out that is used to route the video signal back to the computer to watch during transcriptions. Sony CCD-TRV65 Hi-8 Camcor... Date Added: 2009-04-23 18:01:51 |
| chap4f.doc Path: University of Hawaii - Hilo >> CCNA >> 2 Fall, 2009 Description: CCND02: Chapter 04: Planning the Address Structure Online Study Guide 4.1 4.1.1 IP Addressing in the LAN Review of IP Addresses 1. What are IP Addresses used for? 2. Can two devices share the same ip address on the internet? Why/why not? 3. convert... Date Added: 2009-04-23 18:02:06 |
| Standard4.pdf Path: UH Clear Lake >> STANDARD >> 4 Fall, 2009 Description: Standard 4: Diversity The School of Education at the University of Houston-Clear Lake is strongly committed to diversity. From actively recruiting candidates and faculty from diverse backgrounds to providing candidates with experiences to help them d... Date Added: 2009-04-23 18:03:19 |
| control_software.ppt Path: University of Hawaii - Hilo >> SCU >> 2 Fall, 2009 Description: Software Plan Basic Software for Data Acquisition of a prototype array test in the dark Deliver by the end of Q3 2002 Overview Current Status Work Plan Deliverables Hardware Picture ADR (DR) Detectors + Superconducting Electronics Detector Bias SQ... Date Added: 2009-04-23 18:04:19 |
| WorkZoneSafetyHilo_2008.pdf Path: University of Hawaii - Hilo >> WORKSHOPS >> 2008 Fall, 2009 Description: http:/hltap.eng.hawaii.edu Workshop sponsored by the: Work Zone Safety University of Hawaii at Hilo Campus Center, Room 301 200 West Kawili Street Hilo, Hawaii March 14, 2008 8:00 a.m. 12:00 p.m. in cooperation with the Hawaii State Department of ... Date Added: 2009-04-23 18:05:48 |
| ip2_f2007_syllabus.doc Path: University of Hawaii - Hilo >> IP >> 2 Fall, 2009 Description: Art258interfaceprogrammingII kcc : new media arts : fall 2006 kopiko 202 : T,Th : 10:45 AM - 1:15 PM instructor: chris gargiulo : office: koa 109 office hours: Th : 7AM-8AM, 4:15 PM - 6:15 PM email: gargiulo@hawaii.edu : coursesyllabus : course info... Date Added: 2009-04-23 18:06:22 |
| a_m02k01.pdf Path: University of Hawaii - Hilo >> NVM >> 4 Fall, 2009 Description: ON THE AGE OF THE NECTARIS BASIN. R. L. Korotev, J. J. Gillis, L. A. Haskin, and B. L. Jolliff, Department of Earth and Planetary Sciences, Washington University, Saint Louis MO 63130 (rlk@levee.wustl.edu) We do not know which, if any, rocks of the A... Date Added: 2009-04-23 18:07:29 |
| pendulum.doc Path: University of Hawaii - Hilo >> PHYS >> 100 Fall, 2009 Description: Date CourseName InstructorName Student(s)Name Pendulum Aswingingpendulumkeepsaveryregularbeat.Itissoregular,infact,thatfor many years the pendulum was the heart of clocks used in astronomical measurementsattheGreenwichObservatory. Therear... Date Added: 2009-04-23 18:07:40 |
| m8-hw08g.txt Path: University of Hawaii - Hilo >> MATH >> 8 Fall, 2009 Description: Read 9.6 - Problems 9.6, page 693 3,6,7,11,19,20,25 - Note this assignment is due on Tuesday, 22 April at 1pm. We will finish section 9.6 on Monday. - Preliminary Exam Results: (48 students have taken the exam thus far) 1) maximum possib... Date Added: 2009-04-23 18:07:53 |
| NormalHist.pdf Path: University of Hawaii - Hilo >> MATH >> 100 Fall, 2008 Description: A (rather contrived) survey of human body heights obtained the following data. Frequency Distribution of HEIGHT Measurements: Height (inches) 46 - 52 52 - 58 58 - 64 64 - 70 70 - 76 76 - 82 82 - 88 88 - 94 Frequency 13 215 1359 3413 3413 1359 215 13... Date Added: 2009-04-23 18:08:17 |
| front_r2.txt Path: Utah >> BIOEN >> 5201 Fall, 2008 Description: 0.000 0.701 0.000 0.000 0.230 1.259 0.094 0.000 0.240 1.063 0.109 0.000 0.766 0.811 0.297 0.000 0.779 1.521 0.297 0.000 1.296 1.566 0.500 0.000 1.308 1.284 0.500 0.000 1.827 1.742 0.703 0.000 1.836 1.505 0.703 0.000 2.364 2.326 0.906 0.000 2.372 1.81... Date Added: 2009-04-23 18:10:07 |
| XM_ServiceLog.txt Path: Utah >> CO >> 2 Fall, 2009 Description: XMission Service Log 070322 - installed last three days. up and running as of 6pm today. using old pressure bomb cylinders while i wait for new cylinders to arrive. 070323 - been watching tank pressure.its decreasing too fast.changed calibration f... Date Added: 2009-04-23 18:13:33 |
| Midterm2-comments.pdf Path: Utah >> BE >> 6000 Fall, 2009 Description: Comments on Midterm #2 Midterm #2 Bioengineering 6000- Systems Physiology Results Average (89) 6 5 4 5 Midterm #1 Midterm #2 4 3 2 1 0 C1 0 C 1 0 C+ 0 BB B+ AA 1 4 3 55 E D D+ CC C+ BB B+ AA 0% 50% 55% 60% 65% 70% 75% 80% 85% 90% 95% 3 2 1 0 M... Date Added: 2009-04-23 18:13:56 |
| Caron-Huot_Simon.pdf Path: Utah >> LAT >> 06 Fall, 2009 Description: Tadpole and Cactus Improvement of the Gluon Condensate of 3D Yang-Mills Theory McGill (Montreal, Canada) Simon Caron-Huot1 1 Department of Physics, McGill University, 3600 University Street, Montreal, Canada H3A 2T8 McGill (Montreal, Canada) ABST... Date Added: 2009-04-23 18:14:03 |
| Ch3-3.3.pdf Path: Utah >> MATH >> 6040 Fall, 2008 Description: 3.3. For this exercise, we need Cantor\'s countable axiom of choice: A countable union of countable sets is itself countable. Let F denote the -algebra generated by all singletons in R. Obviously, {x} F for all x R. It remains to show that [a, b] ... Date Added: 2009-04-23 18:15:59 |
| lab06_1.pdf Path: Utah >> BIOLOGY >> 3315 Fall, 2009 Description: Biology 3315 Comparative Vertebrate Morphology Lab 6: Axial Skeleton 1. Primitive features of the axial skeleton of the cyclostome The notochord is persistent, large, and strong. Vertebral centra are absent. Rudimentary neural arch elements (2 pair... Date Added: 2009-04-23 18:16:05 |
| README.TXT Path: Utah >> SLACKWARE >> 3 Fall, 2009 Description: These are 1.2 MB bootdisk images for Slackware Linux 3.6.0. These disks use Linux kernel version 2.0.35. You\'ll need one of these to get Linux started on your system so that you install it. Because of the possibility of collisions between the various... Date Added: 2009-04-23 18:17:19 |
| exam1pssp06_1220.pdf Path: Utah >> MATH >> 1220 Fall, 2008 Description: Calculus II, Math 1220-90, Spring 2006, Palais Practice Exam 1 Solutions, Chapter 7 Exponentials, Logs, Inverse Functions Show all your work on the exam for full credit. You may use graphing (or regular) calculators. 1. a) (10 points) Simplify: e e 3... Date Added: 2009-04-23 18:17:49 |
| stationlist.txt Path: Utah >> SLC >> 2 Fall, 2009 Description: # Scenario SLC2seg_se: 5/16/2008 16:51:19 GMT, M=7.0, Lat: 40.7600, Lon: -111.8288, Depth: 15.0km, Bias: pga=0.00 pgv=0.00 # Columns: Station Code, latitude, longitude, dist from epicenter (km), network code, Channel 1 Code, PGV (cm/sec), PGA (%g), ... Date Added: 2009-04-23 18:18:12 |
| quiz-09.pdf Path: Utah >> MATH >> 1210 Fall, 2008 Description: MATH CENTER: Students should not receive any help on any exercise on this quiz. Casey Johnson 581-7311. Name: Quiz 9 17 Nov 2006 Write the best answer to each question in the box provided. Show your work. 1. If f (x) = sin x, estimate the area und... Date Added: 2009-04-23 18:19:30 |
| q7s.pdf Path: Utah >> MATH >> 2201 Fall, 2009 Description: ... Date Added: 2009-04-23 18:20:03 |
| layout-cache.txt Path: University of Hawaii - Hilo >> THANOS >> 777 Fall, 2009 Description: Version: 1 Frame: QuestFrame FrameLevel: 22 Anchor: TOPLEFT X: 0 Y: -104 W: 384 H: 512 Frame: LootFrame FrameLevel: 5 Anchor: CENTER X: 127 Y: -19 W: 256 H: 256 Frame: FriendsFrame FrameLevel: 8 Anchor: TOPLEFT X: 0 Y: -104 W: 384 H: 512 Frame: Gossi... Date Added: 2009-04-23 18:20:07 |
| pomeroy.pdf Path: University of Hawaii - Hilo >> OCN >> 621 Fall, 2009 Description: ... Date Added: 2009-04-23 18:20:36 |
| kernel-docs.txt Path: University of Hawaii - Hilo >> SW >> 80 Fall, 2009 Description: Index of Documentation for People Interested in Writing and/or Understanding the Linux Kernel. Juan-Mariano de Goyeneche < jmsey... Date Added: 2009-04-23 18:20:56 |
| README.txt Path: University of Hawaii - Hilo >> ACTIVETCL >> 8 Fall, 2009 Description: CSVop, a tool to manipulate CSV files = Introduction - CSVop is an easy to use application adding a nice interface around the tcllib package handling csv files. Dependencies - The code is setup to use the \'starkit\' package (*) to allow for easy ... Date Added: 2009-04-23 18:20:57 |
| tk_logs.pdf Path: Utah >> CS >> 4500 Spring, 2008 Description: Individual Logs Taeho Kim Week 1: Jan 10 Jan 14 Monday, Jan 10 Class meeting 3:00pm 4:30pm Presentation from sponsors Discussion about the bids Wednesday, Jan 12 Team meeting 3:00pm 5:00pm Discussion about bid Make documents Make webpage ... Date Added: 2009-04-23 18:21:08 |
| test2review.pdf Path: Utah >> PUBLIC >> 1030 Fall, 2009 Description: Test 2 Review N Loan formula PMT = P APR N Savings plan formula A = PMT ( 1 (1+ APR ) )( NY ) (1+ APR )(NY ) N APR N 1 1. Say Dave borrowed 20,000 dollars to open a grocery store. How much does Dave have to pay to pay o the debt in 3 years if t... Date Added: 2009-04-23 18:23:18 |
| lec11_2.pdf Path: Utah >> EE >> 5740 Fall, 2009 Description: Outline c GDM MULTIPLE-LEVEL LOGIC OPTIMIZATION Representations. c Giovanni De Micheli Stanford University Taxonomy of optimization methods: Goals: area/delay. Algorithms: algebraic/Boolean. Rule-based methods. Algebraic methods. Mot... Date Added: 2009-04-23 18:23:30 |
| exam2review.pdf Path: Utah >> ECE >> 2280 Spring, 2008 Description: ECE2280 Re view For EXAM 2 SPRING 2007 The material we have covered so far this semester is summarized (but NOT limited to) below: 1. Understand the basic operation of a MosFet: 3 regions of operation: cutoff, triode, saturation and know all cur... Date Added: 2009-04-23 18:23:44 |
| Potential_application_issues.doc Path: Utah >> PS >> 8 Fall, 2009 Description: Potential application issues in 8.9 Campus Community / LDAP CAMPUS_ID field is populated by our LDAP processes. CAMPUS_ID was in PERSONAL_DATA in 8.0; is in PERSON_SA in 8.9 Documentation implies that PERSON_SA will be created only when a person re... Date Added: 2009-04-23 18:24:53 |
| gnuplot_example.txt Path: University of Hawaii - Hilo >> PHYS >> 480 Fall, 2009 Description: # file test.dat # # format: # x value y value y error 1 2 1 3 4 1 5 6 1 7 8 1 8 6 1 9 4 1 10 2 1 # # set title \"Test Example\" # set xlabel \"Dependent Variable [sec]\" # set ylabel \"Independent Variable [cm]\" # # > Fit to a quadratic function # f(... Date Added: 2009-04-23 18:25:45 |
| assignment02.pdf Path: Utah >> CS >> 2420 Summer, 2008 Description: Solar System Simulator Analysis and Design Peter Jensen Spring 2008 Analysis of Existing Solution Where appropriate, the sub-questions are not answered separately their answers are included in the following discussions. Also note that sometimes I t... Date Added: 2009-04-23 18:28:53 |
| 15-4.pdf Path: Utah >> GG >> 554 Fall, 2009 Description: 15.4 Sensitivity and Magnication of Seismometers: The sensitivity of a seismometer is dened as the ratio of the maximum displacement, m, of the mass to the maximum ground motion, Xm, during steady-state motion. The sensitivity is a measure of magnica... Date Added: 2009-04-23 18:31:01 |
| Sec0.3.pdf Path: Utah >> MATH >> 1090 Fall, 2008 Description: Section 0.3: Integral Exponents Math 1090 Fall 2008 For each of the following problems simplify the given expression using properties of exponents. 1. x-2 2x5 2. (3x2 y 3 )4 3. x-1 z 2 y -4 3y 2 x-3 z 1 4. 2x-2 y x3 3 5. 9x-2 y 3 3z 2 2z -... Date Added: 2009-04-23 18:31:26 |
| FSEC10.31.03.pdf Path: University of Hawaii - Hilo >> MIN >> 0304 Fall, 2009 Description: 10/31/2003 FSEC Minutes Present: Paul Allen, David Cleveland, Femar Lee, Shanon Miho, Ivan Nitta, Pat Patterson, Ramsey Pedersen, Jim Poole, Lisa Yogi, Chris Anne Moore Absent: Lei Lani Hinds Faculty and Staff: Dolores Donovan, Iris McGivern August ... Date Added: 2009-04-23 18:32:14 |
| ObjecQuest.pdf Path: University of Hawaii - Hilo >> SCI >> 122 Fall, 2009 Description: Science 122 Objectives & Questions Here are the objectives for each lesson. Before you begin to study the lesson, take a few minutes to read the objectives and the study questions for each lesson. Look for key words and ideas as you read. Use the stu... Date Added: 2009-04-23 18:35:38 |
| tilp.doc Path: FIU >> INTRO >> 7377 Fall, 2009 Description: Catherine Hernandez March, 2002 Q377: Foundations of Educational Technology Technology Integration Learning Plan Overview: The computing labs that support undergraduate curriculum needs in the School of Computer Science (SCS) at Florida Internation... Date Added: 2009-04-23 18:38:00 |
| Lecture10-Combined-Footings.pdf Path: FIU >> GEO >> 2 Fall, 2009 Description: Foundation Engineering Lecture #10 Combined Footings - Rectangular Footings. - Trapezoidal Footings. - Cantilever or Strap Footings L. Prieto-Portar 2008 A combined footing is usually used to support two columns of unequal loads. In such a case, t... Date Added: 2009-04-23 18:39:00 |
| Fall_2008_Year1-2-3_Course_Matrix_rev10-1-08.pdf Path: FIU >> CHUA >> 2 Fall, 2009 Description: FIU - Anesthesiology Nursing Program - Classes of \'08, \'09, \'10 - Course and Clinical Matrix - FALL Semester 2008 WEEK # Class Year> COURSE> Coordinator Week of MONDAY 3rd YEAR SR.Sem-SIM MONDAY 2nd YEAR BIOSCIENCE II TECHNOLOGY MONDAY 1st YEAR P... Date Added: 2009-04-23 18:40:05 |
| 03_worksheet.pdf Path: FIU >> PCB >> 3043 Fall, 2008 Description: Worksheet 3 - Life tables This worksheet is designed to help you to: i) Understand the type of information provided by life tables. ii) Produce life tables for several populations of animals. Answer/address all of the following questions. In all case... Date Added: 2009-04-23 18:40:16 |
| ENGR5324S04Syllabus_Land.pdf Path: University of Texas-Tyler >> ENGR >> 5324 Fall, 2009 Description: ENGR 5324 ENGINEERING PROJECT MANAGEMENT Spring 2004 Mondays, 6:00 8:40 pm; ENG 128 Text: Project Management: The Managerial Process, 2 nd ed. , Clifford F. Gray and Erik W. Larson, McGraw-Hill, 2003 Day Wk Reading Topic(s) Questions Exercises Cas... Date Added: 2009-04-23 18:41:48 |
| exam1.pdf Path: Tulane >> MATH >> 603 Fall, 2009 Description: Math 603, Spring 2007, Take-home Exam 1 Due Monday, March 26th 1. Let {Yi,j : i, j Z + } be an array of i.i.d. random variables. Consider a branching process where, for l 1, Z0 Z1 Z2 . . . Zn = = = . . . = l Y1,1 + Y1,2 + + Y1,l Y2,1 + Y2,2 + ... Date Added: 2009-04-23 18:43:06 |
| peimix97.doc Path: Ole Miss >> POL >> 324 Fall, 2008 Description: Research Note Citizens v. Mandarins: Administrative Litigation in China* Minxin Pei The Chinese government has, in the last 20 years, devoted enormous political resources and effort to revamping its legal system. The resultant legal reforms, part of ... Date Added: 2009-04-23 18:46:35 |
| IntrusionProject.ppt Path: Lamar >> COSC >> 1172 Fall, 2008 Description: Secure Communication and Intrusion Detection James Hidahl, Josh McCandless, Kyle Ray Focused Topics Secure Communications Intrusion Detection Methods Used by Intruders Secure Communications What is security? Access Codes Stron... Date Added: 2009-04-23 18:47:38 |
| L2-IR.pdf Path: Lamar >> EXE >> 4131 Fall, 2009 Description: CHEM-4131 (BIO) PHYSICAL CHEMISTRY LABORATORY L-2: FTIR DATA ACQUISITION Objective: To develop a feel for the science of data acquisition. Lab Goal: To observe some of the factor that influence IR spectra. Part I: Basic spectral observations Do NOT o... Date Added: 2009-04-23 18:47:52 |
| exam1review.pdf Path: Western Kentucky University >> PSY >> 321 Fall, 2008 Description: In addition to these review questions, the in-class activities are also fair game for exam questions. 1. List and briefly describe four major themes in developmental psychology. 2. Briefly explain the basis of learning theory approaches. 3. Explain t... Date Added: 2009-04-23 18:48:59 |
| Euclid5.pdf Path: E. Kentucky >> MATH >> 409 Fall, 2009 Description: CHAPTER 5 Towards Projective Geometry Most mathematical disciplines encounter infinity and find it necessary to incorporate it into their language. Euclidean geometry is no exception to this rule and this process resulted in the beautiful structure k... Date Added: 2009-04-23 18:50:03 |
| IS Lecture 3 Notes Path: Cornell >> HADM >> 2275 Spring, 2009 Description: Unit of Analysis: Sociotechnical Systems WK2 T Agenda Syllabus quiz Readings Our unit of analysis: Sociotechnical systems What is the role of IT in society? Technological Determinism: technology makes intended social changes occur Social s... Date Added: 2009-04-23 18:50:28 |
| OpenGLPhong.pdf Path: E. Kentucky >> EECS >> 672 Fall, 2009 Description: OpenGL\'s Implementation of the Phong Local Lighting Model At a Point, P, on a Surface I = E + ka *La + 6 where fatt;i = \' ) ) ) ) ) ( ) ) ) ) ) * n51 i=0 ^ \' L + k *\"$ r !v\' L ^ fatt;i si kd * n! li d;i s $ ^i ^ \' s;i \' . 0( 0* 0* / 0* 0* )... Date Added: 2009-04-23 18:50:39 |
| RegularExpressions.pdf Path: E. Kentucky >> EECS >> 368 Fall, 2009 Description: EECS 368 Assignment 4 Regular Expressions & Perl (50 points) Due: February 22, 2008 (Friday) This program is a short exercise in using regular expressions with substitution and matching to alter the format of an input text file. The input text cons... Date Added: 2009-04-23 18:51:12 |
| american_decades_1990-1999.pdf Path: E. Kentucky >> HISTORY >> 1990 Fall, 2009 Description: ... Date Added: 2009-04-23 18:51:35 |
| math109q6.pdf Path: E. Kentucky >> MATH >> 109 Fall, 2009 Description: Math 109 Quiz VI Fall 2008 Name: Show your work for full credit. Please circle your answer. 1. Are the following fractions equal? Explian. 3 20 = 12 84 2. Rewrite in simplest form. 480 672 3. Find the dierence between 11 3 and 6 5 . 7 7 1 4. F... Date Added: 2009-04-23 18:51:41 |
| nov26.124-nov26.138.echogram.pdf Path: E. Kentucky >> NOV >> 26 Fall, 2009 Description: nov26.124nov26.138 0 100 200 300 400 Range Bins 500 600 700 800 900 1000 200 69.582S 64.987W 26.44 km 0 100 300 69.692S 64.912W 38.97 km 400 69.806S 64.833W 52.11 km 500 69.921S 64.761W 65.15 km 600 70.033S 64.686W 77.98 km 700 70.... Date Added: 2009-04-23 18:52:19 |
| 2007REGISTRATIONFORM.pdf Path: E. Kentucky >> CONF >> 2007 Fall, 2009 Description: REGISTRATION FORM LAST NAME MD RN RD PT SEPTEMBER 13-14, 2007 FIRST NAME OT DEADLINE DATE: AUGUST 28, 2007 MI Other (please specify) ADDRESS CITY DAYTIME PHONE ORGANIZATION/COMPANY Please mark this space if you need special accommodations, and a ... Date Added: 2009-04-23 18:53:56 |
| lab1introduction.pdf Path: University of Montana >> BIOL >> 403 Fall, 2008 Description: Functional Comparative Anatomy Syallabus Brandon Jackson, 243-6834, brandon.jackson@mso.umt.edu Office Hours will be during open lab and by appointment. Text: Homberger & Walker, 2004, Vertebrate Dissection Ninth Edition. There are also numerous web... Date Added: 2009-04-23 18:54:01 |
| Bosak_CV2.pdf Path: University of Montana >> CAS >> 1123 Fall, 2009 Description: Curriculum Vitae KEITH BOSAK Assistant Professor of Nature-Based Tourism Department of Society and Conservation College of Forestry and Conservation University of Montana, Missoula, MT 59812 Office: 406.243.6062 Cell: 706.224.8804 Keith.bosak@umontan... Date Added: 2009-04-23 18:54:41 |
| 10.Forecasting.Theory.pdf Path: E. Kentucky >> POLS >> 972 Fall, 2009 Description: Political Science 972: International Conflict Discussion Questions for Week 10 Forecasting: Theory 1. Assess the relative importance of strategic surprise and deception (situations where an opponent has gone to extraordinary rather than routine measu... Date Added: 2009-04-23 18:55:40 |
| syllabus382.pdf Path: SIU Edwardsville >> ECE >> 382 Fall, 2009 Description: ECE 382 SIUE, Summer 2003 Course denition Digital Systems Design Syllabus 382-4 DIGITAL SYSTEMS DESIGN. Concepts and design of digital and computer circuitry; binary number systems; study of microprocessors and assembly language programming. Labora... Date Added: 2009-04-23 18:57:30 |
| studio.pdf Path: SIU Edwardsville >> ECE >> 382 Fall, 2009 Description: Verilog Studio Andy G. Lozowski Electrical and Computer Engineering Department Southern Illinois University at Edwardsville August 12, 2003 By popular demand, the material covered in SIUEs course ECE 382 Digital Systems Design was expanded to include... Date Added: 2009-04-23 18:57:31 |
| SPSS_R_DEMO.pdf Path: University of Montana >> MATH >> 447 Fall, 2008 Description: Erik Leigh of our MA 447 class provides this information below, which, in summary, reads in SPSS information into R and performs the work we wanted done for HW # 10.in SPSS. He did this because he has R free at his home computer and didnt want to go ... Date Added: 2009-04-23 18:57:43 |
| S00Ex4Key.pdf Path: Kentucky >> CHE >> 230 Fall, 2008 Description: CHE 230 Organic Chemistry Exam 4, May 4, 2000 Name KEY Student ID No. Before you begin this exam: First: You are allowed to have a calculator and a simple model set at your seat. Please put away all other materials. Second: Place your student ident... Date Added: 2009-04-23 19:00:09 |
| pr_2_page_158.pdf Path: Kentucky >> MA >> 551 Fall, 2008 Description: [Munkres, Problem 2, page 158] Problem. Let f : S 1 R be a continuous map. Show there exists a point x of S 1 such that f (x) = f (x). Solution: First notice that the map h : R S 1 given by h(t) = (cos t, sin t) is continuous and surjective. Theref... Date Added: 2009-04-23 19:00:43 |
| id101.pdf Path: Kentucky >> ID >> 101 Fall, 2009 Description: C O O P E RATI V E E X T E N S I O N S E RV I C E U N I V E R S I T Y OF K E N T U C K Y C O L L E G E O F A G R I C U L T U R E ID-101 INTERPRETING FORAGE QUALITY REPORTS Jimmy C. Henning, Garry D. Lacefield, and Donna Amaral-Phillips* To be usefu... Date Added: 2009-04-23 19:01:17 |
| Poster_CommentsHandout.pdf Path: Kentucky >> MA >> 330 Fall, 2008 Description: MA 330, SPRING 2008 COMMENTS ON COURSE POSTER Please keep the following comments in mind as you work on your course poster. (1) Your poster should have all content on one side and contain the following information: Your Name MA 330, Spring 2008 Title... Date Added: 2009-04-23 19:02:30 |
| Kids_Korner_February_2009.pdf Path: Kentucky >> CES >> 2 Fall, 2009 Description: LEXINGTON. KY 40546 Cooperative Extension Service Taylor County 1143 South Columbia Ave. Campbellsville KY 42718 Phone: (270) 465-4511 (270) 789-2455 Fax: Kids Korner-February 2009 E-Mail: DL_CES_taylor@email.uky.edu Abraham Lincoln, 16th Presid... Date Added: 2009-04-23 19:02:59 |
| exam1prob4.txt Path: Kentucky >> STA >> 705 Fall, 2008 Description: #Problem 4 prob4datamat=matrix(0,nrow=30,ncol=10) #each row arises from the same lambda prob4datamat[1,]=c(1,2,0,2,0,0,2,0,0,0) prob4datamat[2,]=c(1,2,1,0,2,0,1,0,0,1) prob4datamat[3,]=c(1,2,3,2,2,1,3,1,1,1) prob4datamat[4,]=c(2,0,2,0,3,1,2,2,0,1)... Date Added: 2009-04-23 19:03:27 |
| 538.F05.21.pdf Path: Kentucky >> CHE >> 538 Fall, 2008 Description: Principles of Organic Chemistry The Relationship between Kinetics and Thermodynamics 1. The difference? 1.1. Kinetics is a focus on rates of processes. 1.2. Thermodynamics is a focus on stability of constituents of a dynamic system. 1.2.1. 1.2.2. 2. ... Date Added: 2009-04-23 19:03:45 |
| RubricLab6.pdf Path: Central Washington University >> CS >> 101 Fall, 2009 Description: Lab6 StudentsemailedyouListeningSkillspaper.Gradeduringclassandovertheweekend. PleasehavesenttomebyMondaynight. GradeinLab: Checknotesforquality3 SBRuptodate NDuptodate Studentsareworkingquiet... Date Added: 2009-04-23 19:05:03 |
| 2006_538_exam1.midterm.key.pdf Path: Kentucky >> CHE >> 538 Fall, 2008 Description: Page 2 id#_ CHE538 Midterm Exam, Principles of Organic Chemistry Fall 2006 Warning: write/print neatly! If I cant read it you dont get credit. 1. (10 pts.) In chemical reactions associations/relationships between nuclei change. For example A-B + C -... Date Added: 2009-04-23 19:11:05 |
| exam2.pdf Path: Ill. Chicago >> M >> 310 Fall, 2009 Description: Math 310 Exam 2 Name: November 9, 2001 Answer all 5 questions completely. You must show all work to receive credit. If you use a calculator, please write calculator calculation where it was used. Try to check your solutions. 1. Given the transformat... Date Added: 2009-04-23 19:12:11 |
| hivaids.pdf Path: Ill. Chicago >> HEALTHVIEW >> 01 Fall, 2009 Description: CHICAGO HIV/AIDS OUTREACH INTERVENTION I N I T I AT I V E R E A C H E S O U T TO ASIA T he School of Public Healths Community Outreach Intervention Projects (COIP) was founded by the Epidemiology and Biostatistics Divisions Wayne Wiebel, PhD, in ... Date Added: 2009-04-23 19:12:40 |
| structure.pdf Path: Ill. Chicago >> PSYCH >> 303 Fall, 2009 Description: Structure of the Writing Model (adapted from Hayes and Flower, 1980) Task Environment Writing Assignment Topic Audience Text Produced So Far Writers Long Term Memory Knowledge of Topics Knowledge of Audience Stored Writing Plans Knowledge of Sour... Date Added: 2009-04-23 19:13:38 |
| Exam1.pdf Path: Ill. Chicago >> MTHT >> 467 Fall, 2008 Description: First Exam MTHT 467 Spring Semester, 2005 Instructions: You may consult your journal or my handouts when writing your answers. Write everything in the answer book. Clarity is important . . . this includes legibility and grammatical correctness. 1. Yo... Date Added: 2009-04-23 19:13:46 |
| aec42.pdf Path: Kentucky >> AEC >> 42 Fall, 2009 Description: AEC-42 Agricultural Cooperatives How They Fit In The American Free Enterprise System Lionel Williamson In the American free enterprise system businesses are classified into three broad categories: individually owned, partnerships, and corporations.... Date Added: 2009-04-23 19:13:55 |
| Fowler.pdf Path: Kentucky >> CAPSTONES >> 2006 Fall, 2009 Description: A Retrospective Analysis of the Impact of the Henry Toll Fellowship Leadership Development Program Capstone in Public Administration Lizeth C. Fowler April 13, 2006 Table of Contents EXECUTIVE SUMMARY 1 PROBLEM STATEMENT. 2 Background. 3 Program De... Date Added: 2009-04-23 19:14:08 |
| Exam2ReviewF07.pdf Path: Kentucky >> BIO >> 325 Fall, 2008 Description: Review Exam II Fall 2007 Amanda Ensminger Materials for studying Your lecture notes Your homework and quizzes Your notes from today Materials on Dr. Sargent\'s website \"Population Biology Resources\" \"Populus \" \"Old Exam 2\" \"Review for Exam 2\"... Date Added: 2009-04-23 19:14:40 |
| PHI_565_Donnellan.pdf Path: Kentucky >> CEBATT >> 2 Fall, 2009 Description: Philosophy 565 Prof. Clare Batty Donnellan, Reference and Definite Descriptions 1. Donnellans Target September 23, 2008 Donnellan distinguishes between two uses of definite descriptions: the attributive use and the referential use. Both kinds of us... Date Added: 2009-04-23 19:16:15 |
| analysis_of_leadership_skills.pdf Path: S.E. Louisiana >> ETEC >> 660 Fall, 2008 Description: Stacey H. Magee September 26, 2005 ETEC 660.Leadership for Change ASSIGNMENT: Analysis of Personal Leadership Skills As I prepared to write a profile on my personal leadership skills, I was very skeptical that I would find that I was more of a manag... Date Added: 2009-04-23 19:16:32 |
| 25.GraphsDS.pdf Path: McGill >> CS >> 250 Fall, 2009 Description: DATA STRUCTURES FOR GRAPHS Edge list Adjacency lists Adjacency matrix E NW 35 DL 247 AA 49 DL 335 AA 1387 AA 523 AA 411 UA 120 AA 903 UA 877 TW 45 BOS LAX DFW JFK MIA ORD SFO V Data Structures for Graphs 1 Data Structures for Graphs A ... Date Added: 2009-04-23 19:17:39 |
| lec3-1.6page.pdf Path: Berkeley >> CS >> 152 Spring, 2008 Description: IEEE JOURNAL OF SOLID-STATE CIRCUITS, VOL. 36, NO. 11, NOVEMBER 2 A B Vout . . . Combinational Logic Cell Cout Delay Va -> Vout X X X X X X D Q Clk Setup D Dont Care Hold !\"#$%\'&+,-+.\'*/# delay per unit load... Date Added: 2009-04-23 19:18:05 |
| lec3-1.6page.pdf Path: Berkeley >> EECS >> 152 Fall, 2004 Description: IEEE JOURNAL OF SOLID-STATE CIRCUITS, VOL. 36, NO. 11, NOVEMBER 2 A B Vout . . . Combinational Logic Cell Cout Delay Va -> Vout X X X X X X D Q Clk Setup D Dont Care Hold !\"#$%\'&+,-+.\'*/# delay per unit load... Date Added: 2009-04-23 19:18:05 |
| IntRevForProfCalcII.pdf Path: University of Texas-Tyler >> CALCULUS >> 2 Fall, 2009 Description: Integration Review All of these occur as parts of larger problems on the prociency tests. Some just use formulae while others use w-substitution and trig identities. Hints: 7 and 8 use half-angle identities before integrating and double angle after ... Date Added: 2009-04-23 19:19:45 |
| nurrn.pdf Path: Kentucky >> MS >> 0102 Fall, 2009 Description: University of Kentucky College of Nursing Nursing (RN) Admission Requirements The College of Nursing enrollment is composed of four-year students, associate degree nursing graduates, and diploma nursing school graduates. Admission to the Universit... Date Added: 2009-04-23 19:21:53 |
| repsonse paper 15 Path: BC >> EN >> EN010 Fall, 2007 Description: November 29, 2007 Sifting Through the Embers, Douglas Adams The Story of the Sybilline Books, Continued. Matt Doherty Response Paper #15 After the townspeople had finished reading the final book (only one twelfth of the all the world\'s knowledge an... Date Added: 2009-04-23 19:21:58 |
| BillEarle_wfd3.pdf Path: BU >> G >> 2 Fall, 2009 Description: 125 MHZ CH 1 250 MHZ D CLK Q Q DCM 0 90 MUX 0/180 125 MHZ 180 Select 125 MHZ D CH 2 250 MHZ CLK Q 180 Select 125 MHZ D CH 3 250 MHZ CLK Q 180 Select 125 MHZ D CH 4 250 MHZ CLK Q 180 Select 125 MHz clocks for four channels can be set to the same pha... Date Added: 2009-04-23 19:23:22 |
| RotDynCk.pdf Path: BU >> PY >> 105 Fall, 2009 Description: Physics Workshop Rotational Dynamics Suggested Checkpoint Questions with Answers Checkpoint following 1(c): 1. Can you describe the analogy between Newtons 2nd Law ( F = ma) and the torque equation ( = I )? 2. Why is it harder to do sit-ups with yo... Date Added: 2009-04-23 19:26:38 |
| 003.pdf Path: BU >> ELBAZ >> 1 Fall, 2009 Description: ... Date Added: 2009-04-23 19:27:47 |
| notes9-11.pdf Path: BU >> CS >> 538 Fall, 2009 Description: BU CAS CS 538: Cryptography Lecture Notes. Fall 2005. http:/www.cs.bu.edu/~itkis/538/ Gene Itkis Boston University Computer Science Dept. 1 Public Key vs. Symmetric Encryption In the encryption we\'ve been doing so far, the sender and the recipient... Date Added: 2009-04-23 19:28:38 |
| Dual.ppt Path: BU >> CS >> 113 Fall, 2009 Description: Constructing dual of a function f g : dual of f x1 x2 xk f Start with f(x1,x2, .,xk) Negate all inputs Negate the output Resulting function g is the dual of f f is self-dual if g=f Negation gate: x x ... Date Added: 2009-04-23 19:28:39 |
| 11_Managerial_and_Reg_SG.pdf Path: BU >> DCC >> 2 Fall, 2009 Description: Session Guide Managerial and Regulatory Strategies to Improve Drug Use MANAGERIAL AND REGULATORY STRATEGIES SESSION GUIDE Managerial and Regulatory Strategies to Improve Drug Use SESSION GUIDE PURPOSE AND CONTENT Educational approaches to promotin... Date Added: 2009-04-23 19:29:04 |
| lx522f04-7b-subjsobjs.pdf Path: BU >> LX >> 522 Fall, 2009 Description: CAS LX 522 Syntax I Episode 7b. Subjects, agreement, and case 6.1-6.3 Historical interlude Back in the old days, people hypothesized that Pat will eat lunch had a structure like this. IP I I will VP V NP eat lunch NP The subject NP Pat was in t... Date Added: 2009-04-23 19:29:51 |
| bennettc19926c731103.pdf Path: BU >> PM >> 1 Fall, 2009 Description: ... Date Added: 2009-04-23 19:30:15 |
| Ch4.pdf Path: Pittsburgh >> ENGR >> 2141 Fall, 2009 Description: Behavioral Hardware Description Languages Behavioral Hardware Description Languages ! ! ! ! ! ! Behavioral vs. RTL Thinking Gotta have style Structure of Behavioral Code Data Abstraction HDL Parallel Engine Verilog Portability Issues Behavioral vs... Date Added: 2009-04-23 19:31:07 |
| landauer1994736d746d.pdf Path: BU >> PM >> 1 Fall, 2009 Description: ... Date Added: 2009-04-23 19:32:26 |
| m220mt2sample3.pdf Path: Pittsburgh >> MATH >> 220 Spring, 2008 Description: MATH 220 Midterm II Sample 3 1) A rocket is being lauched from a pad 3000 feet from a ground level platform where a camera is lming the event. The rocket rises vertically, with its height described by the position function s(t) = 40t2 , if s is measu... Date Added: 2009-04-23 19:33:08 |
| 03-sol.pdf Path: BU >> CS >> 235 Fall, 2009 Description: Fall 2005 CS235 Algebraic Algorithms Homework 3 H OMEWORK 3, DUE O CT 4 You must prove your answer to every question. Problem 1. (10) We have seen in class that if gcd(a, b) = 1 then there is a pair (r 0 , s0 ) of integers with the property ar... Date Added: 2009-04-23 19:33:31 |
| atoms.pdf Path: Pittsburgh >> A >> 0113 Fall, 2009 Description: The task is, not so much to see what no one has yet seen, but to think what nobody has yet thought, about that which everybody sees. (Schrdinger) o The Atom Rutherford: Primordia Quaerere Rerum (To Seek the Nature of Things) It is given to but fe... Date Added: 2009-04-23 19:34:57 |
| Communicative_Citizen.pdf Path: Pittsburgh >> EXP >> 129 Fall, 2009 Description: Libri, 2005, vol. 55, pp. 7483 Printed in Germany All rights reserved Copyright Saur 2005 Libri ISSN 0024-2667 Libraries and the Communicative Citizen in the Twenty-rst Century William F. Birdsall Library Consultant, Bedford, Nova Scotia, Canada M... Date Added: 2009-04-23 19:37:17 |
| Nathan.pdf Path: Pittsburgh >> IS >> 2620 Spring, 2009 Description: Preserving Privacy in Environments with Location-Based Applications Nathan Sulinski Introduction The increase in location-based applications makes protecting personal location information a major challenge. Addressing this challenge requires a mech... Date Added: 2009-04-23 19:37:24 |
| hw1.pdf Path: Pittsburgh >> CS >> 1566 Fall, 2008 Description: CS1566 Assignment 1 Basic 2D Shapes and Interaction Out: Thu 01/10. Due: Tue 01/22 11:59pm 1 Overview In this assignment you will learn the basics of OpenGL and GLUT drawing and interaction. You will create a window, draw various 2D shapes using v... Date Added: 2009-04-23 19:38:21 |
| bionarrative.pdf Path: CSU Sacramento >> IMET >> 5 Fall, 2009 Description: Biographical Narrative Beginning Intriguing anecdote about subject Necessary background information Hint at subjects significance Middle Notes on first anecdote Notes on second anecdote Notes on third anecdote Hint at controlling impression End ... Date Added: 2009-04-23 19:40:21 |
| FOEAgenda.pdf Path: CSU Sacramento >> IMET >> 5 Fall, 2009 Description: STATE OF CALIFORNIA AIR RESOURCES BOARD FUNDAMENTALS OF ENFORCEMENT Embassy Suites Seaside, California October 7 - 9, 2003 Agenda Tuesday October 7, 2003 8:00 am 8:15 am 8:30 am 8:45 am 9:45 am 10:00 am 10:30 am 11:00 am 12:00 noon 1:00 pm 1:30 pm ... Date Added: 2009-04-23 19:40:37 |
| PredLogPracticeInvalidEnglishInterPractice1.doc Path: CSU Sacramento >> PHIL >> 60 Fall, 2009 Description: PREDICATE LOGIC EXERCISE: PROVING INVALIDITY VIA ENGLISH INTERPRETATION Use the method of analogy or English interpretation to prove that each of the following arguments is INVALID (i.e. making the premise(s) true and the conclusion false). Example 1... Date Added: 2009-04-23 19:41:09 |
| HO_EEE166_Chapter_05_Lecture.pdf Path: CSU Sacramento >> EEE >> 166 Fall, 2008 Description: Chapter 5 Preview Chapter 5 Carrier Transport Phenomena The net flow of the electrons and holes in a semiconductor will generate currents. The process by which these charged particles move is called transport. In this chapter we will consider the tw... Date Added: 2009-04-23 19:41:14 |
| EukaryoticCell.pdf Path: CSU Sacramento >> IMET >> 11 Fall, 2009 Description: Plant & Animal Cells Eukaryotic Cells Plant Cell Animal Cell ... Date Added: 2009-04-23 19:43:01 |
| recruitingdetails_06.pdf Path: Pittsburgh >> GK >> 12 Fall, 2009 Description: http:/chemed.chem.pitt.edu/gk-12 GK-12 Graduate Fellows Program The Pittsburgh Partnership for ENERGIZing Science in Urban Schools Goal To provide stipends and associated training to enable highly qualified and motivated graduate students and advanc... Date Added: 2009-04-23 19:43:22 |
| Hw1-sol.pdf Path: Georgia Tech >> SHANGHAI >> 08 Fall, 2009 Description: ISyE 6201: Manufacturing Systems Instructor: Spyros Reveliotis Solutions to Homework 1 A. Chapter 2, Problem 4. (a) D = 60 units/wk 52 wk/yr = 3120 units/yr h = ic = 0.25/yr $0.02 = $0.005/ yr A = $12 2AD 2 12 3120 Q = = = 3869.88 3870 h 0.005 Th... Date Added: 2009-04-23 19:46:36 |
| VoIP.pdf Path: Georgia Tech >> ECE >> 4112 Fall, 2008 Description: VoIP Vulnerabilities Laboratory Group 7 Patrick Hamilton James Michaels Background VoIP (Voice over Internet Protocol) Routing of voice conversations over an IP-based network VoIP Components: Codec converts analog voice to digital data and com... Date Added: 2009-04-23 19:49:25 |
| twoway12-9-00.pdf Path: Georgia Tech >> MA >> 3720 Fall, 2009 Description: Example . Consider the following data in which there are two factors. See example 11.7, page 452, Devore 5th ed. for a complete explanation of this study conducted to assess the effects of density of planting and variety type on the yield of Tomato p... Date Added: 2009-04-23 19:49:28 |
| AE4131-midterm-soln-sp05.pdf Path: Georgia Tech >> AE >> 4131 Fall, 2008 Description: School of Aerospace Engineering GEORGIA INSTITUTE OF TECHNOLOGY AE4131 Midterm Exam (closed book & notes) Craig Sp05 1. Consider the simple 2D truss made up of 2 bars of length, L, as shown below: a. develop element stiffness matrices for each truss... Date Added: 2009-04-23 19:52:05 |
| Sample-Exam-1.pdf Path: Georgia Tech >> ECE >> 3055 Fall, 2008 Description: ECE 3055 Sample Exam I 1 Consider the execution of the following block of SPIM code. The text segment starts at 0x00400000 and that the data segment starts at 0x10010000.Note that some instructions may be pseudoinstructions. start: str: end: .data .... Date Added: 2009-04-23 19:56:14 |
| hung_cheng-huang_200312_phd.pdf Path: Georgia Tech >> ETD >> 04082004 Fall, 2009 Description: ... Date Added: 2009-04-23 19:57:11 |
| 4.3-MaxMin.pdf Path: Georgia Tech >> MATH >> 1501 Fall, 2008 Description: Math 1501: 4.3: Local Extreme Values Math 1501: 4.3: Local Extreme Values Second Derivative Test Math 1501: 4.3: Local Extreme Values Theorem Suppose that f has two continuous derivatives, f (c) = 0 and f (c) exists. If f (c) > 0 then c is a loca... Date Added: 2009-04-23 19:57:46 |
| begin2.pdf Path: Georgia Tech >> MATH >> 4348 Fall, 2008 Description: 1 Preface TABLE OF CONTENTS AN INTRODUCTION TO THE PROBLEMS OF GREEN\'S FUNCTIONS CHAPTER I: INTEGRAL EQUATIONS Section 1.1 Geometry inL2 [0,1] and Linear Functions Section 1.2 The Fredholm Alternative Theorems Section 1.3 Solving Y = KY + f where K h... Date Added: 2009-04-23 19:57:58 |
| hilimire_matthew_r_200805_mast.pdf Path: Georgia Tech >> ETD >> 03262008 Fall, 2009 Description: AN EMOTIONAL BIAS IN PROCESSING FACIAL EXPRESSIONS: SIMILARITIES AND DIFFERENCES ACROSS AGE A Thesis Presented to The Academic Faculty by Matthew R. Hilimire In Partial Fulfillment of the Requirements for the Degree Master of Science in the Schoo... Date Added: 2009-04-23 20:01:02 |
| 26.finalreview.pdf Path: Georgia Tech >> CS >> 2003 Fall, 2009 Description: DB26 FinalReview CS 4420 Database System Implementation Final Review Ling Liu Associate Professor College of Computing, Georgia Tech 1 DB26 FinalReview Final Coverage Chapter 1 Chapter 2 Section 2.1 to 2.4 Chapter 3 Section 3.1 to 3.5 Chapter... Date Added: 2009-04-23 20:01:07 |
| ExampleQ1S.pdf Path: Georgia Tech >> CS >> 6290 Fall, 2008 Description: Midterm Quiz Solutions Name_GTid#_ CS 4290/6290: High-Performance Computer Architecture Spring 2004 Midterm Quiz This is a closed-book exam. There are 6 problems on this quiz and the maximum total number of points is 40. Write your answers in the sp... Date Added: 2009-04-23 20:01:34 |
| tsodyks_pnas_1997.pdf Path: Pittsburgh >> MATH >> 3375 Fall, 2008 Description: The neural code between neocortical pyramidal neurons depends on neurotransmitter release probability Misha V. Tsodyks, and Henry Markram PNAS 1997;94;719-723 doi:10.1073/pnas.94.2.719 This information is current as of March 2007. Online Information ... Date Added: 2009-04-23 20:02:29 |
| 6400_Twyef.ppt Path: Georgia Tech >> CS >> 6400 Fall, 2008 Description: Testing of Database Applications Isabel Twyeffort Testing Intuitive idea: checking program on specific inputs Requires a set of test inputs and expected results Test inputs must be limited by test criteria Testing DB Applications Test inputs mu... Date Added: 2009-04-23 20:03:13 |
| mcclain_lewis_r_200705_mast.pdf Path: Georgia Tech >> ETD >> 04062007 Fall, 2009 Description: DESIGN-BUILD INTEROPERABILITY AND CONCEPTUAL DESIGN AND DEVELOPMENT OF A DESIGN-BUILD MANAGEMENT CONTROL SYSTEM A Thesis Present to The Academic Faculty By Lewis R. McClain In Partial Fulfillment Of the Requirements for Degree Master of Science i... Date Added: 2009-04-23 20:04:35 |
| ICM3.doc Path: UGA >> EDIT >> 6170 Fall, 2008 Description: Deborah Stanley EDIT 6170 Summer 2000 Instructional Curriculum Map for Lesson One: Student is aware that information on the Web can have both positive and negative characteristics and is familiar with the main criteria for evaluating Web sites. F... Date Added: 2009-04-23 20:07:49 |
| 030.pdf Path: UGA >> PANDORA >> 1887 Fall, 2009 Description: IO8 THE PANDORA. Athens, since 1801, had grown into a village of perhaps five hundred inhabitants. In these early days of the existence of the University, the students roomed in the college building, and took their meals at a Steward\'s hall kept fo... Date Added: 2009-04-23 20:08:09 |
| 222.pdf Path: UGA >> CWT >> 33 Fall, 2009 Description: Plant and Soil 190: 19-28, 1997. 1997 Kluwer Academic Publishers. Printed in the Netherlands. 19 Soil respiration response to three years of elevated CC>2 and N fertilization in ponderosa pine (Pinus ponderosa Doug, ex Laws.) James M. Vose1, Kathe... Date Added: 2009-04-23 20:18:19 |
| 2292.pdf Path: UGA >> CWT >> 33 Fall, 2009 Description: Forest Ecology and Management 220 (2005) 300312 www.elsevier.com/locate/foreco Long-term changes in forest oor processes in southern Appalachian forests Jennifer D. Knoepp a,*, Barbara C. Reynolds b, D.A. Crossley c, Wayne T. Swank a a USDA Forest ... Date Added: 2009-04-23 20:19:51 |
| PRB35326.pdf Path: Georgia Tech >> PH >> 274 Fall, 2009 Description: PHYSICAL REVIEW B 68, 035326 2003 Two-dimensional quantum dots in high magnetic elds: Rotating-electron-molecule versus composite-fermion approach Constantine Yannouleas* and Uzi Landman School of Physics, Georgia Institute of Technology, Atlanta, G... Date Added: 2009-04-23 20:20:07 |
| SaakPeterson2007.pdf Path: Texas A&M >> AGEC >> 677 Fall, 2008 Description: ARTICLE IN PRESS Journal of Environmental Economics and Management 54 (2007) 214228 www.elsevier.com/locate/jeem Groundwater use under incomplete information Alexander E. Saaka, Jeffrey M. Petersonb a b Department of Agricultural Economics, Kansas... Date Added: 2009-04-23 20:22:09 |
| 2_23.pdf Path: Minnesota >> CHEM >> 2301 Summer, 2008 Description: 2nd Order Nucleophilic Substitution (SN2) H HO H C H H nucleophile electrophile + Br HO C H H + Br product leaving group 2nd Order because two molecules involved in rate expression: rate = k[OH-][CH3Br] Nucleophile-Electrophile Combination... Date Added: 2009-04-23 20:23:43 |
| FinalThesisPaper.pdf Path: Virginia Tech >> ETD >> 06282002 Fall, 2009 Description: EFFECTS OF DIFFERENCES IN DIETARY PROTEIN AND VARYING THE INTERVAL FROM COLLECTION OF BOVINE EMBRYOS TO FREEZING ON EMBRYO QUALITY AND VIABILITY by FRANK DEAN JOUSAN Thesis submitted to the Faculty of the Virginia Polytechnic Institute and State Univ... Date Added: 2009-04-23 20:24:17 |
| confidence.pdf Path: Yale >> HL >> 284 Fall, 2009 Description: JASA jasa v.2004/12/09 Prn:7/11/2005; 9:26 F:jasatm04009r2.tex; (Lina) p. 1 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 On ... Date Added: 2009-04-23 20:25:00 |
| 04.1990.04Grant.pdf Path: Yale >> GEOLOGY >> 1990 Fall, 2009 Description: ... Date Added: 2009-04-23 20:25:47 |
| Assignment1Solutions.pdf Path: Cal Poly Pomona >> MATH >> 04747 Fall, 2009 Description: Math 107. Rumbos Solutions to Assignment #1 1 3 1. Let v1 = 2 and v2 = 5 . 2 4 Spring 2009 1 (a) Give the parametric equations of the line through the point P : (0, 4, 7) in the direction of the vector v1 . (b) Give the equation of the plane... Date Added: 2009-04-23 20:27:57 |
| HD_Skprf_Fstnrs_Intro_Presentation_Wi08-Sp08.pdf Path: Ohio State >> ME >> 565 Fall, 2009 Description: Capstone Design Project Chris Crane Ricky Dehner Peter Guindon Ben Haushalter Angela Meier Background Information Project Definition Goals and Objectives Budget and Planned Expenses Timeline and Phases Potential Problems Future Activity Individual R... Date Added: 2009-04-23 20:30:13 |
| leej77040.pdf Path: Texas >> LEEJ >> 77040 Fall, 2009 Description: Copyright by Jong Jin Lee 2005 The Dissertation Committee for Jong Jin Lee Certifies that this is the approved version of the following dissertation: A Study On The Nanocrystal Floating-gate Nonvolatile Memory Committee: Dim-Lee Kwong, Supervisor... Date Added: 2009-04-23 20:30:28 |
| BOV%20Mtg%20October%203,%202007%20Final.doc Path: George Mason >> DOCUMENT >> 26293 Fall, 2009 Description: LAND USE AND PHYSICAL FACILITIES COMMITTEE BOARD OF VISITORS Wednesday, October 3, 2007 AGENDA I. II. Call to Order Election of Chair and Vice Chair Land Use & Physical Facilities Committee (ACTION ITEM). Approval of Minutes Meeting of May 9, 2007 (... Date Added: 2009-04-23 20:31:55 |
| 31295005967467.pdf Path: Texas Tech >> ETD >> 02262009 Fall, 2009 Description: INTRAPOPULATIONAL GENETIC AND DEMOGRAPHIC STRUCTURE OF SPERMGPHILUS RICHARDSONII by MOIRA J. VAN STAADEN, B . S c , B.Sc. (Honours), M.Sc. A DISSERTATION IN ZOOLOGY Submitted to the Graduate Faculty of Texas Tech University in Partial Fulfillment of ... Date Added: 2009-04-23 20:32:15 |
| 31295005186134.pdf Path: Texas Tech >> ETD >> 02262009 Fall, 2009 Description: PERCEIVED-AGE ASCRIPTIONS AS A FACTOR IN THE SOCIAL-ROLE PERCEPTION AND SOCIAL-ROLE BEHAVIOR OF PRESCHOOL CHILDREN IN A MIXED-AGE SETTING by ^ LIBBY BALTER BLUME, B.A., M.A. A DISSERTATION IN HOME ECONOMICS Submitted to the Graduate Faculty of Texas... Date Added: 2009-04-23 20:35:11 |
| lec3-1.6page.pdf Path: Berkeley >> CS >> 152 Spring, 2008 Description: IEEE JOURNAL OF SOLID-STATE CIRCUITS, VOL. 36, NO. 11, NOVEMBER 2 A B Vout . . . Combinational Logic Cell Cout Delay Va -> Vout X X X X X X D Q Clk Setup D Dont Care Hold !\"#$%\'&+,-+.\'*/# delay per unit load... Date Added: 2009-04-23 20:35:15 |
| 31295012471115.pdf Path: Texas Tech >> ETD >> 09262008 Fall, 2009 Description: CAREER EXPLORATION: AN EXAMINATION OF THE COMBINED EFFECTS OF MULTIPLE PREDICTORS by DENISE F. HARTLEY, B.A., M.A. A DISSERTATION IN PSYCHOLOGY Submitted to the Graduate Faculty of Texas Tech University in Partial Fulfillment of the Requirements for ... Date Added: 2009-04-23 20:35:33 |
| feedback-slides.pdf Path: Johns Hopkins >> CS >> 438 Fall, 2009 Description: 15-410 My other car is a cdr - Unknown Exam #1 Mar. 19, 2007 Dave Eckhardt 1 L22_Exam 15-410, S\'07 Synchronization Checkpoint 2 Friday, in cluster Reminder: context switch interrupt Later other things will invoke it too Google Summer of Code h... Date Added: 2009-04-23 20:35:42 |
| IB151Lecture8.pdf Path: Berkeley >> IB >> 151 Fall, 2009 Description: ... Date Added: 2009-04-23 20:35:46 |
| 0411-JamesKao.txt Path: Berkeley >> CS >> 162 Fall, 2008 Description: James Kao 04/11/2005 NETWORK -Performance -Latency is the minimum amount of time to transmit the smallest unit of information Setup latency is the time to get the first bit across and includes transmission latency. -Bandwidth is the speed ... Date Added: 2009-04-23 20:36:13 |
| slides.pdf Path: Berkeley >> CS >> 294 Fall, 1924 Description: Regression CS294 Practical Machine Learning Romain Thibaux 02/07 Part 1 Regression A new perspective on freedom Outline Nearest Neighbor, Kernel Regression Linear regression Derivation from minimizing the sum of squares Probabilistic interpreta... Date Added: 2009-04-23 20:37:42 |
| hw1_sol.pdf Path: Purdue >> CS >> 348 Spring, 2008 Description: CS348 Fall-2008: Solution of homework 1 (100 Points) Problem 1 1 6 7 8 4 a b c c b 3 7 4 8 a b b c 5.9 3.7 2.4 1.0 3.4 3.7 9.36 a b c Relation C Relation B Relation A A C Operation Invalid. The structure of relations A and C is not... Date Added: 2009-04-23 20:38:55 |
| Lecture23-Adders_2up.pdf Path: Berkeley >> EE >> 141 Fall, 2008 Description: EE141 EE141- Spring 2007 Digital Integrated Circuits Lecture 23 Adders EE141 EE141-S07 1 Administrative Stuff Hw 9 due on Tu. Discussion tomorrow 5:30-6:30pm Future Perspectives in Digital Design Invited lecture Dr. Stefan Rusu (Intel) IEEE Fell... Date Added: 2009-04-23 20:39:11 |
| klimm2new.pdf Path: Minnesota >> RHOAD >> 030 Fall, 2009 Description: KAZHDAN-LUSZTIG IMMANANTS AND PRODUCTS OF MATRIX MINORS, II BRENDON RHOADES AND MARK SKANDERA Abstract. We show that for each permutation w containing no decreasing subsequence of length k, the Kazhdan-Lusztig immanant Immw (x) vanishes on all matric... Date Added: 2009-04-23 20:41:38 |
| chapter3.pdf Path: UPenn >> PSYCH >> 172 Fall, 2009 Description: Francisco Gil-White 1999 Chapter 3 & 4 Chapter 3. WHY DONT POPULATIONS QUICKLY CEASE TO EVOLVE? 3 You may not have noticed it, but in the previous chapter you engaged in a great deal of population thinking and not once did you have to think abou... Date Added: 2009-04-23 20:41:56 |
| Lecture4.pdf Path: East Los Angeles College >> OA >> 413 Fall, 2009 Description: Simple Climate Models Lecture 2 One-dimensional (meridional) Energy Balance Models Meridional Non-uniformity Insolation varies with latitude NB : need to allow for the effect of obliquity geometrical effects projected and actual areas of latitu... Date Added: 2009-04-23 20:42:33 |
| AssignmentIII.pdf Path: East Los Angeles College >> OA >> 413 Fall, 2009 Description: OA413 : Climate Dynamics Assignment No. 3 Professor Jochem Marotzke; SOC, 566/11; Tel. (023) 80 593755 Jochem.Marotzke@soc.soton.ac.uk Monday, 10 March, 2003 Due: Thursday, 13 March, 2003; 14:00 Problem III.1: 2-box model a) What steady-state soluti... Date Added: 2009-04-23 20:42:45 |
| imoney08xx.pdf Path: East Los Angeles College >> ECON >> 2020 Fall, 2009 Description: International Monetary Theory and Policy, EC2020/3026 Week 8, Autumn 2003 International Monetary Theory and Policy, EC2020/3026 Week 8, Autumn 2003 Output and Exchange Rate in the Short Run Asset market (has been done) 1. Foreign exchange market... Date Added: 2009-04-23 20:43:51 |
| EuthanasiaGuidelineAttachment.doc Path: Laurentian >> NR >> 11514 Fall, 2009 Description: <?xml version=\"1.0\" encoding=\"UTF-8\"?> <Error><Code>NoSuchKey</Code><Message>The specified key does not exist.</Message><Key>36ff4a396755c7b6b2fc359fe20d627525acb27f.doc</Key><RequestId>A C6A6BDF8043DCE6</RequestId><HostId>N3FhNJUBSDo0YVuoYZGQASiP2Cc... Date Added: 2009-04-23 20:44:35 |
| timetabley2s2col.pdf Path: East Los Angeles College >> BP >> 306 Fall, 2009 Description: 9.00 10.00 COMP2008 Lab/01 Communications and Networks Zaluska E J, Chown T Dr 11.00 COMP2012 L1/01 Soft Eng Proj Poppleton M R Dr, Walters R J 05 / 2017 (L/T J) 12.00 13.00 14.00 COMP2005 15.00 M Distributed Computing L2/01 Henderson P, Cirs... Date Added: 2009-04-23 20:44:40 |
| practical2.pdf Path: East Los Angeles College >> PRACTICAL >> 20081101 Fall, 2009 Description: Practical 2: Exploring problems with some common methods 1 Aims and Objectives The aim of this practical is to explore three common methods for handling missing data: including a dummy variable for the missing outcome; last observation carried for... Date Added: 2009-04-23 20:45:51 |
| hls-part3.pdf Path: East Los Angeles College >> ELEC >> 6016 Fall, 2009 Description: 4. Data Path Synthesis - Generate structural data path realisation from scheduled DFG. Two steps: allocation and binding - Allocation chooses FUs and registers from component library. HLS tool select the one that best matches the design constraints. ... Date Added: 2009-04-23 20:47:46 |
| annspr01.pdf Path: SUNY Albany >> CSI >> 404 Fall, 2009 Description: 7 I r 2! @B24)!(4)!uD!HbH41u0i#@!H0v@iD!q#I@0b9qI(I!0@qDq#!#Bq@0P#bI4222!W\' U F \"A Y 1 T Y Y ) \' Y \' \" T U \' U Y X y \" \' C G U \" F C X ) \" A \" T \' ) T C C TH#2DI@gDbI!R2!24)!tD24&Q@R6I r p1 r p! r !xv0p@I!0@pq24)D!v@(Ib#H22 ... Date Added: 2009-04-23 20:48:00 |
| MA311W12000.pdf Path: East Los Angeles College >> MATH >> 3072 Fall, 2009 Description: ... Date Added: 2009-04-23 20:48:39 |
| COINSeptember2008.pdf Path: CSU Fullerton >> PROG >> 3040 Fall, 2009 Description: ! \" # # $ ! \' \" % \" , - . \" % / 01 2 3 % / 01 42 1/ 5 ! \" ( ! 1 ! \" ! 6 +7 8 9 0 , % 68 ! ! # ! % $ %! ! % \' # ! ( ! +, !) * ! $ www.colleenemillerenterprisesinc.... Date Added: 2009-04-23 20:48:49 |
| screen614-2x2.pdf Path: Maple Springs >> PSY >> 6140 Fall, 2009 Description: Data Screening -1- outline Data Screening USA Draft Lottery Data 400 Self-Reports of Height and Weight 130 Outline Part 1: Getting started 300 200 Fusion Times for Stereograms 120 110 Reported weight in Kg VV 100 90 80 G r o u p 70 NV ... Date Added: 2009-04-23 20:50:06 |
| homework2.pdf Path: Maple Springs >> ITEC >> 1011 Fall, 2009 Description: Homework 2 AS/AK/ITEC 1011 3.0, Section C The Fibonacci number series is as follows: 0, 1, 1, 2, 3, 5, 8, 13, 21, 44, It begins with 0 (the zeroth Fibonacci number) and 1 (the first Fibonacci number) and has the property that each subsequent Fibon... Date Added: 2009-04-23 20:50:22 |
| nats1740B_winterproject.pdf Path: Maple Springs >> NATS >> 1740 Fall, 2009 Description: Moon Observing: Winter Term Project: Due Mon. April 6, 2009 Purpose: To gain insight into the changing appearance and location in the sky of the moon by recording observations of the moon from the same location over a period of several weeks. REMEMBE... Date Added: 2009-04-23 20:50:31 |
| chapter09b0809.pdf Path: Maple Springs >> NATS >> 1740 Fall, 2009 Description: 9.4 Cosmic Collisions: small bodies vs. the planets Our Goals for Learning Have we ever witnessed a major impact? Did an impact kill the dinosaurs? Is the impact threat a real danger or just media hype? How do other planets affect impact rates ... Date Added: 2009-04-23 20:50:32 |
| HO-PriorityQueues.doc Path: UMBC >> COSC >> 222 Fall, 2009 Description: Priority Queues (Chapter 7) 1. Keys and Comparators A key is a value (or object) associated with an element that can be used to indicate the elements weight, rank, importance. The key may be part of the element or may be generated for the element. Co... Date Added: 2009-04-23 20:51:00 |
| PS1.pdf Path: East Los Angeles College >> PHYS >> 3007 Fall, 2009 Description: Problem Sheet 1 Section A These questions are intended to let you practice the basic mathematical manipulations youve been taught. Question 1 T = a b3 b t10 where the dot indicates a derivative with respect to t. Give expressions for T , t T , b T ... Date Added: 2009-04-23 20:51:30 |
| lecture_oct5.pdf Path: UMBC >> CHEM >> 111 Fall, 2009 Description: Stoichiometry Chem 111 - Lesson 14 Redox movie 1 Model 5: The chemical reaction of Cu (s) and Ag+ (aq) Cu (s) + 2 Ag+ (aq) Cu2+ + 2 Ag (s) loses 2e gains 2e Model 6: Oxidation-reduction reactions can be divided into two half-reactions Oxidatio... Date Added: 2009-04-23 20:51:39 |
| WEEK5.pdf Path: UAB >> ENGG >> 130 Fall, 2009 Description: EngG 130 (Hibbeler, 7th Edition), Week 5 Moment of a couple: A couple is defined as a system of two parallel forces of equal magnitude, opposite sense, and separated by some nonzero distance d. Since the resultant of the force is zero, the only physi... Date Added: 2009-04-23 20:54:33 |
| White_photo-h.pdf Path: Cuyamaca College >> WEEK >> 5213 Fall, 2009 Description: ... Date Added: 2009-04-23 20:57:12 |
| White_photo-h.pdf Path: Cuyamaca College >> WEEK >> 2903 Fall, 2009 Description: ... Date Added: 2009-04-23 20:57:19 |
| notes9.doc Path: CSU Fullerton >> GAM >> 667 Fall, 2009 Description: 6.2.2.1.1 Importing Textures Go to File menu and choose import You will then be able to browse for the texture Select your texture and hit open button You will then see the window shown on the right. The things in package group and name loca... Date Added: 2009-04-23 20:59:24 |
| GENG2140-Outline-2008.pdf Path: Allan Hancock College >> GENG >> 2140 Fall, 2009 Description: THE UNIVERSITY OF WESTERN AUSTRALIA GENG2140 MODELLING AND COMPUTER ANALYSIS FOR ENGINEERS SEMESTER TWO 2008 UNIT COORDINATOR(S) Prof. Arcady Dyskin (Civil and Resource Engineering) Prof. Karol Miller (School of Mechanical Engineering) A/Prof. Victo... Date Added: 2009-04-23 20:59:36 |
| mysqlupdate.txt Path: CSU Fullerton >> INT >> 322 Fall, 2009 Description: #!/usr/bin/perl use strict; use CGI \":all\"; use DBI; my $cgi = new CGI; my ($iname, $iage, $iemail, $iwebsite); $iname = $cgi->param(\'name\'); $iage = $cgi->param(\'age\'); $iemail = $cgi->param(\'email\'); $iw... Date Added: 2009-04-23 21:00:02 |
| senscontr.pdf Path: UAB >> PEDS >> 203 Fall, 2009 Description: SENSORY CONTRIBUTIONS TO SKILLED PERFORMANCE CHAPTER 4 OBJECTIVES EXPLAIN THE CONTRIBUTIONS AND LIMITATIONS OF A CLOSED-LOOP MODEL OF HUMAN SKILLS UNDERSTAND THE VARIOUS WAYS THAT SENSORY INFORMATION IS USED IN MOVEMENT CONTROL DISCUSS THE PARTIC... Date Added: 2009-04-23 21:00:04 |
| hyp.pdf Path: UAB >> STAT >> 141 Fall, 2009 Description: 1 Hypothesis Tests Previously we learned how to estimate population characteristics from sample data, now we will see how to make decisions about claims about population characteristics. Is a certain claim true, yes or no? We will learn how to make... Date Added: 2009-04-23 21:00:11 |
| PovWorksheet3.doc Path: East Los Angeles College >> CE >> 52303 Fall, 2009 Description: 3D Graphics Worksheet - CM34377-3 Ray tracing Worksheet Three This week we are going to look at a simple POV file that generates an image of three snowmen. The file demonstrates the use of named colours, the use of ambient lighting and the use of mu... Date Added: 2009-04-23 21:01:02 |
| GDP5.doc Path: East Los Angeles College >> GDP >> 0809 Fall, 2009 Description: School of Engineering Sciences Part IV Group Design Projects 2008/2009 Title and Brief Summary Research Group: Aerodynamics & Flight Mechanics Project Title: Southampton flight simulator development Proposer(s): Kenji Takeda Brief Summary of Project ... Date Added: 2009-04-23 21:03:16 |
| decalecture3.ppt Path: East Los Angeles College >> CE >> 53305 Fall, 2009 Description: DECA Schema 2 XML schemas Format of Lecture: XML Schemas recap from week 2 XML Schema Methodology Choices A case study of a typical Proof of Delivery Document XML Spy demo as appropriate during the slides Summary including XML Schema Issues Version... Date Added: 2009-04-23 21:03:46 |
| Jul07_Friends_N.pdf Path: Allan Hancock College >> SEE >> 48907 Fall, 2009 Description: Newsletter of the Friends of the E. de C. Clarke Earth Science Museum: July2007 1 JULY NEWSLETTER 2007 Whats On? Friday August 31st 2007 INAUGURAL FRIENDS MIXER: JOINT UWA FRIENDS FUNCTION: *see enclosed invitation for details* THIS IS THE FIRST... Date Added: 2009-04-23 21:04:20 |
| a1psol.pdf Path: St. Mary MD >> ENG >> 20012002 Fall, 2009 Description: This assignment represents my own work <your signature>, <your e-mail address> /* Title: Sub-Title: Course Code: Assignment #1 Underwater Lab Problem, Pseudo-code Eng 1D04 Submitted from: Clive Wong Student ID: 9900000 Assignment due date: As Appro... Date Added: 2009-04-23 21:04:26 |
| tute7.pdf Path: Allan Hancock College >> IND >> 426 Fall, 2009 Description: IND426 Tutorial 7 (Solutions) (Roberto Togneri 1998) There is no options+padding and the data is that of an ICMP packet: Type(8) = 8 (ICMP Request Packet, from ping) Code(8) = 0 Checksum(16) = 0x5b90 Identifier(16) = 0xf270 Sequence Number(16) = 0x0... Date Added: 2009-04-23 21:05:05 |
| pro511_w5_l1.pdf Path: CSU Fullerton >> PRO >> 511 Fall, 2009 Description: Agenda Terminal Handling in Unix File Descriptors Opening/Assigning & Closing Sockets Types of Sockets Internal(Local) vs. Network(Internet) Programming for Local Sockets Programming for Network (Internet) Sockets Issues involving Server/Client mode... Date Added: 2009-04-23 21:05:37 |
| sampling_exam_AmerF07.pdf Path: Contra Costa College >> ELEC >> 361 Fall, 2009 Description: ELEC 361-W Signals and Systems: Sample Exam on Sampling Instructor: Dr. Aishy Amer, Concordia University, Electrical & Computer Engineering Fall 2007 Instructions: 1. Time Allowed is 30 minutes. Total Marks are 10. 2. Only a one page crib sheet and ... Date Added: 2009-04-23 21:06:28 |
| marien.pdf Path: Rochester >> AAH >> 130 Fall, 2009 Description: ... Date Added: 2009-04-23 21:06:48 |
| GraphTheory_Examples.pdf Path: Contra Costa College >> COEN >> 231 Fall, 2009 Description: 11/28/2008 Graph Theory Part 2 (Some Examples) Kaushik Roy Teaching Fellow COEN 231 Section U PhD Candidate Dept. of Computer Science Concordia University Montreal, Canada Email: kaush_ro@encs.concordia.ca E il k h @ di Homepage: http:/users.encs.... Date Added: 2009-04-23 21:07:33 |
| 11-7-privacyvaluecost.ppt Path: St. Mary MD >> K >> 778 Fall, 2009 Description: Economics of Privacy K778 Security, Privacy and Trust Economics of Privacy Agenda Introduction Economics of privacy Ownership and Control of Privacy Society Governments Organizations Individuals Questions K778 Security, Privacy & Trus... Date Added: 2009-04-23 21:08:28 |
| chp3.ppt Path: UCF >> STA >> 2023 Fall, 2008 Description: Chapter 3 Probability 3.1 Terminology 3.2 Assign Probability 3.3 Compound Events 3.4 Conditional Probability 3.5 Rules of Computing Probabilities 3.6 Random Sampling Homework:3, 7, 17, 23, 27, 29, 32, 35, 37, 43, 50, 55, 57, 61 1 Section 3.1: Some t... Date Added: 2009-04-23 21:10:47 |
| li-notes.pdf Path: ECCD >> SCS >> 3007 Fall, 2009 Description: LECTURE NOTES 95.307 PROGRAMMING PARADIGMS Weixuan Li Fall 2001 Lecture Notes 95.307 Table of Contents TABLE OF CONTENTS Chapter 1. Programming Paradigms 1. Programming Languages and Programs 2. Criteria for Good Programming Languages 3. Lang... Date Added: 2009-04-23 21:10:52 |
| Study-Guide-1001-1-2-16-09-revd-6pp.pdf Path: Minnesota >> ASTRONOMY >> 1001 Fall, 2009 Description: Astronomy 1011H: Professor Paul Woodward: LCSE (Laboratory for Computational Science & Engineering) 125 Walter Library, Digital Technology Center (offices on 4th floor of Walter Library). paul@lcse.umn.edu 612-625-8049 612 625 8049 Office hours: afte... Date Added: 2009-04-23 21:10:56 |
| 307Notes.pdf Path: ECCD >> SCS >> 95307 Fall, 2009 Description: LECTURE NOTES 95.307 PROGRAMMING PARADIGMS Weixuan Li Fall 2001 Lecture Notes 95.307 Table of Contents TABLE OF CONTENTS Chapter 1. Programming Paradigms 1. Programming Languages and Programs 2. Criteria for Good Programming Languages 3. Lang... Date Added: 2009-04-23 21:11:09 |
| misc.pdf Path: ECCD >> ECOR >> 1606 Fall, 2009 Description: ECOR 1606 - Problem Solving and Computers Increment a+; a-; equivalent t... Date Added: 2009-04-23 21:11:53 |
| RAG2N1.pdf Path: Allan Hancock College >> HUMANITIES >> 142600 Fall, 2009 Description: R o ma n A r c h a e o l o g y Gr o u p I n c V o l um e 2, I s s u e 1 J u n e 2 00 6 T h e RA G IN THIS ISSUE Perths Purple Patch Bill Leadbetter 13 PERTHS PURPLE PATCH Bill Leadbetter of Aperlae. Aperlae was only inhabited relatively late - in ... Date Added: 2009-04-23 21:12:17 |
| Tutorial-DOS.doc Path: ECCD >> SYSC >> 3006 Fall, 2009 Description: SYSC-3006 Computer Organisation Lab Tutorial : First steps in the lab The topics in SYSC-3006 require that we have direct access to the hardware of the PC, without the usual protection afforded by the Windows operating system. For this reason, our ... Date Added: 2009-04-23 21:12:27 |
| MECH-691X.pdf Path: Contra Costa College >> MECH >> 691 Fall, 2009 Description: ID Grade 9018646 9169040 4705602 Not Submitted 9017852 4453646 9008853 5526205 85 85 90 95 90 90 ... Date Added: 2009-04-23 21:14:16 |
| 1.pdf Path: ECCD >> COMP >> 3804 Fall, 2009 Description: ... Date Added: 2009-04-23 21:15:07 |
| Sques_Mterm.pdf Path: Contra Costa College >> STAT >> 360 Fall, 2009 Description: Sample Questions for Midterm Test; STAT 360/2, FALL 2005 Instructors: Y.P. Chaubey and D. Sen Time Limit: One Hour & 10 Minutes. Special Instructions: Closed Book Exam 1. Calculators are permitted. 2. Full Credit will be given only for answering ques... Date Added: 2009-04-23 21:16:02 |
| P2_Review03.pdf Path: UWI Mona >> CS >> 480 Fall, 2009 Description: Software Comprehension A Review Information Systems University of Limerick Ireland E-mail: michaelp.obrien@ul.ie Technical Report UL-CSIS-03-3 November 2003 Abstract Comprehend... Date Added: 2009-04-23 21:17:02 |
| Class_9_industrial_geography_05.pdf Path: ECCD >> GEOG >> 2300 Fall, 2009 Description: Industries: A Faustian Bargain The Industrial Revolution Miscellaneous Announcements Industrial Regions Industrial Diffusion Industrial Ecology Industrial Cultural Interaction Industrial Landscape Case Study: The Photographs of Edwa... Date Added: 2009-04-23 21:17:39 |
| MST.pdf Path: UWI Mona >> CS >> 254 Fall, 2009 Description: Minimum Spanning Trees 2704 867 849 ORD 1846 SFO 337 LAX 1464 DFW 1121 MIA 2342 802 1391 740 621 187 JFK 184 BWI 1090 946 144 1258 BOS PVD 1235 2004 Goodrich, Tamassia Minimum Spanning Trees 1 Minimum Spanning Trees ( 12.7) Spanning subgraph Su... Date Added: 2009-04-23 21:19:13 |
| bomb_lab.pdf Path: Minnesota >> CSCI >> 2021 Fall, 2008 Description: CSCI2021 Bomb Lab 100 Points Due Mar 10th 11:59pm 1.1 Introduction The intent of this lab is to strengthen your debugging skills and understanding of assembly. The nefarious Dr. Evil has planted a slew of binary bombs on our machines. A binary bomb i... Date Added: 2009-04-23 21:19:17 |
| nlp08-slides.pdf Path: Brookdale >> CSCI >> 6509 Fall, 2009 Description: CSCI 4152/6509 Natural Language Processing Lecture 8: Semantics, Probabilistic Approach to NLP http:/www.cs.dal.ca/vlado/csci6509 Vlado Keselj Faculty of Computer Science Dalhousie University 22-Sep-2008 (8) CSCI 4152/6509 NLP 1 Previous Lecture... Date Added: 2009-04-23 21:20:59 |
| a1.pdf Path: Brookdale >> CS >> 6505 Fall, 2009 Description: CSCI 6505: Assignment 1 Q1. Explain in your own words how the diagnostic process of a medical doctor, who tries to infer the disease by observing the symptoms of the patient, can be modelled by Bayes theorem. Your mark on this question will be based ... Date Added: 2009-04-23 21:21:04 |
| chap12.pdf Path: Brookdale >> CS >> 3132 Fall, 2009 Description: Implementations of Inheritance 1 Introduction to Object Oriented Programming 2E Timothy A. Budd Chapter 12 Implications of Inheritance Introduction To Object Oriented Programming 2E c Timothy A. Budd 1996 Chapter 12 Implementations of Inheritanc... Date Added: 2009-04-23 21:21:15 |
| soilwashing.pdf Path: Cal Poly >> GCH >> 6311 Fall, 2009 Description: United States Environmental Protection Agency Office of Solid Waste and Emergency Response (5102G) EPA 542-F-01-008 May 2001 www.epa.gov/superfund/sites www.cluin.org A Citizens Guide to Soil Washing ? EPA uses many methods to clean up pollution... Date Added: 2009-04-23 21:26:44 |
| chap3-3.pdf Path: Lake City CC >> CS >> 4476 Fall, 2009 Description: The Advanced Encryption Standard The National Institute of Standards and Technology (NIST) announced the Advanced Encryption Standard (AES) on November 26, 2001. AES applies a much larger key space. AES has three settings. 1 Key-Block-Round Combina... Date Added: 2009-04-23 21:27:24 |
| lab3rev.pdf Path: Lake City CC >> ENG >> 2453 Fall, 2009 Description: Eng 3553 Lab #3 Routing Protocols Overview The Routing Information Protocol (RIP) is an example of a dynamic distance vector routing algorithm. This protocol chooses routes within a network that are of minimum distance. Routers adapt to changes in ne... Date Added: 2009-04-23 21:27:31 |
| Math556-Exsol3.pdf Path: McGill >> MATH >> 556 Fall, 2009 Description: MATH 556 - EXERCISES 3 : SOLUTIONS 1 (a) By direct calculation, using a derivation as in lecture notes, CX (t) = EfX [eitX ] = 1 eitx |x| exp{|x|} dx = 2 0 0 cos(tx)xex dx as the pdf is an even function around zero. Integrating by parts, CX (t... Date Added: 2009-04-23 21:29:59 |
| Math556-AssignmentSol4.pdf Path: McGill >> MATH >> 556 Fall, 2009 Description: MATH 556 - ASSIGNMENT 4: SOLUTIONS 1 (a) Directly from the notes: by Lyapunovs inequality E[ |Xn X|s ]1/s E[ |Xn X|r ]1/r so that E[ |Xn X|s ] E[ |Xn X|r ]s/r 0 E[ |Xn X|s ] 0 as n , as s < r. Thus and Xn X. sth 2 M ARKS For the given ... Date Added: 2009-04-23 21:30:01 |
| IntroElectro_handout.pdf Path: McGill >> CS >> 273 Fall, 2009 Description: Introduction to Digital Electronics 1. How are computers made? We started by showing the stuff that computers are made of. It all begins with common sand, which consists mostly of silicon dioxide (quartz). Using chemical methods, the sand is converte... Date Added: 2009-04-23 21:30:56 |
| jdk-configuration--vista.pdf Path: McGill >> CS >> 202 Fall, 2009 Description: Windows 7 / Windows Vista Java Development Kit (JDK) Configuration Instructions 1. Go to http:/java.sun.com 2. Click on Java SE on the right (under Popular Downloads.) 3. On the page that loads, scroll down until you see Java SE Development Kit (J... Date Added: 2009-04-23 21:31:15 |
| COMP4510a2_Oct2007.pdf Path: UMass (Amherst) >> COMP >> 4510 Fall, 2009 Description: COMP4510 Assignment Objectives Assignment 2 Due: Oct. 26th, 2007 @11:59PM To provide you with some practical experience with OpenMP parallel programming. To expose you to some typical problem types encountered in parallel programming. Assignmen... Date Added: 2009-04-23 21:34:01 |
| a2.pdf Path: McGill >> COMP >> 202 Fall, 2009 Description: COMP-202A, Fall 2007, All Sections Assignment 2 Due: Tuesday October 9, 2007 (23:55) You MUST do this assignment individually and, unless otherwise specied, you MUST follow all the general instructions and regulations for assignments. Note that for ... Date Added: 2009-04-23 21:34:06 |
| Ch8supertidyburst-up.pdf Path: McGill >> CH >> 303 Fall, 2009 Description: COMP 303 - Lecture Notes for Week 8 Frameworks Slides edited from, Object-Oriented Design Patterns, by Cay S. Horstmann Original slides available from: http:/www.horstmann.com/design_and_patterns.html Modifications made by Laurie Hendren, McGill Univ... Date Added: 2009-04-23 21:34:19 |
| 3_compint.pdf Path: McGill >> CS >> 350 Fall, 2009 Description: Computer Representation of Integers Typically, integers are stored using a 32-bit word. Sign and Modulus Representation Use one bit to represent the sign, and store the binary representation of the magnitude of the integer. For example, (71)10 would ... Date Added: 2009-04-23 21:36:28 |
| JB.ppt Path: McGill >> ECE >> 649 Fall, 2009 Description: VLSI Testing 304-649 Design error and fault simulation Jean-Franois Boland Presentation Plan Project Overview Design error and fault models ESIM Software Future work Project Overview Simulation Design error Logical fault ESIM software, ... Date Added: 2009-04-23 21:36:30 |
| tutorial1.pdf Path: McGill >> EE >> 534 Fall, 2009 Description: ANALOG MICROELECTRONICS (304-534A) An Introduction to Cadence Schematic Composer and the Analog Simulation Environment Step 0. If you are using your MACS account for the rst time: - if you are using the undergraduate Unix machines, from the login men... Date Added: 2009-04-23 21:36:32 |
| lba.pdf Path: Allan Hancock College >> SDB >> 231 Fall, 2009 Description: Available online at www.sciencedirect.com Cognitive Psychology 57 (2008) 153178 www.elsevier.com/locate/cogpsych The simplest complete model of choice response time: Linear ballistic accumulation Scott D. Brown *, Andrew Heathcote School of Psychol... Date Added: 2009-04-23 21:37:00 |
| conclusion.doc Path: McGill >> ARCH >> 672 Fall, 2009 Description: Conclusion: The campus buildings evolved in almost a uniform fashion. The original buildings were more monumental in feel with their elaborate ornamentation, whereas the later buildings became more interested in the technology and the equipment that ... Date Added: 2009-04-23 21:37:06 |
| NeedleStickSleep.pdf Path: McGill >> C >> 634 Fall, 2009 Description: ORIGINAL CONTRIBUTION Extended Work Duration and the Risk of Self-reported Percutaneous Injuries in Interns Najib T. Ayas, MD, MPH Laura K. Barger, PhD Brian E. Cade, MS Dean M. Hashimoto, JD, MD Bernard Rosner, PhD John W. Cronin, MD Frank E. Speiz... Date Added: 2009-04-23 21:39:11 |
| Haunted_Architecture.pdf Path: McGill >> ARCH >> 671 Winter, 2009 Description: Haunted Architecture: Ghosts Guiding Design Anna Sampson Supervisor: David Covo April 1, 2008 Every site is haunted by its history and memory; some are said to be haunted by the spirits of the dead. Artists will live and work in an isolated and haunt... Date Added: 2009-04-23 21:41:09 |
| hw1.pdf Path: McGill >> PHYSICS >> 645 Fall, 2009 Description: Homework Assignment 1. PHYS 645: High Energy Astrophysics Due Feb 1 2008, to ERP 222 (Bob Rutledge) 1. Calculate the synchrotron cooling timescale, assuming an electron begins with energy me c2 , and radiates with energy (dW/dt) calculated in class. ... Date Added: 2009-04-23 21:41:27 |
| Tremaine.pdf Path: McGill >> PHYSICS >> 614 Fall, 2009 Description: The Astrophysical Journal, 574:740753, 2002 August 1 # 2002. The American Astronomical Society. All rights reserved. Printed in U.S.A. THE SLOPE OF THE BLACK HOLE MASS VERSUS VELOCITY DISPERSION CORRELATION Scott Tremaine,1 Karl Gebhardt,2 Ralf Bend... Date Added: 2009-04-23 21:41:38 |
| lab1.pdf Path: UMass (Amherst) >> MATH >> 2132 Fall, 2009 Description: Find the limit of the the following sequences of numbers: an = n2 n+7 2n3 +n2 n2 n + 7 lim = lim n 2n3 + n2 n 1 n 1 n2 + 1 2+ n 7 n3 =0 an = 1 + 9 n 10 n lim 1 + 9 10 n =1 an = 1+(1)n n Since 0 1 + (1)n 2 2 and lim = 0 n n n n... Date Added: 2009-04-23 21:43:54 |
| syllabus.pdf Path: UMass (Amherst) >> MATH >> 1010 Fall, 2009 Description: MATH 1010 Applied Finite Mathematics Fall 2008 A01 Instructor: R. Borgersen Oce: 352 Machray hall Phone: 474 6708 email: borgersen2008@ gmail.com Oce hours: Posted on oce door Slot 5 10:00-11:15 TR 205 Armes A02 A03 Dr. M. Davidson R. Borgersen 431 M... Date Added: 2009-04-23 21:43:57 |
| assign1_251_2002.pdf Path: McGill >> CS >> 251 Fall, 2009 Description: Exercise Sheet #1, Computer Science, 308-251A M. Hallett, Kaleigh Smith, X Fall 2002 Due: Sept. 26, 2002, midnight Drop Box: 308-251 drop box (McConnell, 1st Floor, North Wing) Hand in solutions to questions that gave you difficulty, if you are unsur... Date Added: 2009-04-23 21:46:07 |
| WCBOH.DOC Path: UMBC >> TECH >> 100 Fall, 2009 Description: Workplace Safety In Canada there are laws and codes governing workplace health and safety. These govern working in environments that include: hazardous materials pesticides chemicals X-rays communicable diseases fire hazards explosives env... Date Added: 2009-04-23 21:46:15 |
| assignment5.pdf Path: Mt. Aloysius >> MATH >> 3231 Fall, 2009 Description: Math 3231 Assignment 5 (2004) due 2/4/2004 In the following C1 , C2 etc. are some fixed real constants. 1. Show by partial summation that 1 = log log x + C1 + O n log n 2nx 2. The prime number theorem says that (x) = #{primes p x} def 1 x log x x... Date Added: 2009-04-23 21:47:18 |
| WebLinks.doc Path: Athens Tech >> PSYCH >> 340 Fall, 2009 Description: Psychology 340 Applied Psychology Websites Unit 1 Attribution Theory http:/www.as.wvu.edu/~sbb/comm221/chapters/attrib.htm This article provides a description of attribution theory, an example of a study which illustrates the effects of attribution,... Date Added: 2009-04-23 21:47:57 |
| sm_sg387.pdf Path: Athens Tech >> PSYCH >> 387 Fall, 2009 Description: Psychology 387 Learning Student Manual/Study Guide Athabasca University a COURSE TEAM Author: Lyle Grant Editor: Carol Schafer Visual Presentation: Digital Media Technology Unit The study questions that appear in the Study Guide section of this S... Date Added: 2009-04-23 21:47:58 |
| a3.pdf Path: UMass (Amherst) >> ECE >> 7250 Fall, 2009 Description: ECE 7250 Information Theory Assignment 3 (due 24 October 2008) 1. In this problem, you will prove the weak law of large numbers (WLOLN). To do so proceed as follows: (a) Show that, for any non-negative random variable X and any > 0 P (X ) EX Giv... Date Added: 2009-04-23 21:48:22 |
| transaction.txt Path: UAB >> CSC >> 120 Fall, 2009 Description: c 1004 14.95 c 1008 167.84 p 1002 567.89 p 1000 12.95 c 1007 13.45 c 1001 543.21 c 1006 122.22 n 666 Beast, Beauty c 1001 23.51 n 17.49 Augustana University College Bookstore c 1009 0.66 p 1004 99.99 ... Date Added: 2009-04-23 21:49:13 |
| ELEC433labman2005.pdf Path: Contra Costa College >> ELEC >> 433 Fall, 2009 Description: CONCORDIA UNIVERSITY DEPARTMENT OF ELECTRICAL AND COMPUTER ENGINEERING ELEC 433 STATIC POWER CONVERTERS LABORATORY MANUAL Prepared by Gza Jos Jos R. Espinoza Luis Lopes September - 2005 TABLE OF CONTENTS TABLE OF CONTENTS.. i I. INTRODUCTION Saf... Date Added: 2009-04-23 21:49:32 |
| m209p90_44.doc Path: Athens Tech >> MATH >> 209 Fall, 2009 Description: Math 209 page 90 #44 Write an equation of the lowest-degree polynomial function with the graph with the graph and intercepts shown in the figure. Solution: (2, 0) and (1, 0) are on the graph of the polynomial function. f ( 2) = 0 and f (1) = 0 . Let... Date Added: 2009-04-23 21:49:49 |
| BG-2007-4-D7.pdf Path: Contra Costa College >> LYRA >> 23004 Fall, 2009 Description: ... Date Added: 2009-04-23 21:50:10 |
| Introduction%20to%20Oracle.ppt?zoom_highlight=sql Path: UWI Mona >> CS >> 387 Fall, 2009 Description: <?xml version=\"1.0\" encoding=\"UTF-8\"?> <Error><Code>NoSuchKey</Code><Message>The specified key does not exist.</Message><Key>36fc08f0a200ff562ef7907c4a83ef5d326a13d8.ppt %3Fzoom_high</Key><RequestId>0CC564FA664B918F</RequestId><HostId>azFChS3ALIIlPv7... Date Added: 2009-04-23 21:51:43 |
| VisualizeBeforeYouFormalizeFinal.pdf Path: UC Davis >> VISUALIZE >> 200405 Fall, 2009 Description: Visualize Before You Formalize Fall Conferences 2004 aebellman@ucdavis.edu UsingTransformationGraphingtoInvestigate\"m\"and\"b.\" AQuickIntroduction. To investigate the effects of \"m\" and \"b\" you are going to use a TI-83+ with the Transformation Graph... Date Added: 2009-04-23 21:52:11 |
| PrivateResidencePresentation.pdf Path: McGill >> ARCH >> 676 Winter, 2009 Description: Project number: AL-05-023 Project name: Private Residence Client: Jean Deragon Presentation date: 2005-04-11 1 Studys Objective Inside light provide by sunlight = 2% Gradient of evaluation: Light: evaluation over ten of the achievement of 2% of the... Date Added: 2009-04-23 21:52:48 |
| Homework2.doc Path: Contra Costa College >> SOEN >> 337 Fall, 2009 Description: SOEN337 winter 2009 Homework 2 on White Box testing and testing measurement (1%) Posted on January 21, due on January 27 by midnight Submit electronically as Proposal 2 In parsing Java code, one of the responsibilities of the tool is to determine f... Date Added: 2009-04-23 21:53:51 |
| M112_QuizExamples04_Fall_2008.pdf Path: UMBC >> MATH >> 112 Fall, 2009 Description: Math 112 (71) Fall 2008 Example 1 The graph of a function f is shown. In parts (a) to (e) compute the limit if it exists. If the limit does not exist, determine if the limit is an innite limit, and, if it is, state whether it is + or . Otherwise, exp... Date Added: 2009-04-23 21:54:45 |
| 4)PotionsClass.doc Path: UWI Mona >> E >> 56551 Fall, 2009 Description: Professor Snape\'s Potions\' Class (a.k.a. Science) Most of the potions acquired in Professor Snape\'s class are simple enough to be concocted in any muggle household. The experiments provide a link to the natural elements of Science, and to our wizard ... Date Added: 2009-04-23 21:57:05 |
| p6PracticeShtOne.pdf Path: UWI Mona >> CS >> 354 Fall, 2009 Description: Here\'s a solution to Problem 6 of Practice Sheet one. We first note that a substring 01 must be followed by a substring 10 and vice versa. Thus the simplest strings that satisfy this property are of two types: 010, 01010, 0101010, . or 101, 10101, 10... Date Added: 2009-04-23 21:57:23 |
| Chapter2.ppt Path: UMBC >> COMP >> 112 Fall, 2009 Description: Chapter Two Algorithm Discovery and Design 1 Why are Algorithms Important? If we can discover an algorithm to perform a task, we can instruct a computing agent to execute it and solve the problem for us. 2 Representing Algorithms What language t... Date Added: 2009-04-23 21:58:03 |
| quiz7b.pdf Path: UMBC >> CHEM >> 111 Fall, 2009 Description: Chem 111 Dr. C Doige Quiz 7b November 10, 2006 When choosing between two evils, I always like to try the one I\'ve never tried before. Mae West (1892-1980) Name _ Student Number_ 1. Sketch the shape of the boundary surface diagram for a 3dx2-y2 or... Date Added: 2009-04-23 21:59:44 |
| coen352_TA4.pdf Path: Contra Costa College >> COEN >> 352 Fall, 2009 Description: COEN352 Data structure and algorithms Tutorial 4 Tutor: May El Barachi elbar_m@encs.concordia.ca http:/users.encs.concordia.ca/~elbar_m/ Vectors, lists, and sequences The concept of a sequence, where each object comes before or after another, is im... Date Added: 2009-04-23 22:00:55 |
| 6.pdf Path: Brookdale >> CS >> 2140 Fall, 2009 Description: Resolution in The Propositional Calculus Evangelos Milios March 21, 2003 Based on chapter 14 of the text by Nils Nilsson, Articial Intelligence: A New Synthesis, Morgan Kaufmann, 1998. 1 A single inference rule: resolution A single inference rule... Date Added: 2009-04-23 22:01:03 |
| lecture08.pdf Path: Brookdale >> CS >> 4131 Fall, 2009 Description: Bottom-Up Parsing (Chapter 5) 1 Bottom-Up Parsing Bottom-up parsing is the preferred parsing method in practice Parses a larger class of grammars than LL(1) Just as efficient Again uses an explicit stack and a parsing table (and building the t... Date Added: 2009-04-23 22:01:20 |
| 72systempu.pdf Path: Brookdale >> IS >> 353832 Fall, 2009 Description: EG2141 ENGINE EMISSION CONTROL SYSTEMS EMISSION CONTROL SYSTEMS SYSTEM PURPOSE System Positive crankcase ventilation Evaporative emission control Exhaust gas recirculation Pulsed secondary air injection Threeway catalytic converter Multiport fuel i... Date Added: 2009-04-23 22:01:31 |
| Infrastructure2.ppt Path: Cuyamaca College >> COMP >> 2513 Fall, 2009 Description: Comp2513 E-Commerce Infrastructure 2 Daniel L. Silver, Ph.D. Objectives To complete an overview of the major architectural components of the Internet that form the infrastructure for E-Commerce References: portions of Sharma Ch.1 and 2, and DDEA Ch... Date Added: 2009-04-23 22:01:55 |
| 08-3-DMandLab.3.ppt Path: Wilfrid Laurier >> ENCM >> 511 Fall, 2009 Description: \"Lab. 5\" Updating Lab. 3 to use DMA Test we understand DMA by using some simple memory to memory DMA Make life more interesting, since hardware is involved, by using DMA to send out SPI signals Transfer array using \"normal array handling\" Normal ... Date Added: 2009-04-23 22:02:40 |
| 04movingArrays1instructors.ppt Path: Wilfrid Laurier >> ENCM >> 515 Fall, 2009 Description: Moving Arrays - 1 Completion of ideas needed for a general and complete program Final concepts needed for Final Review for Final Loop efficiency Tackled today Declaring and initializing arrays off the stack Review and a little bit of new Useful... Date Added: 2009-04-23 22:02:49 |
| math251_test1_sol_2007.pdf Path: UMBC >> MATH >> 251 Fall, 2008 Description: ... Date Added: 2009-04-23 22:03:14 |
| Chem112Assignment1.doc Path: UMBC >> CHEM >> 112 Fall, 2009 Description: Chemistry 112 Assignment 1 ( /30) Due: September 23 Please show all work and give answers to the correct number of significant figures. 1. (3) The density of diamond is 3.51 g/cm3. The international unit for weighing diamonds is the carat (1 carat... Date Added: 2009-04-23 22:03:36 |
| procbas.q.pdf Path: East Los Angeles College >> COMS >> 12200 Fall, 2009 Description: 1.1 Questions 1 COMS12200/COMSM0109 Worksheet Dan Page http:/www.cs.bris.ac.uk/home/page/ January 7, 2009 1.1 Questions 1. Imagine you are on the design team for a new 16-bit processor. The ISA for the processor includes specifications for: 16 ge... Date Added: 2009-04-23 22:03:42 |
| lecture9.pdf Path: McGill >> CS >> 361 Fall, 2009 Description: Testing Strategies Comp-361 : Testing Strategies Lecture 9 Alexandre Denault Computer Science McGill University Winter 2008 Changes in the Schedule February 13th (Friday) - No class 20th (Friday) - Guest Lecturer - Janina Szkut 27th (Friday) - ... Date Added: 2009-04-23 22:04:20 |
| lecture9.pdf Path: McGill >> CS >> 206 Fall, 2009 Description: C Compilation Model Comp-206 : Introduction to Software Systems Lecture 9 Alexandre Denault Computer Science McGill University Fall 2006 Midterm Date: Thursday, October 19th, 2006 Time: from 16h00 to 17h30 Content: Everything we have seen in c... Date Added: 2009-04-23 22:04:49 |
| 08SpeedIIR_4_MemoryCompute.pdf Path: Wilfrid Laurier >> ENCM >> 515 Fall, 2009 Description: Understanding the TigerSHARC ALU pipeline Understanding the TigerSHARC ALU pipeline Determining the speed of one stage of IIR filter Part 4 IIR operation with Memory TigerSHARC has many pipelines Review of the COMPUTE pipeline works Interaction of... Date Added: 2009-04-23 22:04:54 |
| S3calibration.pdf Path: Universität St. Gallen (HSG) >> DMO >> 6301 Fall, 2009 Description: ... Date Added: 2009-04-23 22:06:01 |
| ass2.pdf Path: McGill >> MATH >> 579 Fall, 2009 Description: Mathematics 579 Assignment 2. Order and Convergence Due Wednesday 4th March 2009 Assignment 2 1. Using the Forward Euler code as a template, implement Runges second order method 0 1/2 1/2 0 1 and the four stage method (sometimes called The Runge-Ku... Date Added: 2009-04-23 22:06:10 |
| ph200chw1.pdf Path: McGill >> PH >> 200 Fall, 2009 Description: PHYS 200 SPACE, TIME and MATTER PROBLEM SET 1 Due Thursday, Sept. 27, 2007, in class 1. Draw a world line in a space-time diagram which describes the trip of an astronaut to a distant star and back, assuming that the astronaut is travelling with a... Date Added: 2009-04-23 22:06:40 |
| stat2606_08_assign5.pdf Path: ECCD >> STAT >> 2606 Fall, 2009 Description: Carleton University School of Mathematics and Statistics STAT 2606 Assignment #5 SECTION A & B: Due Wednesday, November 26 SECTION C: Due Thursday, November 27 1. The cost of automobile insurance has become a sore subject in California because the r... Date Added: 2009-04-23 22:07:45 |
| tutorial10.ppt Path: Contra Costa College >> SOEN >> 385 Fall, 2009 Description: Concordia University Department of Computer Science and Software Engineering SOEN385 Control Systems and Applications 3D Modeling with V-Realm Builder V-Realm Builder Features Intuitive interface Open standards produces files that can be read b... Date Added: 2009-04-23 22:08:59 |
| coen345_TA2.pdf Path: Contra Costa College >> COEN >> 345 Fall, 2009 Description: White Box Testing Tutor: May El Barachi Contact information: elbar_m@encs.concordia.ca http:/users.encs.concordia.ca/~elbar_m/ Whats White Box Testing White box testing Glass Box testing Structural testing Clear Box testing Open Box Testing A soft... Date Added: 2009-04-23 22:09:26 |
| marie.txt Path: Contra Costa College >> COMP >> 228 Fall, 2009 Description: S1, INPUT SUBT Offset ADD X STORE X LOAD Count SUBT One Store Count SKIPCOND 400 JUMP S1 Load X Output HALT X, DEC 0 Offset, DEC 48 Count, ... Date Added: 2009-04-23 22:09:37 |
| chess.ppt Path: Wilfrid Laurier >> L >> 203 Fall, 2009 Description: Our Lady Peace Spiritual Machines Ray Kurzweil The Age of Spiritual Machines 23 256 grains 24 25 26 27 28 23 256 grains 65 536 grains 24 212 25 213 26 214 27 215 28 216 29 210 211 217 218 Calculate a bushel 100 ml = 1300 grains 1... Date Added: 2009-04-23 22:09:56 |
| 214Lab3-2005.ppt Path: UWI Mona >> CS >> 214 Fall, 2009 Description: 03-60-214: Lab 3 Jan 30, Winter 2004 Jianguo Lu 1 Exercises Draw the diagrams of an FA (DFA or NFA) for the following languages, the alphabet is {a, b, ., z}. Write the regular expression after you have the diagram. A string containing an \'a\'; ... Date Added: 2009-04-23 22:10:52 |
| hockman_wk2_2.doc Path: McGill >> MUMT >> 620 Fall, 2009 Description: Jason A. Hockma Towards A Choice of Gestural Constraints for Instrumental Performers Axel G.E. Mulder This paper presents an overview of development requirements for musical instruments that are adapted to performer motor skills. The author first pre... Date Added: 2009-04-23 22:11:25 |
| PDC070319-6.1a.pdf Path: UWI Mona >> B >> 6176 Fall, 2009 Description: PROPOSED COURSE SEQUENCE FIRST YEAR Course 32-120 32-112 32-222 333333-111 TOTAL FALL Title INTRO TO MUSIC THERAPY MUSIC THEORY I BASIC SKILLS I APPLIED LESSONS 1 HR ENSEMBLE GUITAR TECHNIQUES Credit Schedule 3 R 1900 - 2200 3 1.5 3 1.5 3 15 MWF 1230... Date Added: 2009-04-23 22:12:26 |
| Granger1989.pdf Path: Wilfrid Laurier >> GLGY >> 607 Fall, 2009 Description: Journal of Hydrology, 111 (1989) 21-29 Elsevier Science Publishers B.V., Amsterdam - - Printed in The Netherlands 21 [41 E V A P O R A T I O N FROM N A T U R A L N O N S A T U R A T E D S U R F A C E S R.J. GRANGER and D.M. GRAY Division of Hydro... Date Added: 2009-04-23 22:12:37 |
| forwarding.pdf Path: Wilfrid Laurier >> CPSC >> 441 Fall, 2009 Description: Network Layer: Routing Computer Networking: A Top Down Approach\", by Jim Kurose and Keith R... Date Added: 2009-04-23 22:15:35 |
| ass3fileio.txt Path: Allan Hancock College >> INFT >> 11110 Fall, 2009 Description: / The button that writes the ordering data void writeOrderingData_actionPerformed(ActionEvent e) { Product tempProduct; / An individual product int index; / Index into the array PrintWriter outFile; / Th... Date Added: 2009-04-23 22:16:26 |
| indexFiles.ppt Path: Allan Hancock College >> INFT >> 12210 Fall, 2009 Description: INFT210 Files Streams Streams are an abstraction of input and output an input stream represents a source of byte input an output stream represents a source of byte output Data can come from and be written to many sources, e.g., files keyboard/mo... Date Added: 2009-04-23 22:18:31 |
| ENGI2800_Intro.pdf Path: Brookdale >> ENGI >> 2800 Fall, 2009 Description: Fossil Fuel Power Plant Point Tupper, NB Burns Coal Tufts Cover Power Plant In Dartmouth, NS Burns Natural Gas Nuclear Power Plant Pickering, ON Power Cycle for CANDU reactors Ohio, US Gas-Turbine Power Plant Turbojet Engine C Ch omb am us be ... Date Added: 2009-04-23 22:18:35 |
| konttinen.pdf Path: East Los Angeles College >> COST >> 288 Fall, 2009 Description: Dilute nitride optoelectronic devices Janne Konttinen, Tomi Jouhti, Mircea Guina, Konttinen, Jouhti, Guina, Suvi Karirinne and Markus Pessa Optoelectronics Research Centre (ORC) Tampere University of Technology Tampere, Finland 18.10.2004 Outline O... Date Added: 2009-04-23 22:18:39 |
| d3629.pdf Path: East Los Angeles College >> E >> 218 Fall, 2009 Description: 1 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . T h e c o n t e x t f o r t h e c o u r s e . Activity 3 Allow about 1 hour Use Table 2 to sketch out your ideas on what areas of current or future work you could link to the c... Date Added: 2009-04-23 22:19:50 |
| midterm03.pdf Path: UMass (Amherst) >> PLNT >> 3140 Fall, 2009 Description: 39.314 INTRODUCTORY CYTOGENETICS MID-TERM EXAMINATION 1 p.m. to 2:20 p.m. Tuesday, October 21, 2003 This examination is worth 15% of the course grade. There are 9 questions totalling 100 points. Hand in these question sheets along with your exam bo... Date Added: 2009-04-23 22:23:02 |
| PETR2510Lectures2sl29-42.pdf Path: Allan Hancock College >> PETR >> 2510 Fall, 2009 Description: Marine Seismic Surveys Dr Elena Pasternak Slide 29 Wave Source, Receiver and Recording Equipment l Survey vessel Tows 12 to 16, 3000 to 8000 m long hydrophone streamers spaced 50 to 100 m apart Survey speed 5 knots 68 crew members Dr Elena P... Date Added: 2009-04-23 22:23:48 |
| GurungKFS.doc Path: UWI Mona >> CS >> 60564 Fall, 2009 Description: 60-475 Security and Privacy on the Internet Dr. A.K. Aggarwal KFSensor Honeypot and Intrusion Detection System Sunil Gurung Wednesday, October 06, 2004 Table of Contents 1. Introduction 2. Honeypot Technology 3. KFSensor ( Honeypot and Intrusion ... Date Added: 2009-04-23 22:23:56 |
| project3.pdf Path: Contra Costa College >> ELEC >> 6601 Fall, 2009 Description: Concordia University ELEC 6601 Digital Signal Processing Project #3 Professor Amir G. Aghdam 1. Aliasing due to undersampling. Consider the sinusoidal signal: x(t ) = sin( 0 t ) . 2 rad/sec, then the discrete-time signal If x(t ) is sampled with fre... Date Added: 2009-04-23 22:24:14 |
| c242a5nfc.pdf Path: McGill >> MATH >> 242 Fall, 2009 Description: Department of Mathematics and Statistics McGill University MATH 242 Assignment 5 Not for credit 1. (10 points) Let f :] 1, 1[ R be a function differentiable at 0 and with f (0) > 0. Show from rst principles that there exists > 0 such that 0 < x < ... Date Added: 2009-04-23 22:24:16 |
| SENG637_project_list.pdf Path: Wilfrid Laurier >> SENG >> 637 Fall, 2009 Description: Department of Electrical and Computer Engineering SENG 637 - Dependability, Reliability and Testing of Software Systems Suggested Project List Dr. Behrouz Far Winter 2008 (Revision 1.00) Below is a list of suggested projects for SENG 637. This list ... Date Added: 2009-04-23 22:25:48 |
| BA925UD_TP0_2008.pdf Path: Allan Hancock College >> BA >> 925 Fall, 2009 Description: BA925 Financial Policy Unit Description School/Division: Course: Author: Level: Teaching Period: Prerequisites: Corequisites: Exclusion(s): Credit Points: ASCED Code: Subject Overview Business Master of Business Administration Pat Thompson Advanced... Date Added: 2009-04-23 22:25:57 |
| 369-2006-final-questions.pdf Path: Wilfrid Laurier >> ENCM >> 369 Fall, 2009 Description: University of Calgary Department of Electrical and Computer Engineering ENCM 369: Computer Organization Lecture Instructor for L01 and L02: Dr. S. A. Norman Winter 2006 FINAL EXAMINATION Auxiliary Gymnasium Tuesday, April 18 - 7:00pm to 10:00pm NAME... Date Added: 2009-04-23 22:27:32 |
| US-2008-10-D14.pdf Path: Contra Costa College >> LYRA >> 40377 Fall, 2009 Description: ... Date Added: 2009-04-23 22:28:44 |
| lab6attnShulte.doc Path: Allan Hancock College >> CP >> 684 Fall, 2009 Description: CP 684 Human Factors in Information Systems Theme of the week: Selective Attention Week 5 Lab: Measurement of Concentration Capacity Task 1. Administering the Schulte-Gorboff Attention Test Instructions: In the table below scan numbers from 1 to 2... Date Added: 2009-04-23 22:30:41 |
| 04-BitsAndArithmetic.pdf Path: Wilfrid Laurier >> CPSC >> 231 Fall, 2009 Description: Christian Jacob Chapter 4 Binary Data Representation and Binary Arithmetic 4.1 4.2 Binary Data Representation Important Number Systems for Computers 4.2.1 4.2.2 4.2.3 4.2.4 4.2.5 4.2.6 4.2.7 Number System Basics Useful Number Systems for Computers ... Date Added: 2009-04-23 22:32:17 |
| texture.pdf Path: McGill >> CIM >> 646 Fall, 2009 Description: x s wbp X X`d h s jg s o g s X` jdgp p od gp o jp d e s gp X p h X e s ob Xp h h` ou p od sb g h` jgdp T&rvahljctvaRtth{aumRvtkqrmldrFtrmldd1agtmEhr{kqR}ckauRqn)xRb aXca`cmabrq}tasmveE\'q}qqd2tc)aEqlhtttvcm2lhmmvrxmcmmmb X j g`g j W h jd... Date Added: 2009-04-23 22:32:32 |
| 32prelimin.pdf Path: Brookdale >> IS >> 353832 Fall, 2009 Description: AT115 AUTOMATIC TRANSMISSION Troubleshooting (Preliminary Check) Preliminary Check 1. CHECK FLUID LEVEL (Transmission and transfer case) HINT: The vehicle must have been driven so that the engine and transmission are at normal operating temperatur... Date Added: 2009-04-23 22:33:05 |
| lawschoolexam97.pdf Path: UMass (Amherst) >> LAW >> 45146 Fall, 2009 Description: The University of Manitoba Faculty of Law 45:146 CONSTITUTIONAL LAW First Year - 1C Instructors: D. Miller Time: 3 Hours _ 1. 2. 3. This is an open-book examination. The result obtained on this examination will form 80% of your final grade in the cou... Date Added: 2009-04-23 22:33:43 |
| Magnetic_Fields_in_Matter.pdf Path: W. Kentucky >> PHYS >> 272 Fall, 2009 Description: | fHDrR X V t 8 t SAi(CgPWIcWs B X8R VTH BHrH d VH F8 rRHR p X B X8R V TH B X b Rr rRrR F AgDA2ISUESYSISIA9!SUGgDAaDY2WCUEUgHcsYSt@2Y(IA8 gVWA0SYAqgR!gRCWgVAhmAm!YUIhS(uSYsaRSW&hsAUYUYhAG!cYSIF X dD V@r8` fR f T XD H @8 bRrH d B@` B@8H f@ F p H R... Date Added: 2009-04-23 22:35:07 |
| ppgbc_data.doc Path: Allan Hancock College >> TOOLBOX >> 902 Fall, 2009 Description: Product Information Global BC Basecoat Colour 0800 Clear Product Description The Global BC system consists of high opacity solid colour and metallic basecoat colours and a clearcoat activated with MS hardeners. Global BC is designed for the repair o... Date Added: 2009-04-23 22:35:30 |
| EK761_L5.ppt Path: Allan Hancock College >> EK >> 761 Fall, 2009 Description: 1 CFD REVIEW Get the governing equations PDE & BCs Discretise the domain Mesh generation Convert PDEs to algebraic equations Started with 1-D diffusion equation : d dT k + S = 0 dx dx For any arbitrary CV above equation can be discretis... Date Added: 2009-04-23 22:36:30 |
| 243p1.txt Path: Wisc Platteville >> CS >> 243 Fall, 2009 Description: CS 2430 - Object-Oriented Programming and Data Structures I Fall 2006 Clifton Program: 1 - Getting Started Due Date: September 13, 3:30 p.m. Grace Date: September 15, 3:30 p.m. (last demo at 3:20 p.m.) Points: 15 Finish the code for... Date Added: 2009-04-23 22:36:39 |
| BA506Tutorial07StudentSolutions.pdf Path: Allan Hancock College >> BA >> 506 Fall, 2009 Description: Chapter 9 Analysis and Interpretation of Financial Reports Discussion questions 9.2 Your friend has $5000 to invest in the stock market and is deciding between an investment in Ability Ltd or Absolute Ltd. In the most recent reporting period, Absolut... Date Added: 2009-04-23 22:36:41 |
| BA521LectureIllustration07.doc Path: Allan Hancock College >> BA >> 521 Fall, 2009 Description: School of Business BA521 Personal Financial Planning 1 LECTURE SEVEN ILLUSTRATIONS Lecture Illustration 7.1: Share Valuation Data Original price (at start of year) Current price (at end of year) Earnings per share (Net profit no. of shares) Company... Date Added: 2009-04-23 22:36:42 |
| 1.Introduction.pdf Path: East Los Angeles College >> CS >> 189 Fall, 2009 Description: Foundations of Computing Professor Steve Schneider 30BB02 Course Structure Two lectures per week One tutorial per week (exercise sheets) Mathematics Surgeries: Room 44BB02, Wednesdays 10am. Course material posted on CS189 website. Assessment: Entir... Date Added: 2009-04-23 22:37:44 |
| CHR_GO2_Physical_Activity_Initiative.pdf Path: Wilfrid Laurier >> KNES >> 593 Fall, 2009 Description: Calgary Health Region Fall 2006/Winter 2007 Practicum Projects GO Calgarys Physical Activity Initiative 2 2-3 students, Coordinator: Jason Bostick Active Living Specialist Nutrition and Active Living Department Calgary Health Region jason.bostick@c... Date Added: 2009-04-23 22:38:50 |
| 01-Readme.txt Path: Wilfrid Laurier >> ATT >> 0612 Fall, 2009 Description: = SunExplorer Version 3.1.0 = This directory contains system configuration information. A complete list with explanation on what each file holds and how the data was obtained is included at the end of this file. Date information gathered: Wed Jan ... Date Added: 2009-04-23 22:38:56 |
| cvch5.pdf Path: East Los Angeles College >> MS >> 224 Fall, 2009 Description: r }{(gkv 9 ~ h j d f nf nf i d nf unehgeQdulQmxljx #pe|gdvgelfgQ g u z g z r }| k v}|{ } ( pw~eQmgug9smugdudgfugdg f f j hff d nf q d d d h j (dhQjd#xulf1yguTeflg... Date Added: 2009-04-23 22:40:04 |
| exercise6.pdf Path: East Los Angeles College >> MS >> 202 Fall, 2009 Description: MS202 Introduction to Metric Spaces 6 Exercise sheet 6 1. [Bryant, Exercise 92] Let F : C(, R) R , with = [0, 1], be given by F (x) = 2x( 1 ) ; 2 that is, for each member x C(, R), F (x) is the value 2x(t)|t= 1 . Show that f is 2 continuous, wit... Date Added: 2009-04-23 22:40:25 |
| LecturesCh4.pdf Path: Wilfrid Laurier >> ENEL >> 563 Fall, 2009 Description: 4. EVENT DETECTION 4 Event Detection Biomedical signals carry signatures of physiological events. Epoch: part of a signal related to a specific event. The analysis of a signal requires the identification of epochs and investigation of the correspon... Date Added: 2009-04-23 22:40:57 |
| ZhongminShi.ppt Path: Sveriges lantbruksuniversitet >> CMPT >> 825 Fall, 2009 Description: CMPT 825 Presentation Head-Driven Statistical Models for Natural Language Parsing Author: Michael Collins Speaker: Zhongmin Shi 04/22/09 1 Road Map Head-Driven Lexicalized PCFGs Three parsing models Some refinements Experiment Results Concl... Date Added: 2009-04-23 22:41:17 |
| mysql_05_ass_q.txt Path: Brookdale >> HINF >> 6220 Fall, 2009 Description: # # # Dalhousie University # HINF 6220 - Tutorial Assignment #1 # # # Question # - Considering the available database used in the tutorial sections please create the following SQL statements # Part: 1 # # # # Find all of the patients who... Date Added: 2009-04-23 22:42:47 |
| freehills-2007.ppt Path: Allan Hancock College >> SE >> 4921 Fall, 2009 Description: Roger Henning Stuart Irvine Why intellectual property? Picture this leave university idea create a company for RD for _ years results in software product product launch Question: 1. why? 2. how? InterTrust Technolog... Date Added: 2009-04-23 22:43:07 |
| ass1.pdf Path: Allan Hancock College >> CS >> 4415 Fall, 2009 Description: COMP4415 Assignment 1 2003 March 12, 2003 Assignments will contain a set of problems of various degrees of complexity. To pass, you need to solve at least the EASY problems. Some of the problems may be very hard indeed, so just do your best and subm... Date Added: 2009-04-23 22:43:15 |
| HPSC1400_Lecture_9.ppt Path: Allan Hancock College >> HPSC >> 1400 Fall, 2009 Description: HPSC1400/SCOM1011 Science, Technology, Society and Environment Lecture 9 How Science Develops without a Method: Kuhns Theory of History of Science The Most Famous Historian of Science in the History of the World: Thomas S. Kuhn In 1962, Thomas K... Date Added: 2009-04-23 22:43:57 |
| STEIN_ARTICLE.doc Path: Allan Hancock College >> LAWS >> 2411 Fall, 2009 Description: SAME STRUGGLE, DIFFERENT DIFFERENCE: ADA ACCOMMODATIONS AS ANTIDISCRIMINATION Michael Ashley Stein* The Americans with Disabilities Act (ADA) was heralded as an \"emancipation proclamation\" for people with disabilities, one that would achieve their eq... Date Added: 2009-04-23 22:46:01 |
| StacksQueues.ppt Path: Sveriges lantbruksuniversitet >> CS >> 120 Fall, 2009 Description: Stacks and Queues Introduction to Computing Science and Programming I Data Structures Data structures are different structures that can be used to store data. Different structures will organize it differently causing differences in ho... Date Added: 2009-04-23 22:47:30 |
| lect23-decode.ppt Path: Allan Hancock College >> ELEC >> 2041 Fall, 2009 Description: ELEC2041 Microprocessors and Interfacing Lectures 23: Instruction Representation; Assembly and Decoding http:/webct.edtec.unsw.edu.au/ May 2006 Saeid Nooshabadi saeid@unsw.edu.au ELEC2041 lec23-decode.1 Saeid Nooshabadi Overvie w What computers re... Date Added: 2009-04-23 22:48:24 |
| lecture1.pdf Path: Sveriges lantbruksuniversitet >> CS >> 275 Fall, 2009 Description: CMPT 275 Software Engineering Course Information FALL 2008 1 Best Sources of Information Extensive information about course content and expectations for successful course completion can be found By attending lectures By reading the textbook and oth... Date Added: 2009-04-23 22:48:52 |
| Davison07.pdf Path: Sveriges lantbruksuniversitet >> CS >> 821 Fall, 2009 Description: 1052 IEEE TRANSACTIONS ON PATTERN ANALYSIS AND MACHINE INTELLIGENCE, VOL. 29, NO. 6, JUNE 2007 MonoSLAM: Real-Time Single Camera SLAM Andrew J. Davison, Ian D. Reid, Member, IEEE, Nicholas D. Molton, and Olivier Stasse, Member, IEEE AbstractWe p... Date Added: 2009-04-23 22:51:24 |
| bgp.ppt Path: Sveriges lantbruksuniversitet >> CS >> 765 Fall, 2009 Description: Borde Gate r way Protocol (BGP) 1 C nts onte I nte t conne rne ctivity and BGP conne ctivity se s, ASre rvice lationships BGP Basics BGP se ssions, BGP m ssage BGP attribute e s, s BGP Policy C ontrol: Exam s ple C filte m chanism isco... Date Added: 2009-04-23 22:51:38 |
| Ensc220-MakeupFinal-98-3.pdf Path: Sveriges lantbruksuniversitet >> ENSC >> 220 Fall, 2009 Description: ... Date Added: 2009-04-23 22:51:52 |
| assign01.pdf Path: Sveriges lantbruksuniversitet >> STAT >> 805 Fall, 2009 Description: Stat-805 Assignment 1 2007 Fall Term Due 14 September 2007 This assignment is available in electronic format at: http:/www.stat.sfu. ca/~cschwarz/Stat-805/Assignments/assign01.pdf. 1. Most Probable Number. The Most Probable Number (MPN) is a seria... Date Added: 2009-04-23 22:53:20 |
| lec07.ppt Path: East Los Angeles College >> CIT >> 2310 Fall, 2009 Description: CIT2310 The Music Industry and the Internet Register Todays Lecture Integrating media into web sites Recap: How the WWW works Delivering media Downloading Streaming Psuedostreaming Different media file formats Integrating Media into a Web... Date Added: 2009-04-23 22:53:27 |
| web.pdf Path: Sveriges lantbruksuniversitet >> STAT >> 804 Fall, 2009 Description: Identiability, Invertibility Defn: If {t} is a white noise series and and b0, . . . , bp are constants then Xt = + b0t + b1t1 + + bptp is a moving average of order p; write M A(p). Q: From observations on X can we estimate the bs and 2 = Var(t)... Date Added: 2009-04-23 22:53:34 |
| P-BytesOfLife-Projects.pdf Path: Wilfrid Laurier >> CPSC >> 605 Fall, 2009 Description: Bytes of Life MDSC/CPSC 605 Przemyslaw Prusinkiewicz pwp@cpsc.ucalgary.ca Suggested topics for term papers/projects 1) Simulation model of the root growth and tropism in Arabidopsis thaliana: the role of the auxin flow. 2) Simulation model of the au... Date Added: 2009-04-23 22:55:55 |
| lecture07.doc Path: Sveriges lantbruksuniversitet >> MBB >> 308 Fall, 2009 Description: MBB 308 Lecture 7 VECTORS: V. Cosmids VI. YACs, P1, other vectors for large DNA inserts Cosmids: (text pp 65, 66) V. Cosmid = a plasmid, with typical AmpR, plasmid ori and cloning sites. It also contains one or more lambda cos sites (hence cosmid) ... Date Added: 2009-04-23 22:57:04 |
| 18_sampling.pdf Path: Sveriges lantbruksuniversitet >> CMPT >> 361 Fall, 2009 Description: Signals and sampling Sampling Issues, Aliasing, and Antialiasing Richard (Hao) Zhang Introduction to Computer Graphics CMPT 361 Lecture 18 Reference: Section 14.10 of Foley et al. March 23, 2009 1 Signal: a function f(x) that conveys certain inform... Date Added: 2009-04-23 22:57:23 |
| splines.pdf Path: Sveriges lantbruksuniversitet >> MACM >> 316 Fall, 2009 Description: Cubic Splines MACM 316 1/14 Cubic Splines Given the following list of points: x : y : a = x0 < x1 < < xn = b y0 y1 yn Basic idea: piecewise polynomial interpolation Use lower order polynomials that interpolate on each subinterval [xi, xi+1]... Date Added: 2009-04-23 22:57:37 |
| hwk1.txt Path: Sveriges lantbruksuniversitet >> MATH >> 3073 Fall, 2009 Description: ASSIGNMENT #1 (due Wednesday January 22, 2003) = p. 8: #1, 2 p. 17: #2, 4 p. 26: #3 p. 41: #1, 2, 3 ... Date Added: 2009-04-23 22:57:41 |
| w13lab.txt Path: Sveriges lantbruksuniversitet >> M >> 202 Fall, 2009 Description: worksheet for lab #13 - a) read the nature article on randomizing the deck, \"shuffling: what\'s the deal?\" b) quickly read the other web article, make note of the gray box describing the GSR shuffling algorithm. c) download the .m files for th... Date Added: 2009-04-23 22:57:43 |
| page84_2.doc Path: Sveriges lantbruksuniversitet >> PAGE >> 110 Fall, 2009 Description: 1/18 CMNS354TEDASESSIONFall2006: Designingananimate GROUPPARTICIPANTS:(name,#) 1.name,#) 2.name,#) 3.name,#) 4.name,#) 5.name,#) 6.name,#) 7.name,#) 8.name,#) I.Vitalsettings 1. Dwelling: Theanimatecouldenhance 1. 2. 3. 4. Theanimatecouldobsolesc... Date Added: 2009-04-23 22:59:11 |
| page84_2.doc Path: Sveriges lantbruksuniversitet >> PAGE >> 133 Fall, 2009 Description: 1/18 CMNS354TEDASESSIONFall2006: Designingananimate GROUPPARTICIPANTS:(name,#) 1.name,#) 2.name,#) 3.name,#) 4.name,#) 5.name,#) 6.name,#) 7.name,#) 8.name,#) I.Vitalsettings 1. Dwelling: Theanimatecouldenhance 1. 2. 3. 4. Theanimatecouldobsolesc... Date Added: 2009-04-23 22:59:22 |
| ZZIst_dexams.doc Path: East Los Angeles College >> PY >> 303 Fall, 2009 Description: UNIVERSITY OF EAST LONDON SCHOOL OF PSYCHOLOGY Course: Level: Subject: M.Sc. Occupational 2 TRAINING AND DEVELOPMENT (PYM402) Date: Time: Duration: 16th May 2005 2.00-3.30 p.m. 1 hours __ INSTRUCTIONS TO CANDIDA... Date Added: 2009-04-23 23:00:48 |
| Slides_SKB_8.pdf Path: East Los Angeles College >> CS >> 6242 Fall, 2009 Description: Orthogonal Frequency Division Multiplexing Multi-carrier modulation: divide high speed serial data stream into many parallel low speed data streams. C/f Frequency Hopping using all the frequencies at once. No need for Nyquist filtering of individu... Date Added: 2009-04-23 23:01:56 |
| hpirpi.pdf Path: Sveriges lantbruksuniversitet >> ECON >> 811 Fall, 2009 Description: Analysis of Barclays Capital HPI-RPI Swap 11 November 2001 Barclays Capital wishes to enter into a 15 year swap on the dierence between the growth of the British Retail Price Index and the British Housing Price Index over the interval. Let the level ... Date Added: 2009-04-23 23:02:42 |
| Tut7_sol.ppt Path: Allan Hancock College >> IT >> 31436 Fall, 2009 Description: 31436 Systems Software Networks - Tutorial 7: Input/Output Operations 1 QUESTION 1 Define and explain the following disk scheduling algorithms... Date Added: 2009-04-23 23:04:44 |
| hw3.pdf Path: Sveriges lantbruksuniversitet >> APMA >> 900 Fall, 2009 Description: APMA 900-4 Mathematical Methods I Problem Set 3 Integral Asymptotics and Boundary Layers Fall 2003 Due Monday, 17 November 2003 Course Web Site: http:/www.math.sfu.ca/ralfw/apma900/ 1. Taylor Series and Steepest Descent Let f (z) be an entire (eve... Date Added: 2009-04-23 23:05:31 |
| m249-f05quiz2asoln.pdf Path: Wilfrid Laurier >> MATH >> 249 Fall, 2009 Description: Math 249 Lecture 01 Quiz 2: Wednesday, October 12 NAME: [3 pts] 1. The figure below represents the graph of y = f (x). Which of the statements about limits describes the vertical asymptote at x = a? x=a (a) limxa f (x) = +; (b) limxa+ f (x) = + an... Date Added: 2009-04-23 23:06:29 |
| m249-f05quiz5asoln.pdf Path: Wilfrid Laurier >> MATH >> 249 Fall, 2009 Description: Math 249 Lecture 01 Quiz 5: Wednesday, December 7 NAME: Lab instructor and Section (circle one): Lab 1: Wes Maciejewski [3 pts] Lab 2: Jia Shen 4 1. Which of the following functions is an antiderivative of the function f (x) = x3 ex ? (a) x4 x4 e ;... Date Added: 2009-04-23 23:06:33 |
| lecture1.pdf Path: East Los Angeles College >> CS >> 2121 Fall, 2009 Description: COMP20121 The Implementation and Power of Computer Languages Power Part http:/www.cs.man.ac.uk/petera/2121/index.html Peter Aczel room: CS2.52, tel: 56155 email: petera@cs.man.ac.uk Department of Computer Science, University of Manchester COMP2012... Date Added: 2009-04-23 23:06:59 |
| Committees.pdf Path: East Los Angeles College >> CS >> 6482 Fall, 2009 Description: Lecture 2.4 Committees of Neural Networks and Boosting Slide 0 Jonathan Shapiro Department of Computer Science, University of Manchester February 2, 2003 Committees of Trained Neural Networks Suppose you have trained a number of neural network on t... Date Added: 2009-04-23 23:07:34 |
| 01-MESPOM_Application_Form_Scholars.doc Path: UC Davis >> LOG >> 0503 Fall, 2009 Description: WWW.MESPOM.ORG, info@mespom.org IIIEE,Box196,Tegnrplatsen4,22100SELund,Sweden Application Form for Visiting Scholars Please complete this form electronically and submit as an MS Word file, pdf or printed document. I. Personal Data Family or last na... Date Added: 2009-04-23 23:07:59 |
| fwojp2005390.pdf Path: Allan Hancock College >> FWOJP >> 2005390 Fall, 2009 Description: Published in Gazette 21.7.2005 p 2497 South Australia Fair Work (Assignment of Judge) Proclamation 2005 under sections 19 and 20 of the Fair Work Act 1994 Preamble 1 On 14 July 2005, a proclamation was made under sections 19 and 20 of the Fair Wor... Date Added: 2009-04-23 23:09:53 |
| lecture19.pdf Path: Sveriges lantbruksuniversitet >> ENSC >> 201 Fall, 2009 Description: Lecture 19: Linear Programming II (This material is not covered in Fleischer. A good reference text is Hillier and Lieberman, `Introduction to Operations Research\', published by Holden-Day; the fourth edition of this text came out in 1986, and a fift... Date Added: 2009-04-23 23:10:51 |
| consumptionricardianequivalence.pdf Path: East Los Angeles College >> SEDM >> 1375 Fall, 2009 Description: Topic 2: Aggregate consumption; Ricardian Equivalence 1. What is wrong with the traditional Keynesian consumption function, if anything? The traditional Keynesian consumption function is of the form C=C0+cY, where c=(1-t)(1-s) is the marginal propens... Date Added: 2009-04-23 23:11:43 |
| pollution.pdf Path: East Los Angeles College >> SEDM >> 3306 Fall, 2009 Description: Pollution as externality Jacob Lundberg Pollution as externality Why are pollution problems often best understood as externalities? Can we rely on private agents to negotiate these away? If not, what should the government do about pollution problem... Date Added: 2009-04-23 23:11:50 |
| MIT-Sorting.pdf Path: Sveriges lantbruksuniversitet >> CS >> 307 Fall, 2009 Description: Introduction to Algorithms 6.046 Lecture 6 Prof. Shafi Goldwasser September 24, 2001 L5.1 How fast can we sort? All the sorting algorithms we have seen so far are comparison sorts: only use comparisons to determine the relative order of elements. ... Date Added: 2009-04-23 23:11:58 |
| htscfilters1.pdf Path: East Los Angeles College >> ENG >> 106 Fall, 2009 Description: INSTITUTE OF PHYSICS PUBLISHING Supercond. Sci. Technol. 18 (2005) 12531258 SUPERCONDUCTOR SCIENCE AND TECHNOLOGY doi:10.1088/0953-2048/18/10/001 A compact, higher order, high temperature superconductor microstrip bandpass filter on a two-inch lant... Date Added: 2009-04-23 23:12:17 |
| Lecture3-os-support.ppt Path: Sveriges lantbruksuniversitet >> CMPT >> 431 Spring, 2009 Description: Lecture III: OS Support CMPT 401 Dr. Alexandra Fedorova The Role of the OS The operating system needs to provide support for implementation of distributed systems We will look at how distributed systems services interact with the operating systems... Date Added: 2009-04-23 23:12:51 |
| Lecture_Intro.pdf Path: East Los Angeles College >> COMP >> 202 Fall, 2009 Description: COMP202 Complexity of Algorithms Introductory Lectures COMP202: Complexity of Algorithms Lecturer: Russell Martin, Room 319 Ashton Building, email: Russell.Martin (at) liverpool.ac.uk Lectures: Monday (11am), Wednesday (12pm) and Friday (11am) Asse... Date Added: 2009-04-23 23:13:20 |
| SE_L25L26.ppt Path: East Los Angeles College >> COMP >> 201 Fall, 2009 Description: Verification and Validation Lecture 25 Lecture 26 Software Engineering, COMP201 Slide 1 Verification and Validation Assuring that a software system meets a user\'s needs Software Engineering, COMP201 Slide 2 Objectives q q q q To introduce ... Date Added: 2009-04-23 23:13:49 |
| comp527-12.pdf Path: East Los Angeles College >> COMP >> 527 Fall, 2009 Description: COMP527: Data Mining COMP527: Data Mining DrRobertSanderson (azaroth@liv.ac.uk) Dept.ofComputerScience UniversityofLiverpool 2008 Classification: SVM January 18, 2008 Slide 1 COMP527: Data Mining COMP527: Data Mining InputPreprocessing Attrib... Date Added: 2009-04-23 23:14:52 |
| baseStates.doc Path: Sveriges lantbruksuniversitet >> GEOG >> 355 Fall, 2009 Description: State Income Linear Fuzz 26 billion 2200 billion State Income*Pop assign State GDP Alberus Projection State Projected US States Pointras US States Fuzzy state GDP Import ESRI format Linear Fuzz 1million 20million Fuzz state pop State Pop Edit A... Date Added: 2009-04-23 23:15:46 |
| nov07.pdf Path: Cameron >> CIS >> 1013 Fall, 2009 Description: CIS-1013 Intro to Comp Info Sys Fall 2008 Activities Friday, November 7 1. Demonstrated how to work with time values in MS-Excel. 2. Met in the computer lab and created a time card in the following format. This lab assignment must be turned in as a... Date Added: 2009-04-23 23:16:00 |
| TutorialQuestions1.pdf Path: East Los Angeles College >> PHYS >> 258 Fall, 2009 Description: 2004/2005 PHYS258 First Semester Waves and Related Phenomena Tutorial questions Set 1 of 4 Take this work to the tutorial: see notice board for details 1. A wave is described by the equation: ( y, t ) = 2.4 sin(12.4 y + 17t ) where all of the ... Date Added: 2009-04-23 23:16:32 |
| 305hw4a.pdf Path: Sveriges lantbruksuniversitet >> ECON >> 305 Fall, 2009 Description: Problem Set #4 Answer Key Economics 305: Macroeconomic Theory Spring 2007 1 Chapter 5, Problem #5 If the government chooses G so as to make Y as large as possible, since the eect of an increase in G is to increase Y and decrease C, the government ... Date Added: 2009-04-23 23:17:27 |
| 10_illum.pdf Path: Sveriges lantbruksuniversitet >> CMPT >> 361 Fall, 2009 Description: Local Illumination CMPT 361 Introduction to Computer Graphics Torsten Mller Machiraju/Zhang/Mller Graphics Pipeline Hardware Modelling Transform Visibility Illumination + Shading Perception, Interaction Machiraju/Zhang/Mller Color Texture/ Rea... Date Added: 2009-04-23 23:19:56 |
| human_activity.ppt Path: Sveriges lantbruksuniversitet >> CMPT >> 467 Fall, 2009 Description: Recognizing Human Figures and Actions Greg Mori Simon Fraser University Goal Action recognition Where are the people? What are they doing? Applications Image understanding, image retrieval and search HCI Surveillance Computer Graphics Far ... Date Added: 2009-04-23 23:20:10 |
| relativity_2005_lecture_4.pdf Path: East Los Angeles College >> PHY >> 314 Fall, 2009 Description: PHY-314 Relativity, Lecture 4 Algebra of Tensor Components Objects Met So Far and their Transformations Vectors. Invariant under coordinate transformations. Transformation: Vector Components Scalar Fields, Invariant under coordinate transforms. ... Date Added: 2009-04-23 23:20:18 |
| lesson7.ppt Path: Sveriges lantbruksuniversitet >> BUS >> 312 Fall, 2009 Description: What would you be willing to pay right now for a bond which pays a coupon of 6.5% per year for 3 years, has a face value of $1,000. Assume that similar 3 year bonds offer a return of 5.1%. 1 Bond Prices and Yields What is a Bond Worth? To det... Date Added: 2009-04-23 23:22:27 |
| Effect_of_Lith_Thk.pdf Path: Wilfrid Laurier >> GOPH >> 681 Fall, 2009 Description: 100 Effect of Lithospheric Thickness Boxcar load magnitude = 15 MPa 0 Vertical Displacement (M) -100 w(0)200km -200 w(0)150km w(z=0)100km -300 w(z=0) 75km w(z=0) 50km -400 w(z=0) 25km -500 0 500 1000 1500 2000 2500 Distance from the Load Center... Date Added: 2009-04-23 23:24:02 |
| 74LS161.pdf Path: Sveriges lantbruksuniversitet >> PHYS >> 430 Fall, 2009 Description: ... Date Added: 2009-04-23 23:24:13 |
| Midterm-06.pdf Path: Wilfrid Laurier >> ENCH >> 405 Fall, 2009 Description: ... Date Added: 2009-04-23 23:25:25 |
| xx_ProjectInstructions.pdf Path: RMCAD >> EE >> 573 Fall, 2009 Description: :selbareviled ruof tnemenifer evitareti fo ssecorp a hguorht ledom eht evlove ledom LMU tnetsisnoc a fo mrof eht ni ngised dna sisylana taht tneserper metsys erawtfos xelpmoc yletaredom a fo ngised dna sisylana detneiro-tcejbo eht tcudnoc weivrevO t... Date Added: 2009-04-23 23:26:09 |
| Class_2.pdf Path: East Los Angeles College >> SCRO >> 0919 Fall, 2009 Description: Edoardo Gallo 2nd Year Microeconomics Class 2: Industrial Organization Reading Read Kreps (1990), chapters 11-14, again, this time focus on the IO concepts. The best book on IO is Tirole (1988), it is more advanced but definitely worth the effort. ... Date Added: 2009-04-23 23:26:44 |
| pressreleases.doc Path: SUNY Albany >> DP >> 1056 Fall, 2009 Description: PeoplesRepublicofCornucopia MinistersBriefing Amy Fires Minister at Large Office of Public Affairs 6-507PA Cornucopia Road. Corn Utopia 6-507-I Fax: (518) 507-5076 CONTACT: Minister at Large Amy Fires (507) 507-5077 FOR IMMEDIATE RELEASE: Octobe... Date Added: 2009-04-23 23:29:04 |
| handbook.pdf Path: East Los Angeles College >> KU >> 02309 Fall, 2009 Description: Module Handbook Module Title: Business Mathematics Module Code: BB1666 Programme: Business Information Technology Lecturers Name Dan Russell Barry Avery Room EMail WWW 66 djrussell@kingston http:/www.kingston.ac.uk/~ bs s477 339 b.avery@kingston h... Date Added: 2009-04-23 23:29:19 |
| meier-rauch.pdf Path: Colby >> EC >> 333 Fall, 2008 Description: ... Date Added: 2009-04-23 23:29:30 |
| C122lec11GL.pdf Path: Sveriges lantbruksuniversitet >> C >> 122 Fall, 2009 Description: Lecture 11 Last Day: February 11, 2009 Acids and Bases (Chapter 7) The nature of Acids and Bases Acid Strength Calculating pH of Solutions Today: Acids and Bases (Chapter 7) Acid Dissociation and Dilution Polyprotic Acids 7.1) : O: H + H The Nat... Date Added: 2009-04-23 23:30:03 |
| presentation1.pdf Path: Air Force Academy >> CS >> 371 Fall, 2009 Description: ... Date Added: 2009-04-23 23:31:42 |
| Chapter9.pdf Path: Lourdes >> BUS >> 101 Spring, 2009 Description: Producing Quality Goods and Services Prentice Hall, 2007 Excellence in Business, 3e Chapter 9 - 1 What Is Production? Leading Production Operations Management (POM) Organizing Planning Controlling Prentice Hall, 2007 Excellence in Business,... Date Added: 2009-04-23 23:31:51 |
| Multimedia.pdf Path: East Los Angeles College >> IS >> 346 Fall, 2009 Description: Multimedia http:/edtech.it.bton.ac.uk/is346-03/multimedia/index.html Multimedia http:/edtech.it.bton.ac.uk/is346-03/multimedia/issues.html Multimedia Some concerns Overview of some technologies Image formats Sound formats Video formats Streaming ... Date Added: 2009-04-23 23:33:36 |
| PDFTechniques.pdf Path: Air Force Academy >> MATH >> 101 Fall, 2009 Description: Exercises for Differentiation Techniques-1 Exercises for Differentiation Techniques Use the rules of differentiation to find f (x) : (1) (2) (3) (4) f (x) = (x + 1)2 Solution f (x) = (x + 2)3 Solution f (x) = (x + 3)4 Solution f (x) = x + ... Date Added: 2009-04-23 23:35:14 |
| PleasantEventsSchedule.pdf Path: Maple Springs >> PSYCH >> 4030 Fall, 2009 Description: PLEASANT EVENTS SCHEDULE 1. 4. 7. 10. 13. 16. 19. 22. 25. 28. 31. 34. 37. 40. 43. 46. 49. 52. 55. 58. 61. 64. 67. 70. 73. 76. 79. 82. 85. 88. 91. 94. 97. Acting Attending a concert, opera, or ballet Being asked for help or advice Being at the beach B... Date Added: 2009-04-23 23:38:30 |
| pset5.pdf Path: McGill >> PHYSICS >> 514 Fall, 2009 Description: Physics 514, Problem Set 5 due: Tuesday, March 3, 5 PM Please turn your solutions in to Nima Lashkari or place them in his mailbox in the physics department mailroom before the due date. You are encouraged to discuss these problems with your colleag... Date Added: 2009-04-23 23:38:44 |
| 93_1_a.pdf Path: Maple Springs >> ECON >> 2300 Fall, 2009 Description: Econ 2300BY : Answers to Assignment 1 : Oct. 1993 1. (a) With this price schedule, increasing the weight of the load from 1999.99 pounds to 2000.01 pounds lowers the amount paid, not just on the last few ounces, but on the entire load. So increasing... Date Added: 2009-04-23 23:39:09 |
| SampleCase1.pdf Path: CSU Fullerton >> BCS >> 461 Winter, 2009 Description: Domain Planning/Implementation Case Company Details Bayside Inc. is about to install a new Active Directory-based network. (Were using the same company name, since thats the name of the top-level domain in our W2K installation!). The company has 12 e... Date Added: 2009-04-23 23:39:11 |
| Quiz2.pdf Path: McGill >> CIM >> 250 Fall, 2009 Description: QUIZ 2 Introduction to Computer Science (COMP 250) Mon. March 2, 2009 Professor Michael Langer STUDENT NAME: ID: The exam consists of five questions. There are a total of 10 points. You may use the back of the sheet, if necessary. No electronic devi... Date Added: 2009-04-23 23:39:11 |
| solutions-3.pdf Path: Air Force Academy >> EE >> 404 Fall, 2009 Description: EE351Spectrum Analysis and Discrete Time Systems (Fall 2005) SOLUTIONS Solutions to Assignment 3 1. Use the denition of the convolution integral to derive the following properties: [3] (a) Shifting: x(t) (t t0 ) = x( )(t t0 )d x(t t0 )(t... Date Added: 2009-04-23 23:40:22 |
| m209p90_44.doc Path: Athens Tech >> MATH >> 216 Fall, 2009 Description: Math 209 page 90 #44 Write an equation of the lowest-degree polynomial function with the graph with the graph and intercepts shown in the figure. Solution: (2, 0) and (1, 0) are on the graph of the polynomial function. f ( 2) = 0 and f (1) = 0 . Let... Date Added: 2009-04-23 23:40:52 |
| coen24402sfsol.doc Path: Contra Costa College >> COEN >> 244 Fall, 2009 Description: Solutions. Restricted. Course Number Section Programming Methodology II Examination Date COEN 244 Time CC # of pages Final Examination Instructor (s) August 2002 3 Hours 6 Prof. David Gaudine Material allowed : No Yes X Calculators allowed ... Date Added: 2009-04-23 23:41:33 |
| CEO_speaker_profiles.pdf Path: Allan Hancock College >> BUSINESS >> 6553737 Fall, 2009 Description: SPEAKER PROFILES Adjunct Professor James Strong James Strong has worked in a wide variety of roles and business including: training as a military officer at Duntroon; management of a large mining group; head of industry representation; Chief Executi... Date Added: 2009-04-23 23:42:15 |
| le_31_07.pdf Path: Air Force Academy >> L >> 225 Fall, 2009 Description: Sasha Koustov EP 225: Waves, Fields & Optics Fraunhofer Diraction (single slit) Lecture #31 Fraunhofer diffraction on a single slit General formula. Light maxima. I = I0 [ sin(/2) ]2 /2 Light minima a sin = m, m = 1, 2, 3. = 2 a sin Eect of ... Date Added: 2009-04-23 23:44:01 |
| 06Assignment1.doc Path: Wilfrid Laurier >> ENCM >> 415 Fall, 2009 Description: ENCM415 Assignment 1 due Sunday 24th September One report per laboratory group Subject with cover letter indicating that your own work Updated 13th September 2006 Submit as a word document file with screen captures inserted showing successful comple... Date Added: 2009-04-23 23:44:10 |
| shab2000257.txt Path: Allan Hancock College >> SHAB >> 2000257 Fall, 2009 Description: 1 State Housing Amendment STATE HOUSING AMENDMENT BILL 2000 EXPLANATORY NOTES SHORT TITLE State Housing Amendment Bill 2000 GENERAL OUTLINE Ob... Date Added: 2009-04-23 23:44:38 |
| asn2.pdf Path: Air Force Academy >> M >> 313 Fall, 2009 Description: University of Saskatchewan Department of Mathematics and Statistics Numerical Analysis II: Numerical Linear Algebra (MATH 313) Instructor: Dr. Raymond J. Spiteri ASSIGNMENT 02 Due: 10:00 a.m. Tuesday, October 28, 2008 1. [15 marks] Implement Algorith... Date Added: 2009-04-23 23:44:41 |
| mdj-coots01.ppt Path: Air Force Academy >> CJD >> 032 Fall, 2009 Description: Multi-Dispatch in the Java Virtual Machine: TM Design and Implementation Computing Science University of Alberta Chris Dutchyn (dutchyn@cs.ualberta.ca) Paul Lu (paullu@cs.ualberta.ca) Duane Szafron (duane@cs.ualberta.ca) Steve Bromling (bromling@cs.... Date Added: 2009-04-23 23:44:45 |
| CategoryTheory.pdf Path: Sveriges lantbruksuniversitet >> CMPT >> 481731 Fall, 2009 Description: CMPT 481/731 Functional Programming Summer 2008 Category Theory Category theory is a generalization of set theory. By having only a limited number of carefully chosen requirements in the denition of a category, we are able to produce a general alg... Date Added: 2009-04-23 23:44:51 |
| tokenizer.pl.txt Path: East Los Angeles College >> LG >> 619 Fall, 2009 Description: % File sampleproj.pl - M. Covington - 2001 April 21 % A tokenizer using DCG rules. :- use_module(library(lists). % provides append/3 in SICStus Prolog % A test predicate to demonstrate that it works test :- token_list( Wh... Date Added: 2009-04-23 23:45:44 |
| JSPAppDesign.ppt Path: East Los Angeles College >> CC >> 292 Fall, 2009 Description: JSP Application Design CC292 Simon M. Lucas Main Features of JSP Get / Set properties Via getX setX naming patterns Has the advantage of auto-capturing form data Also: Other data fields on a Java Object can be set And then those values used in... Date Added: 2009-04-23 23:46:34 |
| lecture_11.pdf Path: Sveriges lantbruksuniversitet >> C >> 281 Fall, 2009 Description: Alkenes -carotene (orange pigment and vitamin A precursor) 1 Alkenes vare hydrocarbons that contain a carboncarbon double bond (C=C) general formula: CnH2n known as unsaturated compounds since they have fewer hydrogens than alkanes with the same... Date Added: 2009-04-23 23:46:59 |
| introduction.ppt Path: Air Force Academy >> YAZ >> 2300 Fall, 2009 Description: JavaProgramming,2E IntroductoryConcepts andTechniques Chapter 1 An Introduction to Java and Program Design Object-Oriented Programming Data and the operations on the data are packaged into a unit An interface of properties and functions is expose... Date Added: 2009-04-23 23:47:15 |
| intro.pdf Path: Sveriges lantbruksuniversitet >> SCI >> 300 Fall, 2009 Description: Materials by: Keith Slessor cience 300 Instructor: Erika Plettner C 8074 Science 300 A course for non-Science students presented to enhance: an appreciation of the impact of Science on society an understanding of how Science works and Units 1 NUM... Date Added: 2009-04-23 23:47:36 |
| support_class6.doc Path: East Los Angeles College >> EC >> 111 Fall, 2009 Description: Autumn Term EC111 Support Class 6 Week 11 Outline: Lecture notes 8 and 9 Labour Market Capital and Investment decisions Labour market 2008/09 Labour is an important factor of production. The labour market is the market where labour is exchanged. Pe... Date Added: 2009-04-23 23:50:08 |
| Assign2-2007.pdf Path: Air Force Academy >> ENGR >> 111 Fall, 2009 Description: GE 111.3 Engineering Problem Solving Assignment #2 Due: Sept. 25, 2007 1. The half-life of radioactive carbon 14 is 5700 years. After a plant or animal dies, the level of carbon 14 decreases as the radioactive carbon disintegrates. The decay of rad... Date Added: 2009-04-23 23:52:05 |
| ec371mc07.pdf Path: East Los Angeles College >> EC >> 371 Fall, 2009 Description: U NIVERSITY OF E SSEX D EPARTMENT OF E CONOMICS EC371 Economic Analysis of Asset Prices Multiple Choice Test 19th November 2007 Time allowed: 40 minutes. There are TWENTY questions, ALL of which should be answered. DO NOT START UNTIL YOU ARE IN... Date Added: 2009-04-23 23:52:46 |
| chem115d02.txt Path: Sveriges lantbruksuniversitet >> CHEM >> 19981 Fall, 2009 Description: PROFILE OF STUDENTS IN SFU COURSES COURSE: CHEM 115-2 D02 LOCATION: SFU TITLE: GENERAL CHEM LAB I SECTION TYPE: LAB SEMESTER: 1998-1 ENROL: 59... Date Added: 2009-04-23 23:53:16 |
| C122lec13GL.pdf Path: Sveriges lantbruksuniversitet >> C >> 122 Fall, 2009 Description: Lecture 13 Last Day: February 23, 2009 Acids and Bases (Chapter 7) Acid Dissociation and Dilution Polyprotic Acids Today: Acids and Bases (Chapter 7) Acid Base behaviour and Structure Bases Acid and Base Properties of Salts Polyprotic Acids (Acid... Date Added: 2009-04-23 23:55:31 |
| HW_1.pdf Path: Wilfrid Laurier >> ENME >> 603 Fall, 2009 Description: ... Date Added: 2009-04-23 23:56:48 |
| CHEM126D01.TXT Path: Sveriges lantbruksuniversitet >> CHEM >> 20012 Fall, 2009 Description: Sheet1 PROFILE OF STUDENTS IN SFU COURSES COURSE: CHEM 126-2 D01 LOCATION: SFU TITLE: GENERAL CHEM LAB II SECTION TYPE: LAB SEMESTER: 2001-2 ENROL: 51 = PROGRAM OF STUDENT (Top 5 programs reported in each category Programs with < 3 students not shown... Date Added: 2009-04-23 23:57:11 |
| ced404e01.txt Path: Sveriges lantbruksuniversitet >> ARTS >> 19963 Fall, 2009 Description: PROFILE OF STUDENTS IN SFU COURSES COURSE: CED 404-5 E01 LOCATION: DOW TITLE: PROJECT SECTION TYPE: SEC SEMESTER: 1996-3 ENROL: 6 ... Date Added: 2009-04-23 23:57:13 |
| Solns384_4.pdf Path: Sveriges lantbruksuniversitet >> PHYS >> 384 Fall, 2009 Description: Physics 384 Problem Set 4: Solutions 1. a) Let the string be attached to its support at y = 0. Then the mass below a point y along the string is M (y) = M +(L+y) (if we take y = -L to be the bottom of the string). The force balance equations in the u... Date Added: 2009-04-23 23:57:21 |
| Lecture13.ppt Path: Wilfrid Laurier >> MGIS >> 461 Fall, 2009 Description: TCP/IP: overview Standards originally by the U.S. Department of Defense Newer standards by Internet Activities Board (IAB) Is in \'competition\' with OSI TCP/IP is a mature, highly functional set of protocols OSI is evolving and actual protocols h... Date Added: 2009-04-23 23:57:32 |
| Lecture13.ppt Path: Wilfrid Laurier >> LECTURE >> 461 Fall, 2009 Description: TCP/IP: overview Standards originally by the U.S. Department of Defense Newer standards by Internet Activities Board (IAB) Is in \'competition\' with OSI TCP/IP is a mature, highly functional set of protocols OSI is evolving and actual protocols h... Date Added: 2009-04-23 23:57:32 |
| EPEU1-344.doc Path: Sveriges lantbruksuniversitet >> NUSC >> 344 Fall, 2009 Description: NUSC 344 ELEMENT PRODUCTION IN THE EARLY UNIVERSE EU- 1 References: Cauldrons in the Cosmos, Chapter 2, C. Rolfs and W. Rodney. The First Three Minutes, (1977), S. Weinberg Element Production in the Early Universe, D. Schramm and R.V. Wagoner, Ann.... Date Added: 2009-04-23 23:58:10 |
| MP037.pdf Path: East Los Angeles College >> MEDIA >> 19969 Fall, 2009 Description: CHARTERED INSTITUTE OF PURCHASING & SUPPLY FOUNDATION DIPLOMA DURATION The five Units (see Contents and Assessment) are studied one at a time, over a two-year rolling programme, starting September of Academic Year 1 and finishing May of Academic Year... Date Added: 2009-04-23 23:58:19 |
| Ec967tp_2009.pdf Path: East Los Angeles College >> EC >> 967 Fall, 2009 Description: Department of Economics University of Essex Session 2008/09 Spring Term Joo Santos Silva EC967 Empirical Methods of Economics and Finance Term paper titles 20082009 Details of assessment and submission deadlines are contained in the Postgraduate Ec... Date Added: 2009-04-23 23:58:30 |
| CRIM230ALL.TXT Path: Sveriges lantbruksuniversitet >> ARTS >> 19993 Fall, 2009 Description: Sheet1 PROFILE OF STUDENTS IN SFU COURSES COURSE: CRIM 230-3 ALL SECTIONS LOCATION: SFU TITLE: CRIMINAL LAW SECTION TYPE: LEC SEMESTER: 1999-3 ENROL: 72 = PROGRAM OF STUDENT (Top 5 programs reported in each category Programs with < 3 students not sho... Date Added: 2009-04-23 23:59:34 |
| ex04.pdf Path: East Los Angeles College >> EC >> 371 Fall, 2009 Description: U NIVERSITY OF E SSEX Session 200809 D EPARTMENT OF E CONOMICS R. E. Bailey EC371 Economic Analysis of Asset Prices Exercise 4: Portfolio Selection: The Mean-Variance Model 1. An investor chooses a portfolio comprising one risky asset with expected... Date Added: 2009-04-24 00:00:26 |
| lec07.ppt Path: East Los Angeles College >> CL >> 0708 Fall, 2009 Description: Lecture 7: Schema refinement: Normalisation www.cl.cam.ac.uk/Teaching/current/Databases/ 1 Decomposing relations In previous lecture, we saw that we could decompose the bad relation schema Data(sid,sname,address,cid,cname,grad e) to a better set... Date Added: 2009-04-24 00:01:12 |
| lec_03.pdf Path: East Los Angeles College >> CL >> 0809 Fall, 2009 Description: Databases Lecture 3 Timothy G. Grifn Computer Laboratory University of Cambridge, UK Databases, Lent 2009 T. Grifn (cl.cam.ac.uk) Databases Lecture 3 DB 2009 1 / 22 Lecture 03: Outline Joining Tables Foreign Keys What is NULL in SQL? The need ... Date Added: 2009-04-24 00:01:16 |
| V-SculptingValueShapes.ppt Path: East Los Angeles College >> SS >> 248 Fall, 2009 Description: Risk Management & Real Options V. Designing a system means sculpting its value shape Stefan Scholtes Judge Institute of Management University of Cambridge MPhil Course 200405 Where are we? I. II. Introduction The forecast is always wrong I. II. ... Date Added: 2009-04-24 00:02:38 |
| topics.pdf Path: Air Force Academy >> EE >> 292 Fall, 2009 Description: Getting Started Getting Started - Section Contents What is MATLAB? Starting MATLAB Manipulating your Workspace What\'s in the Workspace Saving the Workspace Clearing the Workspace Retrieving a Saved Workspace Summary of Workspace Commands Quitting MAT... Date Added: 2009-04-24 00:02:52 |
| almamemo573.pdf Path: East Los Angeles College >> BN >> 204 Fall, 2009 Description: ALMA Memo 573, 19; (2007) Printed 16 November 2007 ALMA MEMO 573 Limits on Phase Correction Performance Due to Differences Between Astronomical and Water-Vapour Radiometer Beams B. Nikolic, R. E. Hills and J. S. Richer Mullard Radio Astronomy Obser... Date Added: 2009-04-24 00:04:50 |
| PHIL235_Midterm_Study_Questions_T1_2008.pdf Path: Air Force Academy >> PHL >> 289 Fall, 2009 Description: PHIL 235 Midterm Study Questions The midterm will consist of an expository short answer section (one or more questions that can be answered in 100-200 words, i.e. 1-2 double-space pages) and an essay question (to be answered in 500-700 words). In eac... Date Added: 2009-04-24 00:05:35 |
| lecture-9.pdf Path: Air Force Academy >> P >> 121 Fall, 2009 Description: Lecture Example 11 A stone is thrown horizontally from a bridge, 20.0 m above a river. The initial speed of the stone is 30.0 m/s. (a) What is the time of flight of the stone? (b)What is the horizontal range? (c) What is the final velocity of the sto... Date Added: 2009-04-24 00:06:15 |
| hint_p25_54.pdf Path: Air Force Academy >> EP >> 229 Fall, 2009 Description: HINT: Problem 25-54 Serway Part a) For part a) of the problem there will be an integral to solve of the form: sec d To solve this integral use the substitution of u = sec + tan ; du = sec tan d + sec2 d. Finally solve the integral reformed as: sec ... Date Added: 2009-04-24 00:06:15 |
| Lecture_example-34.pdf Path: Air Force Academy >> P >> 111 Fall, 2009 Description: Two Lens Example: Lecture Example 34 Lens 1, f1 = +10 cm L = 40 cm do1 = 15 cm di1 = 30 cm Image 1 = Object 2 F2 Lens 2, f2 = +15 cm do2 = L di1 = 10 cm F1 Object m1 = -2.0 m2 = +3.0 m = m1m2 = -6.0 F1 F2 Image 2 di2 = -30 cm ... Date Added: 2009-04-24 00:07:00 |
| etd0482.pdf Path: Sveriges lantbruksuniversitet >> IR >> 239 Fall, 2009 Description: A Dividend Yield-based Trading Rule with Industry Data by Daryl Purdy Bachelor of Mathematics - Honours Business Administration, University of Waterloo (1994) PROJECT SUBMITTED IN PARTIAL FULFILLMENT OF THE REQUIREMENTS FOR THE DEGREE OF MASTER OF BU... Date Added: 2009-04-24 00:07:32 |
| etd0482.pdf Path: Sveriges lantbruksuniversitet >> LIB >> 239 Fall, 2009 Description: A Dividend Yield-based Trading Rule with Industry Data by Daryl Purdy Bachelor of Mathematics - Honours Business Administration, University of Waterloo (1994) PROJECT SUBMITTED IN PARTIAL FULFILLMENT OF THE REQUIREMENTS FOR THE DEGREE OF MASTER OF BU... Date Added: 2009-04-24 00:07:32 |
| e103HClect09.pdf Path: Sveriges lantbruksuniversitet >> E >> 103 Fall, 2009 Description: ExchangeIIMarketDemand Thewaytolookattheexchangebetweenmanypeopleistolookatthemarketdemandandsupply curves Themarketdemandcurveisahorizontalsumoftheindividualdemands Rememberthattheareaunderanindividualdemandcurveuptosomequantityqisatotalvalueofq uni... Date Added: 2009-04-24 00:07:36 |
| Antiderivatives.pdf Path: Air Force Academy >> MATH >> 298 Fall, 2009 Description: 2002 D.W.MacLean: Antiderivatives-1 Antiderivatives Denition: of f on I. We write f (x) dx = F (x) + C, and dont usually (but probably should) refer to the interval I. 4x 3 dx = x 4 + C on the interval (, ). ex dx = ex + C on the interval (, ). 1 dx... Date Added: 2009-04-24 00:08:19 |
| 4xml6.pdf Path: Arkansas Little Rock >> CS >> 391 Fall, 2009 Description: Contents Chapter 4 XML and Database Semistructured data XML & DTD introduction XML Schema user-defined data types, integrity constraints XPath core query language for XML XQuery full-featured query language for XML XML and Database Manage... Date Added: 2009-04-24 00:08:43 |
| chapt14.ppt Path: Charleston Law >> BU >> 627 Fall, 2009 Description: CHAPTER 14 CurrentLiabilitiesand Contingencies FINANCIAL INSTRUMENTS Liabilities and equity The issuer of a financial instrument should classify the instrument, or its component parts, as a liability or as equity in accordance with the substance of... Date Added: 2009-04-24 00:08:58 |
| Class10.pdf Path: Charleston Law >> BU >> 288 Fall, 2009 Description: Class Ten Agenda/Topics to be Covered Last Class Reflection Exercise : Carter Racing Readings- key points Next class expectations Organizational Behaviour BU288 Instructor: Jan Varner 2 What does the case demonstrate? Managers face problems when m... Date Added: 2009-04-24 00:09:03 |
| Assignment_1.doc Path: Charleston Law >> BU >> 205 Fall, 2009 Description: BU205 Assignment #1 Due: October 19th, 2004 Ex. 2.33, 2.67, 4.35, 4.57, 4.89, 6.29, 6.43, 6.57, 7.67, 7.95, 8.51 ... Date Added: 2009-04-24 00:09:13 |
| plagiat.pdf Path: Neumont >> IFT >> 6010 Fall, 2009 Description: La dtection de Plagiat IFT6010 IA Cline FRAMBOURG Plan Qu\'est ce que le plagiat ? Comment le reconnaitre ? Par l\'exemple Quelques trucs pour viter le plagiat Comment les universits grent le plagiat ? (Exemple de Montral) De nombreux outils web jeud... Date Added: 2009-04-24 00:14:02 |
| devoir2_seq.txt Path: Neumont >> H >> 1001 Fall, 2009 Description: lambda MSTKKKPLTQEQLEDARRLKAIYEKKKNELGLSQESVADKMGMGQSGVGALFNGINALNA YNAALLAKILKVSVEEFSPSIAREIYEMYEAVSMQPSLRSEYEYPVFSHVQAGMFSPELR TFTKGDAERWVSTTKKASDSAFWLEVEGNSMTAPTGSKPSFPDGMLILVDPEQAVEPGDF CIARLGGDEFTFKKLIRDSGQVFLQPLNPQYPMIPCNESCSVVGKVIASQWPEETFG ... Date Added: 2009-04-24 00:16:08 |
| 1929rcs0-84.pdf Path: Neumont >> EN >> 1928 Fall, 2009 Description: Supreme Court of Canada Untermeyer Estate v. Attorney General for British Columbia, [1929] S.C.R. 84 Date: 1928-12-21 Executors of Estate of Isaac Untermyer, Deceased Appellants; and Attorney-General for The Province of British Columbia Respondent. 1... Date Added: 2009-04-24 00:16:23 |
| 1929rcs0-84.pdf Path: Neumont >> CSC >> 1928 Fall, 2009 Description: Supreme Court of Canada Untermeyer Estate v. Attorney General for British Columbia, [1929] S.C.R. 84 Date: 1928-12-21 Executors of Estate of Isaac Untermyer, Deceased Appellants; and Attorney-General for The Province of British Columbia Respondent. 1... Date Added: 2009-04-24 00:16:24 |
| activityAssociation.doc Path: Uni. Westminster >> CSC >> 677 Fall, 2009 Description: Transaction ID 1000 2000 4000 5000 6000 6100 7200 9200 10001 20001 40001 50001 60002 61003 72005 92003 Items Bought B,C,F B,C A,D,E B,E A,B,D A,B C,D C,D,F A,B,D A,C,D A,D B,C,F B,C,E B,F C,D B,D,E,F Find support and confidence level for the follow... Date Added: 2009-04-24 00:16:55 |
| activityAssociation.doc Path: Uni. Westminster >> CSC >> 497 Fall, 2009 Description: Transaction ID 1000 2000 4000 5000 6000 6100 7200 9200 10001 20001 40001 50001 60002 61003 72005 92003 Items Bought B,C,F B,C A,D,E B,E A,B,D A,B C,D C,D,F A,B,D A,C,D A,D B,C,F B,C,E B,F C,D B,D,E,F Find support and confidence level for the follow... Date Added: 2009-04-24 00:17:12 |
| 1967rcs0-302.doc Path: Neumont >> EN >> 1967 Fall, 2009 Description: Supreme Court of Canada G.W. Golden Construction Ltd. v. Minister of National Revenue [1967] S.C.R. 302 Date: 1967-03-02 G.W. Golden Construction Limited Appellant; and The Minister of National Revenue Respondent. 1966: December 1, 2; 1967: March 2. ... Date Added: 2009-04-24 00:17:32 |
| 1967rcs0-302.doc Path: Neumont >> CSC >> 1967 Fall, 2009 Description: Supreme Court of Canada G.W. Golden Construction Ltd. v. Minister of National Revenue [1967] S.C.R. 302 Date: 1967-03-02 G.W. Golden Construction Limited Appellant; and The Minister of National Revenue Respondent. 1966: December 1, 2; 1967: March 2. ... Date Added: 2009-04-24 00:17:32 |
| FibreBundles_L12.pdf Path: East Los Angeles College >> KF >> 262 Fall, 2009 Description: Lecture 12(27.02.09) Complex Cobordism By a manifold we mean a C -manifold which can be embedded as a closed C submanifold of some Euclidean space. maps of manifolds will always be C . We will also assume that any CW -complex considered is a manif... Date Added: 2009-04-24 00:18:25 |
| mtreview.pdf Path: Uni. Westminster >> PHYS >> 1210 Fall, 2009 Description: s Ec e G l ` 9 8 C 8 oX G E 8 C l ` 9q I C b e l f G A s I I f G bq G f C b E TaYPYm@nhaPvYPDmxFpYY2PY~yhhPHwhFpdmf V khHb If I G f C b E f C ` E C E Ec o ` 9 E 8 C l ` f C W C b e l f G A s C f lq G 9c 9 b HPhPHHhf }HdE HkgmYm%YFY@F... Date Added: 2009-04-24 00:18:25 |
| 1947rcs0-234.pdf Path: Neumont >> CSC >> 1947 Fall, 2009 Description: ... Date Added: 2009-04-24 00:19:23 |
| 1947rcs0-234.pdf Path: Neumont >> EN >> 1947 Fall, 2009 Description: ... Date Added: 2009-04-24 00:19:23 |
| 1970rcs0-638.doc Path: Neumont >> EN >> 1970 Fall, 2009 Description: Supreme Court of Canada The Queen v. Trinneer, [1970] S.C.R. 638 Date: 1970-03-20 Her Majesty the Queen Appellant; and David Robert Trinneer Respondent. 1970: February 2, 3; 1970: March 20. Present: Cartwright C.J. and Fauteux, Abbott, Martland, Juds... Date Added: 2009-04-24 00:19:30 |
| 1970rcs0-638.doc Path: Neumont >> CSC >> 1970 Fall, 2009 Description: Supreme Court of Canada The Queen v. Trinneer, [1970] S.C.R. 638 Date: 1970-03-20 Her Majesty the Queen Appellant; and David Robert Trinneer Respondent. 1970: February 2, 3; 1970: March 20. Present: Cartwright C.J. and Fauteux, Abbott, Martland, Juds... Date Added: 2009-04-24 00:19:30 |
| datastruct.4.ps.pdf Path: Neumont >> DIFT >> 6221 Fall, 2009 Description: DATA STRUCTURES FOR LOGIC OPTIMIZATION c Giovanni De Micheli Stanford University Outline Review of Boolean algebra. c GDM Representations of logic functions. Matrix representations of covers. Operations on logic covers. Background Function f (x1 ... Date Added: 2009-04-24 00:19:49 |
| 0rcs24-589.pdf Path: Neumont >> EN >> 1895 Fall, 2009 Description: ... Date Added: 2009-04-24 00:20:39 |
| 0rcs24-589.pdf Path: Neumont >> CSC >> 1895 Fall, 2009 Description: ... Date Added: 2009-04-24 00:20:39 |
| 1965rcs0-602.doc Path: Neumont >> CSC >> 1965 Fall, 2009 Description: Supreme Court of Canada Canadian Pacific Railway Co. v. Attorney-General of Quebec, [1965] S.C.R. 602 Date: 1965-06-07 Canadian Pacific Railway Company Appellant; and The Attorney General of Quebec and The Minister of Roads of Quebec Respondents; and... Date Added: 2009-04-24 00:21:01 |
| 1965rcs0-602.doc Path: Neumont >> EN >> 1965 Fall, 2009 Description: Supreme Court of Canada Canadian Pacific Railway Co. v. Attorney-General of Quebec, [1965] S.C.R. 602 Date: 1965-06-07 Canadian Pacific Railway Company Appellant; and The Attorney General of Quebec and The Minister of Roads of Quebec Respondents; and... Date Added: 2009-04-24 00:21:01 |
| 1964rcs0-589.pdf Path: Neumont >> EN >> 1964 Fall, 2009 Description: ... Date Added: 2009-04-24 00:23:20 |
| 1964rcs0-589.pdf Path: Neumont >> CSC >> 1964 Fall, 2009 Description: ... Date Added: 2009-04-24 00:23:20 |
| 1964rcs0-274.pdf Path: Neumont >> EN >> 1964 Fall, 2009 Description: ... Date Added: 2009-04-24 00:23:21 |
| 1964rcs0-274.pdf Path: Neumont >> CSC >> 1964 Fall, 2009 Description: ... Date Added: 2009-04-24 00:23:21 |
| ps_3_week18.pdf Path: East Los Angeles College >> EC >> 114 Fall, 2009 Description: EC114 INTRODUCTION TO QUANTITATIVE ECONOMICS Problem Set 3: Introduction to Econometrics January 26, 2009 1 Question 1 WW 12-5 3 Question 3 W&W 12-6 1 ... Date Added: 2009-04-24 00:24:22 |
| 1986rcs2-709.pdf Path: Neumont >> EN >> 1986 Fall, 2009 Description: R. v. Nehring, [1986] 2 S.C.R. 709 Harlie Marvin Nehring Appellant v. Her Majesty The Queen Respondent INDEXED AS: R. v. NEHRING File No.: 19522. 1986: December 12; 1986: December 18. Present: Dickson C.J. and Estey, McIntyre, Chouinard, La... Date Added: 2009-04-24 00:27:13 |
| 1986rcs2-709.pdf Path: Neumont >> CSC >> 1986 Fall, 2009 Description: R. v. Nehring, [1986] 2 S.C.R. 709 Harlie Marvin Nehring Appellant v. Her Majesty The Queen Respondent INDEXED AS: R. v. NEHRING File No.: 19522. 1986: December 12; 1986: December 18. Present: Dickson C.J. and Estey, McIntyre, Chouinard, La... Date Added: 2009-04-24 00:27:13 |
| 1982rcs2-905.doc Path: Neumont >> EN >> 1982 Fall, 2009 Description: Supreme Court of Canada Hammerling v. The Queen, [1982] 2 S.C.R. 905 Date: 1982-12-21 Anthony Thomas Hammerling Appellant; and Her Majesty The Queen Respondent. File No.: 16634. 1982: October 5; 1982: December 21. Present: Laskin C.J. and Beetz, Este... Date Added: 2009-04-24 00:27:59 |
| 1982rcs2-905.doc Path: Neumont >> CSC >> 1982 Fall, 2009 Description: Supreme Court of Canada Hammerling v. The Queen, [1982] 2 S.C.R. 905 Date: 1982-12-21 Anthony Thomas Hammerling Appellant; and Her Majesty The Queen Respondent. File No.: 16634. 1982: October 5; 1982: December 21. Present: Laskin C.J. and Beetz, Este... Date Added: 2009-04-24 00:27:59 |
| 1983rcs1-365.doc Path: Neumont >> EN >> 1983 Fall, 2009 Description: Supreme Court of Canada Martin v. Chapman, [1983] 1 S.C.R. 365 Date: 1983-03-24 John Martin Appellant; and H.H. Chapman Respondent; and Deputy Attorney General of Canada and Band Council of the Indian reserve of Maria Mis en cause. File No.: 16449. 1... Date Added: 2009-04-24 00:30:46 |
| 1983rcs1-365.doc Path: Neumont >> CSC >> 1983 Fall, 2009 Description: Supreme Court of Canada Martin v. Chapman, [1983] 1 S.C.R. 365 Date: 1983-03-24 John Martin Appellant; and H.H. Chapman Respondent; and Deputy Attorney General of Canada and Band Council of the Indian reserve of Maria Mis en cause. File No.: 16449. 1... Date Added: 2009-04-24 00:30:46 |
| outputandcosts.ppt Path: St. Francis IL >> ECON >> 100 Fall, 2009 Description: RUBBER DUCKIES TOTAL PRODUCT Labour Output 1 1 2 3 3 6 4 10 5 15 6 21 7 26 8 30 9 33 10 35 TOTAL PRODUCT GRAPH TOTAL PRODUCT 40 35 30 OUTPUT 25 20 15 10 5 0 0 1 2 3 4 5 LABOUR 6 7 8 9 10 AVERAGE PRODUCT LABOUR 1 2 3 4 5 6 OUTPUT 1 3 6 10 15 2... Date Added: 2009-04-24 00:32:24 |
| ra1973182.txt Path: Allan Hancock College >> RA >> 1973182 Fall, 2009 Description: REGISTRAR-GENERAL ACT 1973 - As at 23 December 1999 - Act 67 of 1973 TABLE OF PROVISIONS TABLE OF PROVISIONS 1. Name of Act 2. Registrar-General 3. Deputy Registrars-General 4. Seal of office 5. Statutory declarations 6. ... Date Added: 2009-04-24 00:33:50 |
| 1969rcs0-603.doc Path: Neumont >> EN >> 1969 Fall, 2009 Description: Supreme Court of Canada Minister of National Revenue v. Edgeley Farms Limited, [1969] S.C.R. 603 Date: 1969-05-16 The Minister of National Revenue Appellant; and Edgeley Farms Limited Respondent. 1969: March 20; 1969: May 16. Present: Cartwright C.J.... Date Added: 2009-04-24 00:34:03 |
| 1969rcs0-603.doc Path: Neumont >> CSC >> 1969 Fall, 2009 Description: Supreme Court of Canada Minister of National Revenue v. Edgeley Farms Limited, [1969] S.C.R. 603 Date: 1969-05-16 The Minister of National Revenue Appellant; and Edgeley Farms Limited Respondent. 1969: March 20; 1969: May 16. Present: Cartwright C.J.... Date Added: 2009-04-24 00:34:03 |
| introduction.ppt Path: St. Francis IL >> CHEM >> 391 Fall, 2009 Description: CHEM 391 Junior Seminar Your Seminar Choose a topic of interest to you that allows you to make up a 10-minute presentation (must be a chemical discussion) Use structures, pictures (whatever necessary) to convey your talk A question period will fo... Date Added: 2009-04-24 00:34:30 |
| Assignment4.doc Path: St. Francis IL >> CHEM >> 100 Fall, 2009 Description: CHEM 100.12 Assignment #4 Issued: October 30th; due November 7th Questions from BLB, 11th edition: 15.32, 15.38, 15.24, 15.44, 15.48, 15.54 1) A mixture of 1.374g H2 and 70.31g Br2 is heated in a 2.00-L vessel at 700K. These substances react as follo... Date Added: 2009-04-24 00:34:33 |
| 1953rcs1-59.pdf Path: Neumont >> EN >> 1952 Fall, 2009 Description: ... Date Added: 2009-04-24 00:35:44 |
| 1953rcs1-59.pdf Path: Neumont >> CSC >> 1952 Fall, 2009 Description: ... Date Added: 2009-04-24 00:35:44 |
| 2006-CA-00974-COAt.pdf Path: Santa Monica >> LAWWIN >> 2 Fall, 2009 Description: IN THE SUPREME COURT OF THE STATE OF MISSISSIPPI RICHARD BRODERICK JONES VS. NEVADA RAE BARR JONES APPELLANT NO. 2006-CA-00974 APPELLEE BRIEF OF APPELLANT ORAL ARGUMENT REQUESTED APPEAL FROM THE CHANCERY COURT OF THE FIRST JUDICIAL DISTRICT OF H... Date Added: 2009-04-24 16:03:12 |
| Proj_1_murphy_190.doc Path: Auburn Montgomery >> MATH >> 190 Fall, 2009 Description: Brent Murphy February 8, 2005 Project 1 Calculus/Math190 MTWF 11-11:50am Dr. Yi Wang Brent Murphy 1. Under what conditions will the decimal expansion of p/q terminate? Under what conditions will it repeat? I have found that the decimal expansion of ... Date Added: 2009-04-24 16:03:35 |
| p4.doc Path: Mississippi State >> CVM >> 8990 Fall, 2009 Description: CVM 8890 Program 4 Fall 2005 Tryptic Peptides Due: October 13, 2005 In this program you will read from a file containing a single protein sequence. The sequence may be split over a number of lines. You should generate the tryptic peptides that would ... Date Added: 2009-04-24 16:04:45 |
| updatedtestspecifications.doc Path: Mississippi State >> ECE >> 4522 Fall, 2009 Description: 4.1 Test Specification Due to the safety factors that are involved with automobiles and the people that drive them, our system components have to be thoroughly tested to ensure correct functionality. If the PIC, water pump, or any of the components... Date Added: 2009-04-24 16:06:26 |
| Registers.ppt Path: Mississippi State >> ECE >> 3724 Fall, 2009 Description: Registers of the 8086/80286 Intel 16-Bit Registers General Purpose AX BX CX DX AX 1 0 AH 7 0 7 AL 0 General Purpose Registers AX (Accumulator) favored by CPU for arithmetic operations BX Base can hold the address of a procedure or variable (SI... Date Added: 2009-04-24 16:07:00 |
| Abercrombie.doc Path: Mississippi State >> ACC >> 217 Fall, 2009 Description: Abercrombie 1 Company Valuation Project Abercrombie Fitch began in 1992 with 40 stores over the United S... Date Added: 2009-04-24 16:07:27 |
| Abercrombie.doc Path: Mississippi State >> ACC >> 8112 Fall, 2009 Description: Abercrombie 1 Company Valuation Project Abercrombie Fitch began in 1992 with 40 stores over the United S... Date Added: 2009-04-24 16:07:27 |
| GarelJ-Outline.doc Path: Barry >> SEMINARF >> 05 Fall, 2009 Description: Topic and Outline The Selective regulated degradation of protein via ubiquitin-proteasome pathway 1. the process by which ubiquitin is joined to a target protein 2. definition of proteasomes 3. role of degrons 4. why is protein degradation important ... Date Added: 2009-04-24 16:10:37 |
| introvbnet_ch03.ppt Path: Bellevue >> CIS >> 2 Fall, 2009 Description: VB.NET Programming Chapter 3 VB.NET Starting the application Starting a new project Menus, Main Screen, Windows Controls Forms Frm name Back color Window State Text Labels Lbl Name Text TextAlign Textboxes Txt Name Text Buttons (comma... Date Added: 2009-04-24 16:10:47 |
| introvbnet_ch03.ppt Path: Bellevue >> CIS >> 335 Fall, 2009 Description: VB.NET Programming Chapter 3 VB.NET Starting the application Starting a new project Menus, Main Screen, Windows Controls Forms Frm name Back color Window State Text Labels Lbl Name Text TextAlign Textboxes Txt Name Text Buttons (comma... Date Added: 2009-04-24 16:10:47 |
| hw2.txt Path: Uni. Westminster >> GPH >> 0926 Fall, 2009 Description: /export/home/gregoh nowhere cd . pwd /export/home/gregoh ls -al total 64 drwxr-xr- 3 gregoh student 512 Jan 16 19:10 . drwxr-xr-x 56 root root 1024 Jan 9 12:38 . -rw- 1 gregoh student 4811 Jan 19 14:44 .bash_history -rw-... Date Added: 2009-04-24 16:14:06 |
| app_layers.ppt Path: Seattle >> CSSE >> 460 Winter, 2009 Description: ApplicationLayer Goals: conceptual+implementation aspectsofnetworkapplication protocols r clientserverparadigm r servicemodels learnaboutprotocolsby examiningpopularapplication levelprotocols Moregoals specificprotocols: r r r r r httpourfocus ... Date Added: 2009-04-24 16:15:13 |
| price.stu.ppt Path: Seattle >> MKTG >> 350 Fall, 2009 Description: Principles of Marketing Price Strategic Objectives Profit Positioning and leadership Social responsibility The Feasible Price Range What is the highest price a consumer will pay? What is the lowest price a seller can charge? What encourages s... Date Added: 2009-04-24 16:15:31 |
| 312revw1.doc Path: Seattle >> ACCT >> 532 Fall, 2009 Description: QUESTIONS & TOPICS TO REVIEW FOR EXAM #1 ACCOUNTING 312 When preparing for the exam, remember that you should, and I will, focus on the depth of your understanding, rather than the breadth of your understanding. You need not know everything, but you ... Date Added: 2009-04-24 16:16:03 |
| intlbrigade.pdf Path: UNC >> CHAOS >> 1 Fall, 2009 Description: \"SOME MEN PUT IN THEIR LIVES\" Americans in the International Brigades, Spain 1936-1939 Erik Blaine Coleman Presented in Partial Fulfillment of the Requirements of Independent Study History 451-452 Supervised by John M. Gates Department of History... Date Added: 2009-04-24 16:19:26 |
| profile_brian_0217_1530.doc Path: N. Arizona >> EGR >> 486 Fall, 2009 Description: Brian Crampton o Advanced Coursework: CSE 315 Automata Theory CSE 355 Microprocessors CSE 386 Software Architectures CSE 396 Principles of Languages CSE 420 Advanced Digital Design CSE 421 Algorithms (in progress) CSE 432 Digital Image Processing CSE... Date Added: 2009-04-24 16:20:42 |
| PetriNets1.pdf Path: Iowa State >> CPRE >> 545 Fall, 2009 Description: IEEE. TRANSACTIONS ON INDUSTRIAL ELECTRONICS, VOL. 41, NO. 6, DECEMBER 1994 561 Petri Nets and Industrial Applications: A Tutorial Richard Zurawski and MengChu Zhou Abstract-This is a tutorial paper on Petri nets. Petri nets, as a graphical and mat... Date Added: 2009-04-24 16:21:52 |
| SPIEconf.ppt Path: Iowa State >> INFAS >> 535 Fall, 2008 Description: Report on a Watermarking Conference By Jennifer Davidson Security and Watermarking of Multimedia Contents V SPIEThe International Society for Optical Engineering Electronic Imaging-Science and Technology 2024 January 2003, Santa Clara, Califor... Date Added: 2009-04-24 16:21:54 |
| mercer.doc Path: Maryville MO >> FY >> 00 Fall, 2009 Description: Mercer County Extension Program Plan 2000-2003 June, 1999 Mercer County Extension Council \"KNOWLEDGE MISSOURIANS\" WORKING FOR 102 South Broadway Courthouse Annex Princeton, MO 64673-1107 (660) 748-3315Chairperson FAX - (660) 748-3180 Mercer County... Date Added: 2009-04-24 16:22:42 |
| 807.pdf Path: UGA >> CWT >> 33 Fall, 2009 Description: Technical Note No. 34 August 23, 1939 OUTLINE FOR COMPILING PRECIPITATION AND RUNOFF DATA .FROM SMALL DRAINAGE AREAS. \'.\',\' . ., . Prepared by the Division of Forest Influences C. R. Hursh, In Charge U. S. Department of Agriculture Forest Service... Date Added: 2009-04-24 19:51:40 |
| clp.ppt Path: McGill >> COMP >> 763 Fall, 2009 Description: Using Constraint Logic Programming to Analyze the Chronology in a William Faulkner Story Jennifer Burg Sheau-Dong Lang Irwin Chiu Hau Computer Science McGill University Winter 2004 Comp763: Modern Computer Games Overview Introduction \"A Rose to... Date Added: 2009-04-24 19:52:37 |
| cme435_lecture_2.ppt Path: Air Force Academy >> ENGR >> 435 Fall, 2009 Description: Lecture 2 Verification Methodologies and Planning General Approaches 1. BlackBox 2. WhiteBox 3. GrayBox 2 BlackBox Verification Verify only by stimulating and observing external interfaces of DUT. Internal implementation is hidden, or presumed... Date Added: 2009-04-24 19:53:12 |
| Lecture8.pdf Path: UWO >> CS >> 434 Fall, 2009 Description: CS434a/541a: Pattern Recognition Prof. Olga Veksler Lecture 8 Today Continue with Dimensionality Reduction Last lecture: PCA This lecture: Fisher Linear Discriminant Data Representation vs. Data Classification PCA finds the most accurate data repr... Date Added: 2009-04-24 19:53:21 |
| practicals.pdf Path: East Los Angeles College >> MAS >> 498 Fall, 2009 Description: Bayesian Computation: Practical Exercises Malcolm Farrow University of Newcastle upon Tyne November 2, 2005 This is a collection of practical exercises from old courses, mostly my old module in Bayesian Computation. Unless otherwise stated, reference... Date Added: 2009-04-24 19:54:48 |
| kolchanov1999.pdf Path: East Los Angeles College >> EJ >> 230 Fall, 2009 Description: BIOINFORMATICS Vol. 15 nos 7/8 1999 Pages 654-668 Conformational and physicochemical DNA features specific for transcription factor binding sites Julia V. Ponomarenko 1, Mikhail P. Ponomarenko 1, Anatoly S. Frolov 1, Denis G. Vorobyev 1, G. Christi... Date Added: 2009-04-24 19:55:22 |
| examples1.pdf Path: East Los Angeles College >> MAS >> 3312 Fall, 2009 Description: MAS3312/MAS4312: Stochastic Financial Modelling - Part 2 Class Examples 1 Example 1.1 (Cash position as a generalised BM ) Suppose the cash position of a company (measured in thousands of pounds) follows a generalised B.M. with drift a = 20 per year... Date Added: 2009-04-24 19:59:21 |
| 1D751gl0.pdf Path: W. Alabama >> PE >> 2600 Fall, 2009 Description: Glossary The following list defines or identifies technical terms, abbreviations, and acronyms used in Dell user documents. A Abbreviation for ampere(s). AC Abbreviation for alternating current. adapter card An expansion card that plugs into an expa... Date Added: 2009-04-24 19:59:41 |
| hw02.pdf Path: UC Davis >> ATM >> 060 Fall, 2009 Description: Atmospheric Science 60 Problem Set #2 Due: Wednesday, October 18, 2000 Make sure to show all your work. 1. Calculate the net loss of radiant energy (in Watts) of a person standing in a room with walls, ceiling, and floor at a temperature of 20C, when... Date Added: 2009-04-24 20:03:10 |
| email2.txt Path: East Los Angeles College >> CS >> 612 Fall, 2009 Description: From: \"Alan J Williams (Formal Methods Group)\" <alanw@cs.man.ac.uk> To: [.] Subject: CS612 Automated Reasoning: Contact; notes; pre-course work Date: Mon, 31 Oct 2005 16:40:39 +0000 All, You are receiving this email because we think you are intendi... Date Added: 2009-04-24 20:03:42 |
| stamatatos7.pdf Path: Neumont >> IFT >> 6010 Fall, 2009 Description: Authors version. Published in Computational Linguistics, 26(4), December 2000, pp. 471-495 Automatic Text Categorization in Terms of Genre and Author Efstathios Stamatatos, Nikos Fakotakis, and George Kokkinakis University of Patras Dept. of Elect... Date Added: 2009-04-24 20:03:46 |
| Notes7.pdf Path: Laurentian >> CS >> 2620 Fall, 2009 Description: 57 Use of Friend functions/classes w Access to private members of a class must be kept to a minimum w An alternative to friend access is to provide helper functions 58 Improving the Complex class design w We want to minimize the number of friends ... Date Added: 2009-04-24 20:05:09 |
| Chem_0500_course_outline_2005.pdf Path: Laurentian >> CHEM >> 0500 Fall, 2009 Description: CHEMISTRY 0500A COURSE OUTLINE SUMMER SESSION I May 10 June 21, 2005 Instructor: E-mail note: Wayne Lippa Office: E-711 Phone: 329-2043 e-mail: lippwk@uleth.ca E-mail has become an important method of communicating with an entire class. As such, it... Date Added: 2009-04-24 20:05:40 |
| Chapter7practice.pdf Path: Laurentian >> ECON >> 200801 Fall, 2009 Description: Chapter 7 Practice Questions Davidson 2008 MULTIPLE CHOICE. Choose the one alternative that best completes the statement or answers the question. 1) In order to determine a household\'s budget line, you must know the 1) _ A) household\'s income, but no... Date Added: 2009-04-24 20:10:24 |
| SimBasis.pdf Path: UWO >> CBE >> 497 Fall, 2009 Description: 2.4 Update Hyprotech is a member of the AEA Technology plc group of companies Copyright Notice The copyright in this manual and its associated computer program are the property of Hyprotech Ltd. All rights reserved. Both this manual and the compute... Date Added: 2009-04-24 20:10:48 |
| pp_soln.pdf Path: Laurentian >> C >> 2710 Fall, 2009 Description: Phase plane analysis solutions Marc R. Roussel February 21, 2003 1. The concentration of X is constant, so we just have two variables, a and a . The rate equations are k1 xa k 1 xa k1 xa k 1 xa k2 a The equilibrium point is still (0,0). (... Date Added: 2009-04-24 20:12:19 |
| Test1-Answers.pdf Path: Laurentian >> CHEM >> 200501 Fall, 2009 Description: ... Date Added: 2009-04-24 20:13:56 |
| functions.pdf Path: Virgin Islands >> CSC >> 330 Fall, 2009 Description: , l*igfo,r -L - A -furtctio\'t is lu\'gherorlzr ,T it oonftt {nrctionr Ls atguneds , or Colootet {.rr.t^o*l (J tcsufrs. - fur.atirrr\' of an n-argurrrcrtE ,function into t!- rtl\'natg-arTtnettr {.rlcticr.s. ... Date Added: 2009-04-24 20:15:22 |
| filter.c(1).txt Path: Virgin Islands >> ECE >> 499 Fall, 2009 Description: void filter(void) { int8 temp; temp = (int8)(196*currentsample + 60*result1_1)>8); result1_2 = (signed int8)( ( (signed int16)(154*temp - 154*result1_1) + 51*result1_2 ) >8 ); result1_1 = temp; if(result1_2 >= 0) { fasten... Date Added: 2009-04-24 20:15:52 |
|
|
Get Started With Course Hero Today!
Get study guides, join study groups, and more!
Sign up in seconds with your Facebook account!
Course Hero is a Facebook Application Partner.
Click below to sign-up for FREE.
Our Social Learning Network was built to provide students and key learning partners like professors a platform to share, meet and collaborate while accelerating their comprehension of course-related theories and concepts. We are committed to providing you immediate access to a growing wealth of study materials and an unparalleled academic network of students, professors and other key partners. Why do you care? Because you want the best grade possible and at times need a 24/7 resource that’s responsive to your needs. |
|
What People Are Saying About Course Hero
|
|||
|
|||
|
Explore the benefits of joining Course Hero's social learning network.
|
|||
 |
Get millions of study materials now!Need lecture notes for a missed class or want insightful explanation of the theories and concepts you learn in class? Look no further, Course Hero’s Study Materials empowers you to find a broad and deep set of materials that can help you right now!
Click below to sign-up for FREE.
|
||
 |
Get over 200,000 textbook solutions now!Having difficulty with your homework and need documents that are relevant for your Textbook? Don't be frustrated. Course Hero's Textbook Help presents you study materials from many college courses.
Click below to sign-up for FREE.
|
||
 |
Meet over 300,000 students and your fellow classmates now!Want to meet your current classmates or those that took the class last year? Don’t worry or have anxiety. Course Hero’s Study Groups gives you the seamless opportunity to develop both anonymous or direct relationships with those classmates whom you want to meet and get help from right now!
Click below to sign-up for FREE.
|
||
