Course Solutions And Notes - 243CourseList 39

Displaying 1501-2000 of 25195 documents:
next page of documents

LCA.ppt
Path: San Diego State >> MGT >> 740 Fall, 2008
Description: Life-Cycle Analysis/Assessment (LCA) Georgia Institute of Technology Systems Realization Laboratory Life Cycle Analysis Life-cycle analysis (LCA) is a method in which the energy and raw material consumption, different types of emissions and other ...
Date Added: 2009-01-09 10:20:46

LCA.ppt
Path: San Diego State >> P H >> 899 Fall, 2008
Description: Life-Cycle Analysis/Assessment (LCA) Georgia Institute of Technology Systems Realization Laboratory Life Cycle Analysis Life-cycle analysis (LCA) is a method in which the energy and raw material consumption, different types of emissions and other ...
Date Added: 2009-01-09 07:00:56

LCA.ppt
Path: San Diego State >> P H >> 722 Fall, 2008
Description: Life-Cycle Analysis/Assessment (LCA) Georgia Institute of Technology Systems Realization Laboratory Life Cycle Analysis Life-cycle analysis (LCA) is a method in which the energy and raw material consumption, different types of emissions and other ...
Date Added: 2009-01-09 10:20:46

LCA.ppt
Path: San Diego State >> MALAS >> 600a Fall, 2008
Description: Life-Cycle Analysis/Assessment (LCA) Georgia Institute of Technology Systems Realization Laboratory Life Cycle Analysis Life-cycle analysis (LCA) is a method in which the energy and raw material consumption, different types of emissions and other ...
Date Added: 2009-01-09 10:20:21

LCA.ppt
Path: San Diego State >> ECON >> 740 Fall, 2008
Description: Life-Cycle Analysis/Assessment (LCA) Georgia Institute of Technology Systems Realization Laboratory Life Cycle Analysis Life-cycle analysis (LCA) is a method in which the energy and raw material consumption, different types of emissions and other ...
Date Added: 2009-01-11 20:56:42

NREM 2103 Forest Measurements I.doc
Path: Oklahoma State >> MATH >> 2103 Fall, 2008
Description: NREM 2103 Forest Measurements I Syllabus - Spring 2009 NREM 2103 Forest Measurements I is an introductory course in forest measurement. In order to practice forest management, forest managers must be aware of the current state of the forest resource....
Date Added: 2009-02-02 21:42:10

Chem 207_Lab Report 1_Densities of Liquids and Solids 2
Path: Cornell >> CHEM >> 2070 Fall, 2007
Description: Densities of Liquids and Solids Lab Instructor: Kaushik Nanda Chemistry 207 September 9, 2007 Results and Discussion: Purpose: To experimentally determine the densities of an unknown solid and an unknown liquid as accurately and precisely as possib...
Date Added: 2008-03-26 16:15:06

bowle143.pdf
Path: IPFW >> SOC >> S450 Spring, 2008
Description: ...
Date Added: 2009-01-09 01:55:41

bowle143.pdf
Path: IPFW >> IM >> 105 Spring, 2008
Description: ...
Date Added: 2009-01-11 18:44:45

Lecture8AquaticBiodiversity.pdf
Path: UC Davis >> ESP >> 172 Fall, 2008
Description: Threats to Aquatic Biodiversity Threats to Freshwater Species 20% of freshwater fishes extinct or in serious decline Extinct/at-risk salmon/steelhead runs outnumber healthy by 3:1 In CA, 57% of fish species are extinct or declining (Moyle and William...
Date Added: 2009-01-11 20:26:26

Lecture8AquaticBiodiversity.pdf
Path: UC Davis >> ESP >> 169 Fall, 2008
Description: Threats to Aquatic Biodiversity Threats to Freshwater Species 20% of freshwater fishes extinct or in serious decline Extinct/at-risk salmon/steelhead runs outnumber healthy by 3:1 In CA, 57% of fish species are extinct or declining (Moyle and William...
Date Added: 2009-01-11 20:26:26

scan0003
Path: SFASU >> GOL >> 131 Spring, 2008
Description: ...
Date Added: 2008-05-04 19:44:07

LLLGscreen.pdf
Path: Syracuse >> ARC >> 605 Fall, 2008
Description: Learning About Community Support for the Families of Children with Disabilities John OBrien with Bryn Fortune Sharon Dietrich Joan Blough Nancy Peeler Reflections on the Local Liaison Learning Group puorG gninraeL nosiaiL lacoL eht no snoitcelfeR Pa...
Date Added: 2009-01-12 04:52:58

LLLGscreen.pdf
Path: Syracuse >> ARC >> 621 Fall, 2008
Description: Learning About Community Support for the Families of Children with Disabilities John OBrien with Bryn Fortune Sharon Dietrich Joan Blough Nancy Peeler Reflections on the Local Liaison Learning Group puorG gninraeL nosiaiL lacoL eht no snoitcelfeR Pa...
Date Added: 2009-01-12 04:52:58

LLLGscreen.pdf
Path: Syracuse >> ARC >> 681 Fall, 2008
Description: Learning About Community Support for the Families of Children with Disabilities John OBrien with Bryn Fortune Sharon Dietrich Joan Blough Nancy Peeler Reflections on the Local Liaison Learning Group puorG gninraeL nosiaiL lacoL eht no snoitcelfeR Pa...
Date Added: 2009-01-12 04:52:58

LLLGscreen.pdf
Path: Syracuse >> ARC >> 557 Fall, 2008
Description: Learning About Community Support for the Families of Children with Disabilities John OBrien with Bryn Fortune Sharon Dietrich Joan Blough Nancy Peeler Reflections on the Local Liaison Learning Group puorG gninraeL nosiaiL lacoL eht no snoitcelfeR Pa...
Date Added: 2009-01-12 04:52:58

LLLGscreen.pdf
Path: Syracuse >> ARC >> 572 Fall, 2008
Description: Learning About Community Support for the Families of Children with Disabilities John OBrien with Bryn Fortune Sharon Dietrich Joan Blough Nancy Peeler Reflections on the Local Liaison Learning Group puorG gninraeL nosiaiL lacoL eht no snoitcelfeR Pa...
Date Added: 2009-01-12 04:52:58

LLLGscreen.pdf
Path: Syracuse >> ARC >> 604 Fall, 2008
Description: Learning About Community Support for the Families of Children with Disabilities John OBrien with Bryn Fortune Sharon Dietrich Joan Blough Nancy Peeler Reflections on the Local Liaison Learning Group puorG gninraeL nosiaiL lacoL eht no snoitcelfeR Pa...
Date Added: 2009-01-12 04:52:58

W03 problems1b key
Path: UCLA >> CHEM >> 30B Winter, 2003
Description: TA: Danny Ng 1/13/2002 Problem Set 1 (Chepter 9 Alcohols and Thiols) A. Synthesis of Alcohols from Alkenes (Review) Answer Key 1. Provide the missing reagents or products for the following reactions. Include all possible stereoisomers whenever appl...
Date Added: 2008-04-05 21:22:11

Exam II Review Solution.pdf
Path: UCSB >> MATH >> 117 Fall, 2008
Description: Practice Problem Solutions Problem 1: a) b) c) d) e) f) g) h) Problem 2: X ~ N ( ,4) a. X n z* n X 1.72 X n 2.576 4 n 36 2 = 1 2.576 4 = 1 n = (2.576 )(4 ) = 107 b. z * n n 1 Problem 3: a) b) c) ...
Date Added: 2009-01-11 21:44:41

Richard_Dunn.pdf
Path: UMBC >> CMSC >> 691 Summer, 1998
Description: Distributed Online Localization in Sensor Networks Using a Moving Target Aram Galstyan and Kristina Lerman from Information Sciences Institute Bhaskar Krishnamachari and Sundeep Pattem from University of Southern California Overview Introduction...
Date Added: 2009-02-17 23:52:05

MIDTERM_REVIEW
Path: Penn State >> HRIM >> 497D Summer, 2007
Description: HRIM 497D WINE APPRECIATION MIDTERM REVIEW THE EXAM CONSISTS OF 50 TRUE/FALSE OR MULTIPLE CHOICE QUESTIONS @ 2 POINTS EACH. YOU NEED TO KNOW: RED AND WHITE GRAPES VARIETAL CHARACTERISTICS WINE MAKING PROCEDURES- VITICULTURE AND VINICULTURE TASTING CR...
Date Added: 2008-04-19 08:05:55

handbook2002.pdf
Path: N.C. State >> AEE >> 424 Fall, 2008
Description: 20 Meeting 02 Planners Handbook Achieving A Career/Life Balance 33 Details You Might Forget But Shouldnt The Dream Meeting Mistakes Independents Make Budgeting For Intl Meetings Limiting Your Legal Liability Must-Have Resources Professional...
Date Added: 2009-01-09 04:42:17

Socioeconomic status and health- roy_Notes
Path: Cornell >> DSOC >> 1101 Fall, 2008
Description: Socioeconomic status and health: neurobiological perspective Roy SES is one of the strongest predictors of health in industrial nations. Humans are social creatures whose sense of well being comes from social interactions Hierarchical societies, i...
Date Added: 2009-02-20 02:48:03

HW9solutions
Path: Cornell >> MATH >> 2210 Fall, 2005
Description: Section 6.1 2. Invertible because det 2 4 3 = -2. 5 8. Not invertible because the determinant is 0. 1 2 3 16. det 4 k 5 = 60 + 84 + 8k - 18k - 35 - 64 = 45 - 10k. The matrix is invertible when k = 4.5. 6 7 8 4- 2 0 6- 0 = (4 - )(6 - )(3 - ) - 8...
Date Added: 2008-02-23 11:38:38

Chemistry I Notes
Path: Rockhurst >> CHEM >> 101 Spring, 2008
Description: Chemistry I Notes Chapter One- Water: A Natural Wonder The phases of matter include solids, liquids and gases. Density is the amount of matter that occupies a given volume. It\'s units are g/mL and is considered a physical property. A solid has a defi...
Date Added: 2008-04-09 17:38:21

AEM414 - problem set 3_Essay
Path: Cornell >> AEM >> 4140 Fall, 2007
Description: Assignment 3 A record-setting contract for the ages: The arena of professional sports has always created opportunities for the media and for capitalists, playing host to some of the most well-known and talented athletes throughout the world. During t...
Date Added: 2009-02-20 04:13:10

050207AfrUnion.txt
Path: Chester >> ECO >> 343 Fall, 2008
Description: The African Union moves a quiet revolution | csmonitor.com from the February 07, 2005 edition http:/www.csmonitor.com/2005/0207/p09s02-coop.html The African Union moves a quiet revolution By Nancy Soderberg ADDIS ABABA - With the world focus on terr...
Date Added: 2009-02-11 17:22:55

GNC Sensors - Monk.ppt
Path: Auburn >> FOEN >> 4730 Fall, 2008
Description: Guidance, Navigation, and Control Sensors: GPS, GLONASS, & RGAs Timothy S. Monk What is GNC, and why is it important? The International Space Station is a multi-billion dollar object orbiting the Earth at about 7 kilometers per second Humans maint...
Date Added: 2009-01-09 18:43:57

2007_Q1_Vote_Report.pdf
Path: Loyola Chicago >> WWW >> 1 Fall, 2008
Description: Loyola University of Chicago Proxy Vote History ISS Standard Rec For For For For For For For For For For For For For For For For For For For For For For For For For For For For For For For For For For For For For Against For For For For For Record D...
Date Added: 2009-02-17 23:59:45

Spanish Club Film Series
Path: CSB-SJU >> MUS >> 8733 Spring, 2008
Description: Spanish Club Film Series When: Tuesday, March 11th Film: Nueve Reinas Where: AV1 in Alcuin Library Time: 6pm FREE PIZZA AND DISCUSSION AFTER THE FILM ...
Date Added: 2008-04-10 00:10:44

lecture_25_viewsheds.pdf
Path: Mich Tech >> FW >> 3540 Spring, 2008
Description: 4/14/08 !\"#$%,-( ! .(/\"#$%%(0,(01#0(*2(+0,\'3($04#13(0,\'(*41*,5#,40+(#+#5#,4%(4%\"6+#(21*5( 0(2\"7#\'(/0,40-#(8*\",4( !\"#$%,-(\",(.19:;<( ! <804\"0+(.,0+=%4(#74#,%\"*,( !>?)( !@6%#1/04\"*,(8*\",4%( !\"#$%...
Date Added: 2009-01-10 17:13:53

dynamopldi.pdf
Path: UCSD >> CSE >> 231 Fall, 2008
Description: Dynamo: A Transparent Dynamic Optimization System Vasanth Bala vas@hpl.hp.com Evelyn Duesterwald duester@hpl.hp.com Sanjeev Banerjia sbanerjia@incert.com Hewlett-Packard Labs 1 Main Street, Cambridge, MA 02142 www.hpl.hp.com/cambridge/projects/Dyn...
Date Added: 2009-01-10 01:55:04

math4181_Oct_17_07.pdf
Path: LSU >> PETE >> 7999 Spring, 2008
Description: ...
Date Added: 2009-01-09 08:06:54

math4181_Oct_17_07.pdf
Path: LSU >> MATH >> 4181 Fall, 2008
Description: ...
Date Added: 2009-02-18 01:31:39

07 September 11, 2006
Path: UGA >> GEOG >> 1112 Fall, 2006
Description: Geography September 11, 2006 1 calorie/ gram C latent heat of water latent heat energy released during a phase change or energy needed to cause a phase change liquid gas = evaporation gas liquid = condensation liquid solid = thawing/ melting s...
Date Added: 2008-04-07 19:48:57

v56n2-211-212.pdf
Path: Hawaii >> SCHOLARSPA >> 10125 Fall, 1989
Description: Hawaiian Marine Bioinvasions: A Preliminary Assessment 1 L. G. Eldredge 2 and J. T Carlton 3 THROUGH THE Hawaii Biological Survey at Bishop Museum, a count of the total numbers of species in the Hawaiian Archipelago has been accumulated, with the lat...
Date Added: 2009-02-17 19:35:22

v56n2-211-212.pdf
Path: Hawaii >> SCHOLARSPA >> 2651 Fall, 2008
Description: Hawaiian Marine Bioinvasions: A Preliminary Assessment 1 L. G. Eldredge 2 and J. T Carlton 3 THROUGH THE Hawaii Biological Survey at Bishop Museum, a count of the total numbers of species in the Hawaiian Archipelago has been accumulated, with the lat...
Date Added: 2009-02-17 19:35:22

hw9.pdf
Path: Arizona >> ECON >> 696f Fall, 2008
Description: Economics 520, Fall 2007 Homework 9 Due Tuesday, November 13 at beginning of class 1. Suppose that a random sample X1 , . . . , Xn is taken from a N (, 1) distribution with unknown mean . However, we only observe Yi , an indicator equal to 1 if Xi i...
Date Added: 2009-01-11 19:59:15

hw9.pdf
Path: Arizona >> U >> 9 Fall, 2008
Description: Economics 520, Fall 2007 Homework 9 Due Tuesday, November 13 at beginning of class 1. Suppose that a random sample X1 , . . . , Xn is taken from a N (, 1) distribution with unknown mean . However, we only observe Yi , an indicator equal to 1 if Xi i...
Date Added: 2009-02-06 20:27:07

hw9.pdf
Path: Arizona >> ECON >> 520 Fall, 2008
Description: Economics 520, Fall 2007 Homework 9 Due Tuesday, November 13 at beginning of class 1. Suppose that a random sample X1 , . . . , Xn is taken from a N (, 1) distribution with unknown mean . However, we only observe Yi , an indicator equal to 1 if Xi i...
Date Added: 2009-01-09 19:08:14

Homework3
Path: Oregon >> PHYS >> 201 Fall, 2008
Description: PHYS 201 Chapter 3 Homework 3 Fall 2007 Questions 1. One car travels due east at 40 km/h, and a second car travels north at 40 km/h. Are their velocities equal? Explain. No, because their directions are different. 9. Can a particle with constant s...
Date Added: 2008-04-18 15:42:22

Qu11.1-08D.pdf
Path: Towson >> PHYS >> 351 Fall, 2008
Description: TU PHYS 351 (hlc) 001 Qu10.2!08D ! November 10, 2008 Page 1 of 1 Qu10.2-08D - Lagrangians + 20 NAME and SECTION # on ONLY BACK of this Always answer all within the context of the course. Give verbal answers concisely, but as completely as possibl...
Date Added: 2009-02-02 16:21:21

Quiz13.pdf
Path: LSU >> STAT >> 7005 Spring, 2004
Description: Question for March 11, 2004 Quiz 13 PDF 13) Investigators want to examine the success of aphids on juvenile zone branches (no flowers) and mature zone branches (flowers present) on clones of cottonwood trees. Twelve separate clones of cottonwood tr...
Date Added: 2009-02-18 01:33:46

MedSchoolCurricula2005ff.pdf
Path: Marshall >> RS >> 213 Fall, 2008
Description: CURRICULA OF MEDICAL SCHOOLS IN THE UNITED STATES DATA OBTAINED FROM THE CURRICULUM MANAGEMENT AND INFORMATION TOOL OF THE AMERICAN ASSOCIATION OF MEDICAL COLLEGES DECEMBER 2005 Compiled by SN Zill and ER Duke Department of Anatomy and Pathology Jo...
Date Added: 2009-01-09 02:50:13

MedSchoolCurricula2005ff.pdf
Path: Marshall >> RS >> 216 Spring, 2008
Description: CURRICULA OF MEDICAL SCHOOLS IN THE UNITED STATES DATA OBTAINED FROM THE CURRICULUM MANAGEMENT AND INFORMATION TOOL OF THE AMERICAN ASSOCIATION OF MEDICAL COLLEGES DECEMBER 2005 Compiled by SN Zill and ER Duke Department of Anatomy and Pathology Jo...
Date Added: 2009-01-09 02:50:13

MedSchoolCurricula2005ff.pdf
Path: Marshall >> RS >> 217 Spring, 2008
Description: CURRICULA OF MEDICAL SCHOOLS IN THE UNITED STATES DATA OBTAINED FROM THE CURRICULUM MANAGEMENT AND INFORMATION TOOL OF THE AMERICAN ASSOCIATION OF MEDICAL COLLEGES DECEMBER 2005 Compiled by SN Zill and ER Duke Department of Anatomy and Pathology Jo...
Date Added: 2009-01-09 02:50:13

MedSchoolCurricula2005ff.pdf
Path: Marshall >> RS >> 219 Spring, 2008
Description: CURRICULA OF MEDICAL SCHOOLS IN THE UNITED STATES DATA OBTAINED FROM THE CURRICULUM MANAGEMENT AND INFORMATION TOOL OF THE AMERICAN ASSOCIATION OF MEDICAL COLLEGES DECEMBER 2005 Compiled by SN Zill and ER Duke Department of Anatomy and Pathology Jo...
Date Added: 2009-01-09 02:50:13

ef152-lec-1-6
Path: Tennessee >> EF >> 152 Spring, 2008
Description: EF 152 Module 1, Lecture 6 - Review Rotational Motion Rotational Kinetic Energy Rolling Torque Angular Momentum Rotational Dynamics Exam Format and Procedures What to bring: Where to sit: Exam cover sheet: How much time: What to write: During the ex...
Date Added: 2009-04-07 17:58:30

gl718.txt
Path: Lehigh >> DMD >> 1 Fall, 2008
Description: Subject: Re: history of lim-1 Date: Wed, 18 Jul 2001 10:52:14 -0500 (CDT) From: Brayton Gray <brayton@math.uic.edu> The six term exact sequence involving lim and lim^1 appears first in a paper by Roos entitled \"Sur les Foncteurs Derives de lim Applic...
Date Added: 2009-02-17 23:14:11

LAB4.NEW
Path: Texas San Antonio >> BIO >> 2322 Spring, 2008
Description: Recombinant DNA Session 04: Southern blotting BACKGROUND Blots! North, South, East (not yet), and West! Blots are an analytical technique to detect the presence and state of nucleic acid and protein sequences. The transfer of DNA from an agarose gel ...
Date Added: 2008-05-03 18:32:41

biolabreview
Path: Texas >> BIO >> 206L Spring, 2008
Description: INTRODUCTION TO THE LABORATORY PROCEDURES FOR OBTAINING AND PRESENTING DATA Exercises for Lab 1 A control is the same as the experimental group in all aspects except the variable being tested. This factor, called the \"independent variable,\" is varied...
Date Added: 2008-07-29 23:27:42

312.pdf
Path: University of Illinois, Urbana Champaign >> MCB >> 312 Fall, 2008
Description: Course Schedule - Spring 2009 Molecular and Cell Biology 312 Applied Microbiology Methods credit: 2 hours. Consideration, through experimentation, of properties of bacteria, yeasts, molds, and actinomycetes important to industrial processes; explorat...
Date Added: 2009-02-02 18:17:44

p1t18f08assn.xlsx
Path: Arizona >> MATH >> 115b Fall, 2008
Description: TEAM MARKETING DATA: Assignment Section: Team: Product: Description: 13 18 Demand Information Potential national market: 150,000,000 Test Markets Market Number 1 2 3 4 5 Market Size 3,965,400 2,127,100 3,627,400 1,187,900 3,500,200 Price $182.95 $18...
Date Added: 2009-01-12 04:55:22

hw7.pdf
Path: UC Riverside >> PHYS >> 291 Fall, 2008
Description: ...
Date Added: 2009-01-10 01:39:32

1740.118.ps
Path: Hawaii >> SOEST >> 1740 Fall, 2008
Description: Insitu Temperature (C) -5 0 200 400 0 5 10 15 20 25 30 33 Salinity (PSU) 30 20 10 0 Insitu Temperature (C) 34 35 36 Pressure (decibar) 600 800 1000 1200 1400 1600 33.0 1207373605.0388276 Float: 1740 Profile: 118 Location: 27.6N 141.1E Date: 01/27...
Date Added: 2009-02-17 20:00:05

masthead0203.pdf
Path: Maryland Baltimore >> LAW >> 0203 Fall, 2008
Description: ! ! \" \" # !\" $ % $ $ $ ! $ $ # $ $ $ ! % $ $ $ % \" % % % % \' \' % % \" \" ! ...
Date Added: 2009-02-11 22:24:04

NS(JSA) Sociobiology
Path: BU >> NS >> 101 Fall, 2007
Description: NS (JSA) Sociobiology 12/10/2007 11:02:00 AM Review of Natural Selection One of the main process responsible for evolutionary change o Other processes Sexual selection Genetic drift Produces adaptation by elimination of less fit genotypes o Malad...
Date Added: 2008-04-16 13:42:36

par8.pdf
Path: Purdue >> COM >> 590d Fall, 2008
Description: Eight Parameter Transformation - Ground XY (plane) to image a0 + a1 X + a2Y r= 1 + c1 X + c2Y c= b0 + b1 X + b2Y 1 + c1 X + c2Y Equations for application of the transformation, ground XY to r,c or row, column in the image. To insure numerical stabi...
Date Added: 2009-01-10 17:26:36

par8.pdf
Path: Purdue >> GRAD >> 590d Fall, 2008
Description: Eight Parameter Transformation - Ground XY (plane) to image a0 + a1 X + a2Y r= 1 + c1 X + c2Y c= b0 + b1 X + b2Y 1 + c1 X + c2Y Equations for application of the transformation, ground XY to r,c or row, column in the image. To insure numerical stabi...
Date Added: 2009-01-10 17:26:36

par8.pdf
Path: Purdue >> CE >> 597z Fall, 2008
Description: Eight Parameter Transformation - Ground XY (plane) to image a0 + a1 X + a2Y r= 1 + c1 X + c2Y c= b0 + b1 X + b2Y 1 + c1 X + c2Y Equations for application of the transformation, ground XY to r,c or row, column in the image. To insure numerical stabi...
Date Added: 2009-01-12 04:10:17

par8.pdf
Path: Purdue >> C E >> 597z Fall, 2008
Description: Eight Parameter Transformation - Ground XY (plane) to image a0 + a1 X + a2Y r= 1 + c1 X + c2Y c= b0 + b1 X + b2Y 1 + c1 X + c2Y Equations for application of the transformation, ground XY to r,c or row, column in the image. To insure numerical stabi...
Date Added: 2009-01-12 04:10:17

par8.pdf
Path: Purdue >> C E >> 503 Fall, 2008
Description: Eight Parameter Transformation - Ground XY (plane) to image a0 + a1 X + a2Y r= 1 + c1 X + c2Y c= b0 + b1 X + b2Y 1 + c1 X + c2Y Equations for application of the transformation, ground XY to r,c or row, column in the image. To insure numerical stabi...
Date Added: 2009-01-09 06:45:51

C921.pdf
Path: UGA >> C >> 921 Fall, 2008
Description: A Guide to National Policy Regarding Alien Workers: 2007 Regulations Simplified Matthew R. Chappell Extension Horticulturist - Nursery Production Background The nursery, greenhouse, and landscape industries in the United States have historically reli...
Date Added: 2009-02-18 13:53:48

Chapter 13 - Social Psychology
Path: Miami University >> PSY >> 111 Spring, 2008
Description: Psych Notes Chapter 13 Social Psychology Module 1 Cooperative Competition ALTRUSITIC BEHAVIOR is doing something without any benefit for yourself Ex: In experiment, chimp did not care about other unfamiliar begging monkeys getting food The Prisoner...
Date Added: 2008-04-21 07:12:11

hw_2.pdf
Path: Maryland >> PHYS >> 06 Fall, 2008
Description: QUANTUM PHYSICS I PROBLEM SET 2 due September 29 A. (Griths 1.18) When is quantum mechanics necessary ? In general, quantum mechanics is relevant when the de Broglie wavelength of the particle in question (h/p) is comparable to the characteristic ...
Date Added: 2009-02-18 00:18:20

hw_2.pdf
Path: Maryland >> PHYS >> 401 Fall, 2008
Description: QUANTUM PHYSICS I PROBLEM SET 2 due September 29 A. (Griths 1.18) When is quantum mechanics necessary ? In general, quantum mechanics is relevant when the de Broglie wavelength of the particle in question (h/p) is comparable to the characteristic ...
Date Added: 2009-02-18 00:18:21

BI09B23
Path: American International >> CHE >> 331 Spring, 2009
Description: 2 3 4 5 7 8 Comple x1 9 10 11 ...
Date Added: 2009-04-07 18:27:02

transition.pdf
Path: Penn State >> KINES >> 390 Fall, 2008
Description: Reproduced with permission of the copyright owner. Further reproduction prohibited without permission. Reproduced with permission of the copyright owner. Further reproduction prohibited without permission. Reproduced with permission of the copyrigh...
Date Added: 2009-01-11 17:35:36

comprehensive_review.pdf
Path: N. Illinois >> BIOS >> 447 Spring, 2008
Description: COMPARATIVE VERTEBRATE ANATOMY SPRING 2007 BIOLOGY 447 GENERAL REVIEW OF CONCEPTS 1. Be able to relate the structure and function of one anatomical system that is relevant to others. For example, evolution of feeding is vertebrates involves changes...
Date Added: 2009-01-11 17:06:44

Stewart_08.pdf
Path: Berkeley >> PHYSICS >> C290c Fall, 2008
Description: Merger Histories of LCDM Galaxies: Disk Survivability and the Deposition of Cold Gas via Mergers Kyle Stewart UC Berkeley Astro Seminar 9-9-08 Collaborators: James Bullock, Elizabeth Barton, Jeff Cooke UC Irvine Risa W echsler Stanford, Ari Malle...
Date Added: 2009-01-09 19:28:01

1738.015.ps
Path: Hawaii >> SOEST >> 1738 Fall, 2008
Description: Insitu Temperature (C) -5 0 200 400 0 5 10 15 20 25 30 33 Salinity (PSU) 30 20 10 0 Insitu Temperature (C) 34 35 36 Pressure (decibar) 600 800 1000 1200 1400 1600 33.0 1207372624.0388276 Float: 1738 Profile: 015 Location: 33.6N 142.2E Date: 08/31...
Date Added: 2009-02-17 20:02:49

Olivera.pdf
Path: George Mason >> PSY >> 2 Fall, 2009
Description: Parieto-frontal Interactions in Visual-object and Visual-spatial Working Memory: Evidence from Transcranial Magnetic Stimulation M. Oliveri1,2, P. Turriziani1,3, G.A. Carlesimo1,3, G. Koch3, F. Tomaiuolo1, M. Panella3 and C. Caltagirone1,3 IRCCS S. ...
Date Added: 2009-04-16 01:17:32

Olivera.pdf
Path: George Mason >> PSY >> 768 Fall, 2009
Description: Parieto-frontal Interactions in Visual-object and Visual-spatial Working Memory: Evidence from Transcranial Magnetic Stimulation M. Oliveri1,2, P. Turriziani1,3, G.A. Carlesimo1,3, G. Koch3, F. Tomaiuolo1, M. Panella3 and C. Caltagirone1,3 IRCCS S. ...
Date Added: 2009-04-16 01:17:32

LAB1.doc
Path: Iona >> WK >> 140 Fall, 2009
Description: COMPUTING LABORATORY FUNDAMENTALS OF USING WINDOWS OVERVIEW OF THE LABORATORY EXERCISE In this laboratory, you will learn about the Windows environment. You will learn to use Windows Explorer to manage and organize files and file folders on the comp...
Date Added: 2009-04-15 23:29:58

JL2001.pdf
Path: Hawaii >> IFA >> 2001 Fall, 2008
Description: THE ASTRONOMICAL JOURNAL, 122 : 20992114, 2001 October ( 2001. The American Astronomical Society. All rights reserved. Printed in U.S.A. COLORS AND SPECTRA OF KUIPER BELT OBJECTS1 DAVID C. JEWITT2 Institute for Astronomy, 2680 Woodlawn Drive, Honolu...
Date Added: 2009-02-17 19:24:33

Cobas_thesis.pdf
Path: LSU >> ETD >> 1114101 Fall, 2008
Description: MASS MEDIA ETHICS VS. ETHNIC IDENTITY: THE CUBAN AMERICAN NATIONAL FOUNDATION\'S BATTLE WITH THE MIAMI HERALD A Thesis Submitted to the Graduate faculty of the Louisiana State University and Agricultural and Mechanical College in partial fulfillment ...
Date Added: 2009-02-17 17:32:30

oldmidterm2sol.pdf
Path: UCSD >> ECE >> 153 Fall, 2008
Description: UCSD ECE 153 Prof. Young-Han Kim Handout #15 Wednesday, October 29, 2008 Solutions to Old Midterm Exam II 1. First available teller (20 points). Consider a bank with two tellers. The service times for the tellers are independent exponentially dist...
Date Added: 2009-01-11 21:37:30

oldmidterm2sol.pdf
Path: UCSD >> ECE >> 2 Summer, 2008
Description: UCSD ECE 153 Prof. Young-Han Kim Handout #15 Wednesday, October 29, 2008 Solutions to Old Midterm Exam II 1. First available teller (20 points). Consider a bank with two tellers. The service times for the tellers are independent exponentially dist...
Date Added: 2009-01-11 21:37:30

oldmidterm2sol.pdf
Path: UCSD >> ECE >> 4 Fall, 2008
Description: UCSD ECE 153 Prof. Young-Han Kim Handout #15 Wednesday, October 29, 2008 Solutions to Old Midterm Exam II 1. First available teller (20 points). Consider a bank with two tellers. The service times for the tellers are independent exponentially dist...
Date Added: 2009-01-11 21:37:30

ColoradoDaily050807.pdf
Path: Colorado >> COLORADODA >> 050807 Fall, 2008
Description: Work to be done for graduating students BY G.P. BUD PETERSON Tuesday, May 8, 2007 8:38 PM MDT With spring commencement ceremonies just two days away, I wanted to take this opportunity to speak directly to the graduating seniors, the advanced degree c...
Date Added: 2009-02-06 20:49:13

Erving Goffman
Path: Virginia Tech >> SOC >> 1004 Fall, 2008
Description: Erving Goffman, Humanizaing bureaucracies Dramaturgical approach Saw the performances staged in a theater as an analytical analogy and tool for depicting and understanding socialization and the shaping of the self Depicted social life as a stage o...
Date Added: 2008-09-30 13:23:37

Problem Set 7 answers
Path: Michigan State University >> CEM >> 383 Fall, 2007
Description: ...
Date Added: 2008-07-25 16:46:27

closedmonop.pdf
Path: Washington State >> ECONS >> 571 Fall, 2008
Description: Mark J. Gibson Monopolistic Competition Models with Homogeneous Firms The representative consumer is endowed with units of labor and has the utility function (1 ) log 0 c ( x ) n dx , where n is the measure of goods available and the elasticit...
Date Added: 2009-02-18 02:24:17

closedmonop.pdf
Path: Martin Luther >> SES >> 571 Fall, 2008
Description: Mark J. Gibson Monopolistic Competition Models with Homogeneous Firms The representative consumer is endowed with units of labor and has the utility function (1 ) log 0 c ( x ) n dx , where n is the measure of goods available and the elasticit...
Date Added: 2009-02-18 02:24:18

Chapter 17-1
Path: UNC >> CHEM >> 262 Spring, 2008
Description: CHEM 262 Wei You Chapter 17. Carboxylic Acids (1) Structure The functional group of a carboxylic acid is a carboxyl group O C OH O OH COOH CO2H Alternativerepresentationsforacarboxylgroup the general formula for an aliphatic carboxylic acid is...
Date Added: 2009-03-22 07:55:35

eb0504.pdf
Path: Cornell >> CCE >> 126 Fall, 2008
Description: May 2005 EB 2005-04 Wind Energy Development in New York State: Issues for Landowners Christopher J. Dorociak, Duane Chapman, Brian Henehan, and Jude Barry Department of Applied Economics and Management College of Agriculture and Life Sciences Cor...
Date Added: 2009-02-17 21:29:22

tut_quartus_intro_schem.pdf
Path: Wisconsin Milwaukee >> PHYSICS >> 351 Fall, 2009
Description: Quartus II Introduction Using Schematic Design This tutorial presents an introduction to the Quartus R II CAD system. It gives a general overview of a typical CAD ow for designing circuits that are implemented by using FPGA devices, and shows how thi...
Date Added: 2009-04-15 22:19:08

midterm_practice.pdf
Path: Pittsburgh >> MATH >> 1360 Fall, 2008
Description: MATH 1360, Fall 2007 - Review and Some Practice Problems for the Midterm Exam 1. One-dimensional ows x = f (x) (on the line and on the circle): you are expected to know how to nd xed points using both graphical and (where possible) analytical approa...
Date Added: 2009-02-02 20:07:00

hw11.doc
Path: Iowa State >> CPR E >> 281x Fall, 2008
Description: Assignment 11 Reading: Counters, Shift registers, multipliers and state machines. 1. PowerPC and MIPS Assembly Language: Consider the following C procedure: int SumArray (int *A, int N) {int sum; int i; sum = 0; for (i=0; i < N; i+) sum = sum + A[i]...
Date Added: 2009-01-10 17:10:12

hw11.doc
Path: Iowa State >> CPR E >> 282x Fall, 2008
Description: Assignment 11 Reading: Counters, Shift registers, multipliers and state machines. 1. PowerPC and MIPS Assembly Language: Consider the following C procedure: int SumArray (int *A, int N) {int sum; int i; sum = 0; for (i=0; i < N; i+) sum = sum + A[i]...
Date Added: 2009-01-10 17:10:12

Stegosaurus
Path: NYU >> CONWEST >> 101 Fall, 2005
Description: Writing The Essay: Sciences 11:00-12:15 The Stegosaurus Does the stegosaurus really function the way it looks? Does its form really fit its function? The stegosaurus has many unique anatomical features that physiologically, are a mystery. For exampl...
Date Added: 2008-04-17 20:09:58

Stegosaurus
Path: NYU >> WRIT >> V40. 0100 Spring, 2008
Description: Writing The Essay: Sciences 11:00-12:15 The Stegosaurus Does the stegosaurus really function the way it looks? Does its form really fit its function? The stegosaurus has many unique anatomical features that physiologically, are a mystery. For exampl...
Date Added: 2008-04-17 20:19:11

TR-92-23.pdf
Path: Virginia Tech >> CS >> 00000303 Fall, 2008
Description: ...
Date Added: 2009-02-18 00:47:00

confp11-07.pdf
Path: Iowa State >> HCI >> 504 Spring, 2008
Description: Cross-Hedging Distillers Dried Grains: Exploring Corn and Soybean Meal Futures Contracts by Adam Brinker, Joe Parcell, and Kevin Dhuyvetter Suggested citation format: Brinker, A., J. Parcell, and K. Dhuyvetter. 2007. Cross-Hedging Distillers Dried G...
Date Added: 2009-01-09 08:01:59

flowrate_prelab.pdf
Path: Mich Tech >> MEEM >> 3220 Fall, 2008
Description: Prelab for Air Flow Laboratory - November 7, 2008 Read the experiment narrative and 7.3 and 7.15 of the textbook. Then answer the following questions: 1. What is a discharge coecient? 2. How many diameters away from the stagnation port should the sta...
Date Added: 2009-01-10 17:14:07

simulator_project_phases.pdf
Path: Richmond >> CS >> 301 Fall, 2009
Description: CMSC 301 Simulator Project - Fall 2003 This project will be completed in three phases that model the development process, except that I am providing the basic class definition and the structure of the code in the main method. The end result will be a...
Date Added: 2009-04-15 23:34:05

030407business2.txt
Path: Chester >> ECO >> 343 Fall, 2008
Description: Budapest Business Journal - Article Last updated: 10th Apr 2003, 8:58 Banking Telecom Exchanges Real Estate Retail Advertising & Media Industry Politics Other News This week\'s BBJ Enter keyword(s): Advanced Search Cover Feature Whos...
Date Added: 2009-02-11 19:07:37

schenk05influence.pdf
Path: Penn State >> IST >> 535 Fall, 2008
Description: IEEE COMMUNICATIONS LETTERS, VOL. 9, NO. 8, AUGUST 2005 1 On the Inuence of Phase Noise Induced ICI in MIMO OFDM Systems Tim C. W. Schenk, Student Member, IEEE, Xiao-Jiao Tao, Member, IEEE, Peter F. M. Smulders, Senior Member, IEEE, and Erik R. Fle...
Date Added: 2009-02-02 15:29:23

5a.gbk.txt
Path: BYU >> PTIC >> 5 Fall, 2009
Description: LOCUS pTIC5a 5450 bp DNA CIRCULAR SYN 28-MAR-2008 DEFINITION Ligation of tetR frag into pTIC2 lacking tetR ACCESSION pTIC5a KEYWORDS . SOURCE Unknown. ORGANISM Unknown Unclassified. REFERENCE 1 (ba...
Date Added: 2009-04-16 00:01:05

ADV121_ConsumerDecisionMaking.ppt
Path: San Jose State >> ADV >> 121 Fall, 2008
Description: Consumer Decision Making Chapter 9: Individual Decision Making Chapter 10: Buying and Disposing Chapter 11: Group Influence and Opinion Leadership Chapter 12: Organizational and Household Decision Making The consumer decision process 2. 3. 4. 5. 6. ...
Date Added: 2009-01-10 17:56:25

Notes
Path: UNC >> DRAM >> 116 Fall, 2008
Description: DRAM 116 Class Notes AUGUST 22, 2007 Fall 2008 TO PERFORM: o Create a character that is both a part of and separate from ourselves o Human need; fundamental o Heart of theatre 3 types of performances: personal, community, and professional We pe...
Date Added: 2008-12-13 20:17:14

4.10.2.1
Path: Georgia Tech >> ECE >> 2040 Spring, 2008
Description: ...
Date Added: 2008-10-28 15:46:29

PNL-4100pt3.pdf
Path: Colorado >> NORGOVWEB >> 1 Fall, 1991
Description: DISCLAIMER This report was prepared as an account of work sponsored by an agency of the United States Government. Neither the United States Government nor any agency Thereof, nor any of their employees, makes any warranty, express or implied, or assu...
Date Added: 2009-02-04 14:09:08

PNL-4100pt3.pdf
Path: Colorado >> NORGOVWEB >> 1982 Fall, 2008
Description: DISCLAIMER This report was prepared as an account of work sponsored by an agency of the United States Government. Neither the United States Government nor any agency Thereof, nor any of their employees, makes any warranty, express or implied, or assu...
Date Added: 2009-02-04 14:09:08

MUS 10A Signature Page SP08.doc
Path: Fresno City College >> MUS >> 10a Fall, 2008
Description: Curriculum Signature Page Please check off the form(s) this signature page will pertain. New Course Proposal and Outline Revised Course Proposal Form A $ Form B Form C $ Form D $ Five-Year Review Form Form E Advise and Consent Special Studies 47 Spe...
Date Added: 2009-02-02 14:17:25

8out-5e.doc
Path: Santa Clara >> LSB >> 3 Fall, 2009
Description: CHAPTER 8 INVENTORIES: MEASUREMENT Overview The next two chapters continue our study of assets by investigating the measurement and reporting issues involving inventories and the related expense-cost of goods sold. Inventory refers to the assets a co...
Date Added: 2009-04-15 20:15:13

Gen_Psy_Ch17_Treatments
Path: Rutgers >> PSYCH >> 101 Spring, 2008
Description: Treatment Where do we go from here? Psychological Therapies Perspectives on Psychotherapy Medical Interventions Psychology, 4/e by Saul Kassin Psychological Therapies Clinical Psychologists Professionals Involved in Therapy Ph.D. in psychology, c...
Date Added: 2008-04-14 09:57:09

EHRD 621 Egan Fall 06.pdf
Path: Texas A&M >> EHRD >> 621 Fall, 2008
Description: SYLLABUSEHRD 621-601 Communication in Human Resource Development Texas AM University College of Education and Human Development Human Resource Development Instructor: Toby Marshall Egan Assistant Profe...
Date Added: 2009-02-03 13:27:54

midterm sample answers.pdf
Path: Illinois State >> FIL >> 440 Fall, 2008
Description: DEPARTMENT OF FINANCE, INSURANCE & LAW COLLEGE OF BUSINESS ILLINOIS STATE UNIVERSITY FIL 440 - Ahlgrim Midterm 100 points NAME _ NOTE: For all bond questions, always assume semiannual coupons unless stated otherwise in the question. MULTIPLE CHOICE ...
Date Added: 2009-01-10 17:08:55

021114Koizumi.txt
Path: Chester >> ECO >> 343 Fall, 2008
Description: WSJ.com - Koizumi Lacks a Bullet November 14, 2002 COMMENTARY Koizumi Lacks a Bullet By DAVID ROCHE Gone are the days when Japanese Prime Minister Junichiro Koizumi was billed as a star reformer. Instead his recent bank-reform package was a silver gu...
Date Added: 2009-02-11 18:20:10

exam2Topics.pdf
Path: Skidmore >> CS >> 323 Fall, 2009
Description: CS 323 Exam #2 S 08 Exam Topics Review the text and the lecture notes (the Outlines web page also has links to the Creational and Structural patterns lectures in PDF format - you can print these instead of the individual pages of the lecture notebo...
Date Added: 2009-04-15 21:09:13

SpectroscopyExcercise.pdf
Path: N.E. Illinois >> UX >> 3455 Fall, 2009
Description: Spectrophotometry Exercise CHM 3455 Biochemistry Lab, Dr. Scott Tremain Introduction Spectrophotometry is one of the most often used techniques in the biochemistry lab. How well you prepare your samples and use the spectrophotometer will greatly affe...
Date Added: 2009-04-15 22:11:23

swcc.ps
Path: Berkeley >> CS >> 258 Fall, 2008
Description: ...
Date Added: 2009-02-17 17:45:21

64.pdf
Path: UCLA >> ANDERSON >> 4150 Fall, 2008
Description: ...
Date Added: 2009-02-11 22:00:57

CHAPTER 2 THE CHEMICAL CONTEXT OF LIFE
Path: Michigan State University >> BS >> 110 Spring, 2007
Description: CHAPTER 2 THE CHEMICAL CONTEXT OF LIFE I. Chemical Elements and Compounds A. Matter consists of chemical elements in pure form and in combinations called compounds Chemistry is fundamental to an understanding of life, because living organisms are mad...
Date Added: 2008-03-18 23:02:12

?method=getElement&element=~week12~week12.ppt
Path: Old Dominion >> CS >> 495 Fall, 2008
Description: WebServerDesign Week12 Old Dominion University Department of Computer Science CS 495/595 Spring 2006 Michael L. Nelson <mln@cs.odu.edu> 3/27/06 DigestAuthentication Stillbasedonthechallenge/response mechanismsfirstemployedinBasic authenticatio...
Date Added: 2009-01-12 03:58:45

lecture8.pdf
Path: Lehigh >> IE >> 170 Fall, 2008
Description: Hashes Red-Black Trees Hashes Red-Black Trees Taking Stock Last Time Hashes (Intro to) Binary Search Trees More on Java Collections Interfaces Jeff Linderoth Department of Industrial and Systems Engineering Lehigh University IE170: Algorithms in S...
Date Added: 2009-04-15 19:37:39

lecture8
Path: Lehigh >> IE >> 170 Spring, 2007
Description: Hashes Red-Black Trees Hashes Red-Black Trees Taking Stock Last Time Hashes (Intro to) Binary Search Trees More on Java Collections Interfaces Jeff Linderoth Department of Industrial and Systems Engineering Lehigh University IE170: Algorithms in S...
Date Added: 2008-08-06 18:09:13

lecture8
Path: Lehigh >> IE >> 170 Spring, 2007
Description: Hashes Red-Black Trees Hashes Red-Black Trees Taking Stock Last Time Hashes (Intro to) Binary Search Trees More on Java Collections Interfaces Jeff Linderoth Department of Industrial and Systems Engineering Lehigh University IE170: Algorithms in S...
Date Added: 2008-08-06 18:09:13

VOL1Iss18.doc
Path: Old Dominion >> IS >> 702 Fall, 2008
Description: 1 WEEKLY BULLETIN Vol. 1, Issue 18 Deadlines: Dept of State Fall Internship application deadline March 1, 2007 White house Internship application deadline March 6, 2007 for SUMMER 2007 and June 26, 2007 for FALL 2007 International Conference U.S. ...
Date Added: 2009-01-09 05:50:39

VOL1Iss18.doc
Path: Old Dominion >> ECON >> 852 Fall, 2008
Description: 1 WEEKLY BULLETIN Vol. 1, Issue 18 Deadlines: Dept of State Fall Internship application deadline March 1, 2007 White house Internship application deadline March 6, 2007 for SUMMER 2007 and June 26, 2007 for FALL 2007 International Conference U.S. ...
Date Added: 2009-01-09 05:50:40

VOL1Iss18.doc
Path: Old Dominion >> ECON >> 698 Fall, 2008
Description: 1 WEEKLY BULLETIN Vol. 1, Issue 18 Deadlines: Dept of State Fall Internship application deadline March 1, 2007 White house Internship application deadline March 6, 2007 for SUMMER 2007 and June 26, 2007 for FALL 2007 International Conference U.S. ...
Date Added: 2009-01-09 05:50:40

VOL1Iss18.doc
Path: Old Dominion >> HIST >> 616 Fall, 2008
Description: 1 WEEKLY BULLETIN Vol. 1, Issue 18 Deadlines: Dept of State Fall Internship application deadline March 1, 2007 White house Internship application deadline March 6, 2007 for SUMMER 2007 and June 26, 2007 for FALL 2007 International Conference U.S. ...
Date Added: 2009-01-09 05:50:40

VOL1Iss18.doc
Path: Old Dominion >> IS >> 794 Spring, 2008
Description: 1 WEEKLY BULLETIN Vol. 1, Issue 18 Deadlines: Dept of State Fall Internship application deadline March 1, 2007 White house Internship application deadline March 6, 2007 for SUMMER 2007 and June 26, 2007 for FALL 2007 International Conference U.S. ...
Date Added: 2009-01-09 05:50:40

VOL1Iss18.doc
Path: Old Dominion >> IS >> 706 Fall, 2008
Description: 1 WEEKLY BULLETIN Vol. 1, Issue 18 Deadlines: Dept of State Fall Internship application deadline March 1, 2007 White house Internship application deadline March 6, 2007 for SUMMER 2007 and June 26, 2007 for FALL 2007 International Conference U.S. ...
Date Added: 2009-01-09 05:50:40

VOL1Iss18.doc
Path: Old Dominion >> POLS >> 697 Fall, 2008
Description: 1 WEEKLY BULLETIN Vol. 1, Issue 18 Deadlines: Dept of State Fall Internship application deadline March 1, 2007 White house Internship application deadline March 6, 2007 for SUMMER 2007 and June 26, 2007 for FALL 2007 International Conference U.S. ...
Date Added: 2009-01-09 05:50:40

VOL1Iss18.doc
Path: Old Dominion >> ECON >> 706 Fall, 2008
Description: 1 WEEKLY BULLETIN Vol. 1, Issue 18 Deadlines: Dept of State Fall Internship application deadline March 1, 2007 White house Internship application deadline March 6, 2007 for SUMMER 2007 and June 26, 2007 for FALL 2007 International Conference U.S. ...
Date Added: 2009-01-09 05:50:40

VOL1Iss18.doc
Path: Old Dominion >> HIST >> 633 Fall, 2008
Description: 1 WEEKLY BULLETIN Vol. 1, Issue 18 Deadlines: Dept of State Fall Internship application deadline March 1, 2007 White house Internship application deadline March 6, 2007 for SUMMER 2007 and June 26, 2007 for FALL 2007 International Conference U.S. ...
Date Added: 2009-01-09 05:50:40

VOL1Iss18.doc
Path: Old Dominion >> IS >> 819 Fall, 2008
Description: 1 WEEKLY BULLETIN Vol. 1, Issue 18 Deadlines: Dept of State Fall Internship application deadline March 1, 2007 White house Internship application deadline March 6, 2007 for SUMMER 2007 and June 26, 2007 for FALL 2007 International Conference U.S. ...
Date Added: 2009-01-09 05:50:40

VOL1Iss18.doc
Path: Old Dominion >> IS >> 712 Fall, 2008
Description: 1 WEEKLY BULLETIN Vol. 1, Issue 18 Deadlines: Dept of State Fall Internship application deadline March 1, 2007 White house Internship application deadline March 6, 2007 for SUMMER 2007 and June 26, 2007 for FALL 2007 International Conference U.S. ...
Date Added: 2009-01-09 05:50:40

VOL1Iss18.doc
Path: Old Dominion >> GEOG >> 650 Fall, 2008
Description: 1 WEEKLY BULLETIN Vol. 1, Issue 18 Deadlines: Dept of State Fall Internship application deadline March 1, 2007 White house Internship application deadline March 6, 2007 for SUMMER 2007 and June 26, 2007 for FALL 2007 International Conference U.S. ...
Date Added: 2009-01-09 05:50:40

VOL1Iss18.doc
Path: Old Dominion >> ECON >> 801 Fall, 2008
Description: 1 WEEKLY BULLETIN Vol. 1, Issue 18 Deadlines: Dept of State Fall Internship application deadline March 1, 2007 White house Internship application deadline March 6, 2007 for SUMMER 2007 and June 26, 2007 for FALL 2007 International Conference U.S. ...
Date Added: 2009-01-09 05:50:40

VOL1Iss18.doc
Path: Old Dominion >> HIST >> 634 Fall, 2008
Description: 1 WEEKLY BULLETIN Vol. 1, Issue 18 Deadlines: Dept of State Fall Internship application deadline March 1, 2007 White house Internship application deadline March 6, 2007 for SUMMER 2007 and June 26, 2007 for FALL 2007 International Conference U.S. ...
Date Added: 2009-01-09 05:50:40

VOL1Iss18.doc
Path: Old Dominion >> IS >> 897 Fall, 2008
Description: 1 WEEKLY BULLETIN Vol. 1, Issue 18 Deadlines: Dept of State Fall Internship application deadline March 1, 2007 White house Internship application deadline March 6, 2007 for SUMMER 2007 and June 26, 2007 for FALL 2007 International Conference U.S. ...
Date Added: 2009-01-09 05:50:40

VOL1Iss18.doc
Path: Old Dominion >> IS >> 717 Fall, 2008
Description: 1 WEEKLY BULLETIN Vol. 1, Issue 18 Deadlines: Dept of State Fall Internship application deadline March 1, 2007 White house Internship application deadline March 6, 2007 for SUMMER 2007 and June 26, 2007 for FALL 2007 International Conference U.S. ...
Date Added: 2009-01-09 05:50:40

VOL1Iss18.doc
Path: Old Dominion >> GEOG >> 695 Fall, 2008
Description: 1 WEEKLY BULLETIN Vol. 1, Issue 18 Deadlines: Dept of State Fall Internship application deadline March 1, 2007 White house Internship application deadline March 6, 2007 for SUMMER 2007 and June 26, 2007 for FALL 2007 International Conference U.S. ...
Date Added: 2009-01-09 05:50:40

VOL1Iss18.doc
Path: Old Dominion >> IS >> 606 Fall, 2008
Description: 1 WEEKLY BULLETIN Vol. 1, Issue 18 Deadlines: Dept of State Fall Internship application deadline March 1, 2007 White house Internship application deadline March 6, 2007 for SUMMER 2007 and June 26, 2007 for FALL 2007 International Conference U.S. ...
Date Added: 2009-01-09 05:50:39

VOL1Iss18.doc
Path: Old Dominion >> ECON >> 806 Fall, 2008
Description: 1 WEEKLY BULLETIN Vol. 1, Issue 18 Deadlines: Dept of State Fall Internship application deadline March 1, 2007 White house Internship application deadline March 6, 2007 for SUMMER 2007 and June 26, 2007 for FALL 2007 International Conference U.S. ...
Date Added: 2009-01-09 05:50:40

VOL1Iss18.doc
Path: Old Dominion >> HIST >> 645 Fall, 2008
Description: 1 WEEKLY BULLETIN Vol. 1, Issue 18 Deadlines: Dept of State Fall Internship application deadline March 1, 2007 White house Internship application deadline March 6, 2007 for SUMMER 2007 and June 26, 2007 for FALL 2007 International Conference U.S. ...
Date Added: 2009-01-09 05:50:41

VOL1Iss18.doc
Path: Old Dominion >> ECON >> 650 Fall, 2008
Description: 1 WEEKLY BULLETIN Vol. 1, Issue 18 Deadlines: Dept of State Fall Internship application deadline March 1, 2007 White house Internship application deadline March 6, 2007 for SUMMER 2007 and June 26, 2007 for FALL 2007 International Conference U.S. ...
Date Added: 2009-01-09 05:50:40

VOL1Iss18.doc
Path: Old Dominion >> GEOG >> 696 Fall, 2008
Description: 1 WEEKLY BULLETIN Vol. 1, Issue 18 Deadlines: Dept of State Fall Internship application deadline March 1, 2007 White house Internship application deadline March 6, 2007 for SUMMER 2007 and June 26, 2007 for FALL 2007 International Conference U.S. ...
Date Added: 2009-01-09 05:50:40

VOL1Iss18.doc
Path: Old Dominion >> IS >> 719 Fall, 2008
Description: 1 WEEKLY BULLETIN Vol. 1, Issue 18 Deadlines: Dept of State Fall Internship application deadline March 1, 2007 White house Internship application deadline March 6, 2007 for SUMMER 2007 and June 26, 2007 for FALL 2007 International Conference U.S. ...
Date Added: 2009-01-09 05:50:40

VOL1Iss18.doc
Path: Old Dominion >> IS >> 668 Fall, 2008
Description: 1 WEEKLY BULLETIN Vol. 1, Issue 18 Deadlines: Dept of State Fall Internship application deadline March 1, 2007 White house Internship application deadline March 6, 2007 for SUMMER 2007 and June 26, 2007 for FALL 2007 International Conference U.S. ...
Date Added: 2009-01-09 05:50:39

VOL1Iss18.doc
Path: Old Dominion >> ECON >> 807 Fall, 2008
Description: 1 WEEKLY BULLETIN Vol. 1, Issue 18 Deadlines: Dept of State Fall Internship application deadline March 1, 2007 White house Internship application deadline March 6, 2007 for SUMMER 2007 and June 26, 2007 for FALL 2007 International Conference U.S. ...
Date Added: 2009-01-09 05:50:40

VOL1Iss18.doc
Path: Old Dominion >> HIST >> 660 Fall, 2008
Description: 1 WEEKLY BULLETIN Vol. 1, Issue 18 Deadlines: Dept of State Fall Internship application deadline March 1, 2007 White house Internship application deadline March 6, 2007 for SUMMER 2007 and June 26, 2007 for FALL 2007 International Conference U.S. ...
Date Added: 2009-01-09 05:50:41

VOL1Iss18.doc
Path: Old Dominion >> ECON >> 697 Fall, 2008
Description: 1 WEEKLY BULLETIN Vol. 1, Issue 18 Deadlines: Dept of State Fall Internship application deadline March 1, 2007 White house Internship application deadline March 6, 2007 for SUMMER 2007 and June 26, 2007 for FALL 2007 International Conference U.S. ...
Date Added: 2009-01-09 05:50:40

VOL1Iss18.doc
Path: Old Dominion >> GEOG >> 697 Fall, 2008
Description: 1 WEEKLY BULLETIN Vol. 1, Issue 18 Deadlines: Dept of State Fall Internship application deadline March 1, 2007 White house Internship application deadline March 6, 2007 for SUMMER 2007 and June 26, 2007 for FALL 2007 International Conference U.S. ...
Date Added: 2009-01-09 05:50:40

VOL1Iss18.doc
Path: Old Dominion >> IS >> 722 Fall, 2008
Description: 1 WEEKLY BULLETIN Vol. 1, Issue 18 Deadlines: Dept of State Fall Internship application deadline March 1, 2007 White house Internship application deadline March 6, 2007 for SUMMER 2007 and June 26, 2007 for FALL 2007 International Conference U.S. ...
Date Added: 2009-01-09 05:50:40

How to analyze a game
Path: Cornell >> COM L >> 1126 Spring, 2009
Description: For a video game description to be accurate as a review, it is important to include elements such as graphics (appearance), interface (or controls) and the actual gameplay itself, including difficulty, perspective, genre and plot. Firstly, appearance...
Date Added: 2009-02-01 20:19:41

mitosis.pdf
Path: George Mason >> BIO >> 103 Fall, 2009
Description: Mitosis (Cell division) - Cells arise from other cells. You don\'t spontaneously make cells. - Until they discovered microbes, people did believe in spontaneous generation - molds, bacteria, etc. would appear magically. - Eventually, they discovered t...
Date Added: 2009-04-16 01:29:22

CareerServicesNewsletter8-18-06.pdf
Path: George Mason >> CONF >> 714 Spring, 2008
Description: Career Services Newsletter August 18, 2006 Volume 2, Issue 11 Welcome to the ICAR Career Services Newsletter. Questions or Comments to icarjob@gmu.edu Table of Contents Table of Contents.. 1 Job Search Spotlight. 2 Organization Spotlight .. 2 Fellow...
Date Added: 2009-01-11 18:42:58

CareerServicesNewsletter8-18-06.pdf
Path: George Mason >> CONF >> 740 Fall, 2008
Description: Career Services Newsletter August 18, 2006 Volume 2, Issue 11 Welcome to the ICAR Career Services Newsletter. Questions or Comments to icarjob@gmu.edu Table of Contents Table of Contents.. 1 Job Search Spotlight. 2 Organization Spotlight .. 2 Fellow...
Date Added: 2009-01-12 04:27:03

CareerServicesNewsletter8-18-06.pdf
Path: George Mason >> CONF >> 745 Fall, 2008
Description: Career Services Newsletter August 18, 2006 Volume 2, Issue 11 Welcome to the ICAR Career Services Newsletter. Questions or Comments to icarjob@gmu.edu Table of Contents Table of Contents.. 1 Job Search Spotlight. 2 Organization Spotlight .. 2 Fellow...
Date Added: 2009-01-11 18:42:58

CareerServicesNewsletter8-18-06.pdf
Path: George Mason >> CONF >> 502 Fall, 2008
Description: Career Services Newsletter August 18, 2006 Volume 2, Issue 11 Welcome to the ICAR Career Services Newsletter. Questions or Comments to icarjob@gmu.edu Table of Contents Table of Contents.. 1 Job Search Spotlight. 2 Organization Spotlight .. 2 Fellow...
Date Added: 2009-01-12 04:27:03

CareerServicesNewsletter8-18-06.pdf
Path: George Mason >> CONF >> 650 Fall, 2008
Description: Career Services Newsletter August 18, 2006 Volume 2, Issue 11 Welcome to the ICAR Career Services Newsletter. Questions or Comments to icarjob@gmu.edu Table of Contents Table of Contents.. 1 Job Search Spotlight. 2 Organization Spotlight .. 2 Fellow...
Date Added: 2009-01-12 04:27:03

CareerServicesNewsletter8-18-06.pdf
Path: George Mason >> CONF >> 642 Fall, 2008
Description: Career Services Newsletter August 18, 2006 Volume 2, Issue 11 Welcome to the ICAR Career Services Newsletter. Questions or Comments to icarjob@gmu.edu Table of Contents Table of Contents.. 1 Job Search Spotlight. 2 Organization Spotlight .. 2 Fellow...
Date Added: 2009-01-09 07:58:14

CareerServicesNewsletter8-18-06.pdf
Path: George Mason >> CONF >> 660 Spring, 2008
Description: Career Services Newsletter August 18, 2006 Volume 2, Issue 11 Welcome to the ICAR Career Services Newsletter. Questions or Comments to icarjob@gmu.edu Table of Contents Table of Contents.. 1 Job Search Spotlight. 2 Organization Spotlight .. 2 Fellow...
Date Added: 2009-01-12 04:27:03

CareerServicesNewsletter8-18-06.pdf
Path: George Mason >> CONF >> 900 Fall, 2008
Description: Career Services Newsletter August 18, 2006 Volume 2, Issue 11 Welcome to the ICAR Career Services Newsletter. Questions or Comments to icarjob@gmu.edu Table of Contents Table of Contents.. 1 Job Search Spotlight. 2 Organization Spotlight .. 2 Fellow...
Date Added: 2009-01-09 07:58:14

CareerServicesNewsletter8-18-06.pdf
Path: George Mason >> CONF >> 668 Summer, 2008
Description: Career Services Newsletter August 18, 2006 Volume 2, Issue 11 Welcome to the ICAR Career Services Newsletter. Questions or Comments to icarjob@gmu.edu Table of Contents Table of Contents.. 1 Job Search Spotlight. 2 Organization Spotlight .. 2 Fellow...
Date Added: 2009-01-12 04:27:03

SPIRITUAL_NEEDS.rtf
Path: Syracuse >> ARC >> 572 Fall, 2008
Description: IDENTIFYING SPIRITUAL NEEDS Illness, disease, addiction, depression, emotional disorders and other imbalances in our lives are directly related to unmet spiritual needs. We are most aware of spiritual needs whenever we question the meaning of our lif...
Date Added: 2009-01-09 15:30:25

SPIRITUAL_NEEDS.rtf
Path: Syracuse >> ARC >> 604 Fall, 2008
Description: IDENTIFYING SPIRITUAL NEEDS Illness, disease, addiction, depression, emotional disorders and other imbalances in our lives are directly related to unmet spiritual needs. We are most aware of spiritual needs whenever we question the meaning of our lif...
Date Added: 2009-01-09 15:30:25

SPIRITUAL_NEEDS.rtf
Path: Syracuse >> ARC >> 605 Fall, 2008
Description: IDENTIFYING SPIRITUAL NEEDS Illness, disease, addiction, depression, emotional disorders and other imbalances in our lives are directly related to unmet spiritual needs. We are most aware of spiritual needs whenever we question the meaning of our lif...
Date Added: 2009-01-09 15:30:25

SPIRITUAL_NEEDS.rtf
Path: Syracuse >> ARC >> 621 Fall, 2008
Description: IDENTIFYING SPIRITUAL NEEDS Illness, disease, addiction, depression, emotional disorders and other imbalances in our lives are directly related to unmet spiritual needs. We are most aware of spiritual needs whenever we question the meaning of our lif...
Date Added: 2009-01-09 15:30:25

SPIRITUAL_NEEDS.rtf
Path: Syracuse >> ARC >> 681 Fall, 2008
Description: IDENTIFYING SPIRITUAL NEEDS Illness, disease, addiction, depression, emotional disorders and other imbalances in our lives are directly related to unmet spiritual needs. We are most aware of spiritual needs whenever we question the meaning of our lif...
Date Added: 2009-01-09 15:30:25

SPIRITUAL_NEEDS.rtf
Path: Syracuse >> ARC >> 557 Fall, 2008
Description: IDENTIFYING SPIRITUAL NEEDS Illness, disease, addiction, depression, emotional disorders and other imbalances in our lives are directly related to unmet spiritual needs. We are most aware of spiritual needs whenever we question the meaning of our lif...
Date Added: 2009-01-09 15:30:25

NFS 201 - Drop Course.pdf
Path: Kentucky >> NFS >> 201 Fall, 2008
Description: ...
Date Added: 2009-02-03 13:52:47

PointPlanBrief2006.pdf
Path: Hawaii >> HAWAIIENER >> 2006 Fall, 2006
Description: Hawaii Energy Policy Forum: 10 Point Plan for a Sustainable Energy Future Kyle Datta, Senior Director Rocky Mountain Institute 0 0 Our Challenge Energy prices have nearly doubled and increasing fuel prices cost the state more than $750 million doll...
Date Added: 2009-02-17 19:52:28

Cambridge nurturing_ResearchPaper
Path: Cornell >> NBA >> 5930 Spring, 2007
Description: The fertile soil of Silicon Fen: NURTURING ENTREPRENEURS: In the second of a series on entrepreneurship, Maija Pesola looks at why Cambridge remains a centre for technology start-up companies. FTFT000020050209e1290001v BUSINESS LIFE ENTERPRISE By MAI...
Date Added: 2009-02-19 22:57:23

5.pdf
Path: Arizona >> CS >> 227 Fall, 2008
Description: Chapter 5 Analysis of Algorithms Goals Analyze algorithms Understand some classic searching sorting and algorithms Distinguish O(1), O(n), O(n log n), and O(n2) 5.1 Algorithm Analysis This chapter introduces a way to reason about the efficiency ...
Date Added: 2009-04-15 23:04:08

project_ece751.pdf
Path: Wisconsin >> M E >> 751 Fall, 2008
Description: Project Description for Embedded Computing Systems (ECE 751) Fall 2006 Project: For the course project, you will be expected to complete original work related to embedded systems in teams of two or three students. Projects will consist of a proposal,...
Date Added: 2009-02-03 14:25:42

erasure-jfp.pdf
Path: UPenn >> CIS >> 700 Spring, 2006
Description: Under consideration for publication in J. Functional Programming 1 Type-Safe Run-time Polytypic Programming STEPHANIE WEIRICH Department of Computer and Information Science University of Pennsylvania Philadelphia, PA 19104, USA Abstract Polytypic ...
Date Added: 2009-02-06 17:34:43

10Gbase-T.pdf
Path: MTSU >> INFS >> 4790 Fall, 2008
Description: ...
Date Added: 2009-01-09 03:10:52

10Gbase-T.pdf
Path: MTSU >> INFS >> 4900 Spring, 2008
Description: ...
Date Added: 2009-01-09 03:10:53

10Gbase-T.pdf
Path: MTSU >> INFS >> 5790 Fall, 2008
Description: ...
Date Added: 2009-01-09 03:10:53

10Gbase-T.pdf
Path: MTSU >> INFS >> 5900 Fall, 2008
Description: ...
Date Added: 2009-01-09 03:10:53

Exam 1 - F2005
Path: North Texas >> CHEM >> 2370 Fall, 2007
Description: 1 4. Wrhich cc7mpound would have the highest boiling point? A) CE3CHCH3 / 5. IF the role of the solvent is to assist in the preparation and stabilization of the Gfignmd reagent by coordination with the magnesium, which of these solv_entsshould be ...
Date Added: 2008-04-14 13:40:38

ef152-lec-1-5
Path: Tennessee >> EF >> 152 Spring, 2008
Description: Module 1, Lecture 5 Given: A 2 m long 90 N plank hangs vertically from a frictionless hinge. The plank is struck 1.5 m below the hinge by a 3 kg ball traveling at 10 m/s. The ball rebounds at 6 m/s. Required: Angular velocity of the plank. Example: ...
Date Added: 2009-04-07 17:58:24

StorySubmission.pdf
Path: Clemson >> PRTM >> 391 Spring, 2008
Description: Welcome to the College of HEHD Story Submission Webpage. Please fill out the form below and hit the submit button when you are finished. Name I am an Alumni Email Phone Number Year of Graduation Degree Maiden Name I am HEHD Faculty/Staff HEHD Sc...
Date Added: 2009-01-10 17:31:55

bluetooth.pdf
Path: Rochester >> ECE >> 237 Fall, 2009
Description: BluetoothA New Low-Power Radio Interface Providing Short-Range Connectivity JAAP C. HAARTSEN, MEMBER, IEEE, AND SVEN MATTISSON, MEMBER, IEEE In the past decades, progress in microelectronics and VLSI technology has fostered the widespread use of comp...
Date Added: 2009-04-15 22:35:04

280H - F2005 - Sylabus.pdf
Path: Berkeley >> SOCIOL >> 280h Fall, 2008
Description: SOCIOLOGY 280H Fall, 2005 AN ADVANCED INTRODUCTION TO THE COMPARATIVE STUDY OF DEVELOPMENT Release 1.0 Peter Evans PEVANS@BERKELEY.EDU WEBSITE: http:/sociology.berkeley.edu/faculty/evans/index.html CLASS MEETINGS: 402 Barrows Wed. 4-6 PM OFFICE ...
Date Added: 2009-01-11 21:22:19

Chapter12-15
Path: Texas >> PHY >> 303K Spring, 2005
Description: ...
Date Added: 2008-03-23 11:27:19

GMP.pdf
Path: Michigan >> EECS >> 498 Fall, 2008
Description: Group Membership Service EECS 498 Lecture Notes Farnam Jahanian Department of EECS University of Michigan http:/www.eecs.umich.edu/~farnam Reading List Section 13.9 in Building Reliable and Secure Network Applications by Ken Birman, 1997. (optional...
Date Added: 2009-02-02 19:42:00

430SyllFall2008.doc
Path: University of North Carolina, Wilmington >> BIO >> 430 Fall, 2008
Description: BIO 430 EVOLUTIONARY BIOLOGY, FALL 2008 Meets: M&W 5:00-6:15, 103 Dobo Hall Instructor: Dr. Michael A. McCartney (MCCARTNEYM@UNCW.EDU) Office: 2328 Center for Marine Science (CMS) Office Phone: 2-2391 (CMS), 2-2676 (Friday) On-campus office hours...
Date Added: 2009-02-02 19:58:36

1728.182.ps
Path: Hawaii >> SOEST >> 1728 Fall, 2008
Description: Insitu Temperature (C) -5 0 200 400 0 5 10 15 20 25 30 33 Salinity (PSU) 30 20 10 0 Insitu Temperature (C) 34 35 36 Pressure (decibar) 600 800 1000 1200 1400 1600 33.0 1207369581.0388276 Float: 1728 Profile: 182 Location: 29.6N 143.9E Date: 10/26...
Date Added: 2009-02-17 20:25:31

Paper 1 Proteus
Path: Tulane >> ENGL >> 101-15 Spring, 2008
Description: Willy Stout English 101-15 February 12th, 2008 Catching and Deciphering \"Proteus\" James Joyce\'s novel, Ulysses, is subdivided for simplicity into chapters with the names of the original Odyssey chapters. The third one, \"Proteus\" is usually considered...
Date Added: 2008-04-07 11:05:25

solution12.pdf
Path: Purdue >> MATH >> 12 Fall, 2000
Description: PROBLEM OF THE WEEK Solution of Problem No. 12 (Spring 2002 Series) Problem: Determine all the real 2 2 matrices A = a c b d satisfying A2 + A + I = 0. Solution (by Damir Dzhafarov, Fr. MA, edited by the Panel) Expanding the equation yields the sys...
Date Added: 2009-02-06 18:29:07

6-Menus.doc
Path: San Jose State >> CS >> 130 Fall, 2008
Description: Menus In .NET, a menu is just another object that you can add to your form. You can add objects to your form by drop-and-drag from the Toolbox. If you dont see the toolbox, choose View | Toolbox in the main menu of Visual Studio. You should see this:...
Date Added: 2009-01-11 18:10:44

US-constitution.pdf
Path: Santa Rosa >> RE >> 51 Fall, 2008
Description: LeaderCenter Our U.S. Constitution Revisited The Constitution of the United States of America is the supreme law of the United States. It provides the framework for the organization of the United States Government. Discover facts about the United Sta...
Date Added: 2009-01-09 10:28:49

US-constitution.pdf
Path: Santa Rosa >> INTDIS >> 51 Fall, 2008
Description: LeaderCenter Our U.S. Constitution Revisited The Constitution of the United States of America is the supreme law of the United States. It provides the framework for the organization of the United States Government. Discover facts about the United Sta...
Date Added: 2009-01-09 10:28:49

001108Opposition.txt
Path: Chester >> ECO >> 343 Fall, 2008
Description: WSJ.com - Americas A Popular Vote? See the Election 2000 Center for complete coverage of federal and state elections across the U.S. and up-to-the-minute returns. Special Report Dot-Com Dominoes: Layoffs and closures have gathered speed. We examine ...
Date Added: 2009-02-11 17:55:38

Quiz1Review
Path: Texas >> EE >> 339 Spring, 2007
Description: Semiconductor Crytals: Semiconductor crystals are composed of atoms from column IV, III VI Most commonly used is Si b/c it readily grows a insulating thermal oxide (Si02) Properties and Growth 3 basic solid types: Crystalline (ord...
Date Added: 2008-06-06 11:18:20

3.6 Chain Rule
Path: Grove City >> MATH >> 161 Spring, 2008
Description: 3.6 Chain Rule ...
Date Added: 2008-04-07 20:48:40

wccf26l_handout_final_revised.pdf
Path: UCSD >> IDIOM >> 26 Fall, 2008
Description: Two syntactic positions for English Aspectual Verbs Shin Fukuda University of California, San Diego Presented at the 26th West Coast Conference on Formal Linguistics (WCCFL 26) April 27-29th, 2007. University of California, Berkeley 1.1 An alternati...
Date Added: 2009-02-17 18:25:26

pg66-lec4
Path: UC Irvine >> BME >> 110A Spring, 2006
Description: ...
Date Added: 2008-04-09 20:17:21

montana_ref_2001.pdf
Path: Texas >> LIB >> 2001 Fall, 2008
Description: ...
Date Added: 2009-02-11 22:38:22

montana_ref_2001.pdf
Path: Caribbean >> LIB >> 2001 Fall, 2008
Description: ...
Date Added: 2009-02-17 18:12:50

kirchberg06.pdf
Path: Maryland >> PHYSICS >> 06 Fall, 2008
Description: pss www.pss-b.com physica basic solid state physics Current-carrying capacity of semiconducting carbon nanotubes Yung-Fu Chen and Michael S. Fuhrer Department of Physics and Center for Superconductivity Research, University of Maryland, College Pa...
Date Added: 2009-02-06 19:28:10

Eng1B_E4a.pdf
Path: San Jose State >> AS >> 1b Spring, 2008
Description: English 1B, Sections 17 & 29 (Spring 2006) Dr. Katherine D. Harris ESSAY 4: Flip-Flops First Draft Due: Tues, 3/21 (1 email copy by 8am + 1 copy to class) First Draft: Though flip-flops might seem like a silly topic, there are actually many differen...
Date Added: 2009-01-09 07:02:05

Chapter 2 Notes
Path: Pacific >> EPSY >> 121X Spring, 2008
Description: January 28th, 2008 CHAPTER 2 Cognitive development and language o Principles of development Rates differ Orderly Gradual o Continuous versus discontinuous theories of development Continuous Development progresses smoothly and gradually from infan...
Date Added: 2008-04-29 20:53:38

phonetic_feature.pdf
Path: Cornell >> FILM >> 495 Fall, 2008
Description: ...
Date Added: 2009-01-12 04:26:27

hist2 test4
Path: Texas >> HIST >> 315 L Spring, 2008
Description: 1965-1980 Vietnam war: Vietnamese resistance - Ho Chi Minh - with USA cooperation 1877-1940 - vietnam controlled by france 1940 - 1945 - Japanese occupy vietnam 1945-1954 - french war in vietnam -> US aids france, Soviet union supports ho chi minh, a...
Date Added: 2008-09-11 11:33:07

Spanish Composition
Path: SUNY Oswego >> SPA >> 102 Spring, 2007
Description: Kevin McDermott SPA 102 Professora Whittingham 11-28-07 Feliz Navidad! Mi temporada favorita del ao es invierno. Era lunes, el veinte cuatro de diciembre. Nosotros viviamos en la isla de Staten pero ir a mis madres para Feliz Navidad. Mi padre tenia...
Date Added: 2008-04-29 05:53:43

RSA_Example.pdf
Path: LSU >> MATH >> 4023 Fall, 2008
Description: ) % 9*%7 )< \'( > ) $ :<7 ,?@ \' \'% \'( \'( % ! % )\' )\' )% !\"# $ % # $ % # $ % # $ % # $ % \'( $ % \'( $ % \'( $ % \'( $ % \'( $ % & *+ ,- ./0 ...
Date Added: 2009-01-11 16:31:39

050120yen.txt
Path: Chester >> ECO >> 343 Fall, 2008
Description: WSJ.com - Economic Impact Of Yen\'s Gains Worries Japanese January 20, 2005 ASIAN BUSINESS NEWS DOW JONES REPRINTS This copy is for your personal, non-commercial use only. To order presentation-ready copies for distribution to your colleagues, client...
Date Added: 2009-02-11 17:49:29

Formal Proposal Audience Analysis
Path: Detroit Mercy >> ENG >> 303 Spring, 2008
Description: \"Fast Track\" Proposal: ODOT Audience Analysis Currently, the state of Ohio is suffering from uneven distribution of money allocated to build and maintain its highway systems (Geyer). Once this has been taken care of internally, and money is getting t...
Date Added: 2008-03-29 20:41:50

eecs 31.pdf
Path: UC Irvine >> EECS >> 31 Fall, 2008
Description: EECS31 INTRODUCTION TO DIGITAL SYSTEMS Catalog Data: EECS31 Introduction to Digital Systems (Credit Units: 4) F, Summer. Digital representation of information. Specifications of combinational and sequential systems. Analysis and design of networks of...
Date Added: 2009-02-02 17:15:24

SOS4720C_DE_2008.pdf
Path: UF >> SOS >> 6722 Fall, 2008
Description: GIS IN LAND RESOURCE MANAGEMENT - SOS 4720C Distance Education Section INSTRUCTOR: Dr. Sabine Grunwald, Associate Professor, Soil and Water Science Department, University of Florida, 2169 McCarty Hall, PO Box 110290, Gainesville, FL 32611-0290. CONT...
Date Added: 2009-01-10 18:29:47

documentary syllabus RTV 6033 Spring 2007.doc
Path: Arkansas State >> RTV >> 6033 Spring, 2008
Description: RTV 6033-01 The Broadcast Documentary Spring 2007 Dr. Mary Jackson Pitts Office-Rm 367 Ph: 972-3361 Office Hours :MWF1011 TTH9:3010:30 www.clt.astate.edu/mpitts mpitts@astate.edu Course Description: This course provides for the graduate student in ...
Date Added: 2009-02-02 21:19:20

hw1.doc
Path: Purdue >> STAT >> 503 Fall, 2008
Description: Stat 503 Divisions 1 & 4 Homework #1 (40 points) (4) Due Thu. 1/22/09 e 19 (5) (0) (4) (4) (12) (9) (6) (4) 1. Page 24, Exercise 2.6 (Histogram plot may be done using Excel or by hand, as you prefer.) 2. Page 25, Exercise 2.9 (not to be graded) 3...
Date Added: 2009-02-11 22:15:22

homework-chapter-7.pdf
Path: Southern Methodist >> PHYS >> 1303 Fall, 2008
Description: ...
Date Added: 2009-01-09 15:24:13

pstr 1312 SYLLABUS FALL 2007.O07.doc
Path: St. Philips College >> ARTS >> 1312 Spring, 2008
Description: ST. PHILIPS COLLEGE 1801 MARTIN LUTHER KING DRIVE SAN ANTONIO, TX 78203-2098 210-531-3315 DEPARTMENT OF TOURISM, HOSPITALITY AND CULINARY ARTS SYLLABUS FOR THE COURSE PSTR 1312 LAMINATED DOUGH, PATE AU CHOUX, AND DONUTS INSTRUCTOR: Cynthia Dela Fue...
Date Added: 2009-02-02 16:17:37

lec_19.pdf
Path: UC Irvine >> CHEM >> 130c Spring, 2008
Description: 5/12/2008 Ex 22.1a HW 5 solutions TherateofthereactionA+2B>3C+Dwasreportedas1.0 moldm3 s1.Statetheratesofformationandconsumptionof theparticipants. 5/12/2008 HW5solutions 1 5/12/2008 HW5solutions 2 22.3a 22.5a At518C,therateofdecomposition...
Date Added: 2009-01-09 19:43:21

Midwestpepperrpt.pdf
Path: Purdue >> HORT >> 2001 Fall, 2008
Description: Bell and Specialty Pepper Evaluations for Bacterial Spot Resistance, Yield, and Quality Brent Rowell, R. T. Jones, W. Nesmith, A. Satanek, W. Turner, and J.C. Snyder Dept. of Horticulture, N-318 Agric. Science North, Univ. of Kentucky, Lexington, KY ...
Date Added: 2009-02-11 22:17:54

CROSSWORD_PUZZLE_1.pdf
Path: Penn State >> MUSIC >> 435 Fall, 2008
Description: 1 4 5 10 11 12 6 7 8 2 9 3 ACROSS H L 4. 7. 11. 14. 15. 17. 13 15 14 16 17 I N 18 21 19 20 I A E 22 T E 21. 22. 23. 23 24. 24 25 26 26. 27 28 H A 29 30 31 32 27. 29. 31. 33. 34. M 33 A device that stores an electrical char...
Date Added: 2009-01-09 09:40:37

103a_hw7.pdf
Path: UCSD >> MATH >> 207a Fall, 2008
Description: ...
Date Added: 2009-01-10 01:48:55

103a_hw7.pdf
Path: UCSD >> MATH >> 207b Winter, 2008
Description: ...
Date Added: 2009-01-10 01:48:55

103a_hw7.pdf
Path: UCSD >> MATH >> 103a Fall, 2008
Description: ...
Date Added: 2009-01-11 21:30:09

Clermont Kevin 109 Harv. L. Rev. 1120 (1996).pdf
Path: Cornell >> COM L >> 109 Fall, 2008
Description: HeinOnline - 109 Harv. L. Rev. 1120 1995-1996 HeinOnline - 109 Harv. L. Rev. 1121 1995-1996 HeinOnline - 109 Harv. L. Rev. 1122 1995-1996 HeinOnline - 109 Harv. L. Rev. 1123 1995-1996 HeinOnline - 109 Harv. L. Rev. 1124 1995-1996 HeinOnline - 10...
Date Added: 2009-02-02 13:59:41

Exam 2 People
Path: Michigan State University >> ISS >> 220 Fall, 2008
Description: Jane Addams (1860-1935) Founded a house in Chicago for immigrants, was a founder of the U.S. Settlement House Movement and the first American woman to be awarded the Nobel Peace Prize, co-founded Hull House in Chicago, Illinois, one of the first set...
Date Added: 2008-03-19 07:30:44

constraints.pdf
Path: Mississippi State >> ECE >> 4542 Fall, 2009
Description: Name Sensor Range Accuracy Calibration Power Description The resistance of the semiconductor oxide sensor must not vary based upon temperatures ranging from 0 to 120 degrees Fahrenheit. The device will contain a 7-segment display, which will display...
Date Added: 2009-04-15 21:25:27

gbnep11_cover-contents.pdf
Path: TAMU Galveston >> GBIC >> 11 Fall, 2011
Description: Galveston Bay National Estuary Program Fiscal Year 1992 Annual Workplan Galveston Bay National Estuary Program GBNEP Publication - 11 March 1991 This project has been funded wholly or in part by the United States Environmental Protection Agency und...
Date Added: 2009-02-11 21:28:41

Acct6000HarveysyllabusF08.pdf
Path: UGA >> ACCT >> 6000 Fall, 2008
Description: David W. Harvey Fall 2008 - Monday-Wednesday 8:00 a.m. UGA Athens Sanford Hall Room 313 Office hours: Monday and Wednesday 9:15-10:15 and by appointment Office at UGA Athens: 231-A Brooks Hall (706) 542-3617 (O); (706) 546-1739 (H); (706) 614-4650 (...
Date Added: 2009-02-06 19:40:22

lecture10.pdf
Path: Caltech >> CS >> 141b Winter, 2008
Description: Recap Consistency Models Fault Tolerance Reliable Communication Security Distributed Computation Laboratory http:/www.cs.caltech.edu/~cs141/ Distributed Filesystems 15 May 2002 1 Today Distributed File Systems Distributed Computation Laboratory ...
Date Added: 2009-01-09 19:57:19

finalfall2004
Path: Cornell >> MATH >> 1920 Spring, 2008
Description: ...
Date Added: 2008-06-01 16:45:56

p7131.pdf
Path: Medical College >> P >> 7131 Fall, 2008
Description: Policy 7.13.1 Faculty Appointment, Development, Promotion, & Tenure Policy: Recruitment Medical College of Georgia Academic, Research, and Student Affairs Policy Library Policy 7.13.1 Volume 7 Faculty Affairs Chapter 13.1 Faculty Appointment, Devel...
Date Added: 2009-02-11 22:24:18

MachDes-Proj. 9-2007.pdf
Path: UNI >> 330 >> 9 Fall, 2008
Description: 330:148 (g) Machine Design Assignment 9 (Shaft design) To be submitted by November 5, 2007 1. A shaft of diameter 60 mm is subjected to a shear stress of 40 MPa and has an angle of twist equal to 0.01 radian. Determine the length of the shaft for G =...
Date Added: 2009-02-02 20:00:32

Matlab_Part2.pdf
Path: USF >> EEL >> 4512 Fall, 2009
Description: 1 EEL4512, Introduction to Communication Systems Dept. of Electrical Engineering, University of South Florida Matlab Project: Part 2 Ismail Guvenc, Fall 2005 I. M ULTIPATH A. Brief Information In wireless communication systems, multiple reections o...
Date Added: 2009-04-16 00:37:37

9. Dr. Leonard\'s Study Questions
Path: NYMC >> PHYS >> 1010 Fall, 2007
Description: Study Questions for Dr. Leonard\'s lectures: 1. 2. 3. 4. 5. 6. 7. 8. 9. Describe different types of movement that are generated by the our central motor system. Discuss the major components of the central motor system and their organization. What is...
Date Added: 2008-04-18 10:43:31

license.txt
Path: Hawaii >> SCHOLARSPA >> 1370 Fall, 2008
Description: Item submitted by Hiroko Sato (hirokosa@hawaii.edu) on 2008-04-28T21:43:47Z (GMT): NON-EXCLUSIVE DISTRIBUTION LICENSE By signing and submitting this license, you (the author(s) or copyright owner) grants to University of Hawaii at Manoa (UHM) the non...
Date Added: 2009-02-17 19:29:27

license.txt
Path: Hawaii >> SCHOLARSPA >> 10125 Fall, 1989
Description: Item submitted by Hiroko Sato (hirokosa@hawaii.edu) on 2008-04-28T21:43:47Z (GMT): NON-EXCLUSIVE DISTRIBUTION LICENSE By signing and submitting this license, you (the author(s) or copyright owner) grants to University of Hawaii at Manoa (UHM) the non...
Date Added: 2009-02-17 19:29:27

03a6.pdf
Path: UCLA >> ANDERSON >> 4809 Fall, 2008
Description: ...
Date Added: 2009-02-11 21:59:51

ChIV.pdf
Path: Texas Tech >> ME >> 3370 Fall, 2008
Description: Ch. IV Differential Relations for a Fluid Particle This chapter presents the development and application of the basic differential equations of fluid motion. Simplifications in the general equations and common boundary conditions are presented that a...
Date Added: 2009-04-15 20:35:12

collisions.xls
Path: Mary Baldwin >> PHYS >> 201 Fall, 2008
Description: Names: DATA: Cart 1 mass 1 (kg) x x x x x x x x Trial 1 Trial 2 Trial 3 Trial 4 watch +/- signs watch +/- signs vi (m/s) vf (m/s) x x x x x x x x Cart 2 mass 2 (kg) x x x x (at rest) vi (m/s) 0 0 0 0 watch +/- signs vf (m/s) x x x x CALCULA...
Date Added: 2009-02-11 21:43:21

001018Troubles.txt
Path: Chester >> ECO >> 343 Fall, 2008
Description: WSJ.com - Business and Finance - Asia Voices Event Join John Bogle, the founder and former chairman of Vanguard, for a live discussion on investing in the new millennium, Wednesday at 2 p.m. EDT. Discuss the last presidential debate with Capital Jou...
Date Added: 2009-02-11 17:52:58

1325-582fact.pdf
Path: UT Arlington >> MATH >> 1325 Fall, 2008
Description: Factsheet for MATH 1325-582 (Spring 2004) INSTRUCTOR: Larry F. Heath Classroom: 309 Pickard Hall Office: 435 Pickard Hall Office Hours: 8:00am-9:50am MWF 11:00am-11:30am MWF 4:00pm-5:20pm TTh and by appointment Office Telephone: 817-272-3261 e-mail a...
Date Added: 2009-02-03 14:11:53

5320-20081(001)-hwk.pdf
Path: Texas Tech >> IE >> 5320 Fall, 2008
Description: HomeWork #1 1.2 1.3 1.4 1.6 2.1 2.2 Due Sep 8 1a,b,e,f, 2a,d,e,f, 3, 4c, 5-6 1, 3 1-3, 5, 7 2, 4, 5 2, 7, 10e, 11 3, 4 such that ( , +, , ) Page 2 Page 4 Page 5 Page 10 Page 13 Page 17 P. 1. Prove there does not exist an order relation on is an...
Date Added: 2009-02-03 13:33:16

HW-10-01-08s-Ch13
Path: Lehigh >> IE >> 215 Spring, 2008
Description: IE 215 Solutions for Problems due Oct 1, 2008 (Ch 13) 13.1 The diameter of an extruder barrel is 65 mm and its length = 1.75 m. The screw rotates at 55 rev/min. The screw channel depth = 5.0 mm, and the flight angle = 18. The head pressure at the die...
Date Added: 2008-10-21 09:44:05

Education (Soci)
Path: Towson >> SOCI >> 101 Fall, 2007
Description: Class Outline: Education (M, ch. 14, pp. 380 - 395) 1. 2. 3. 4. 5. 6. Education as a Social Institution Understanding Schooling from Structural Functionalist and Social Conflict Perspectives Public and Private Schools and Equalizing Education Changin...
Date Added: 2008-04-07 22:52:03

03-1583df.pdf
Path: Wisconsin >> HISTORY >> 424 Fall, 2008
Description: ...
Date Added: 2009-02-03 14:35:07

sprt1.pdf
Path: Minnesota >> PH >> 8482 Fall, 2008
Description: ...
Date Added: 2009-02-17 21:06:58

Homework 4
Path: Texas >> MATH >> 408L Spring, 2008
Description: yp968 Homework 4 Radin (58415) This print-out should have 20 questions. Multiple-choice questions may continue on the next column or page find all choices before answering. 001 10.0 points 5. V = 6. V = 7 cu. units 15 5 cu. units 12 003 10.0 poi...
Date Added: 2008-04-29 02:02:06

3335.pdf
Path: U. Houston >> MATH >> 3335 Fall, 2008
Description: STUDENT SYLLABUS FOR MATH 3335, VECTOR ANALYSIS PREREQUISITES: MATH 2433 or the approval of the chair RECOMMENDED TEXT: Introduction to Vector Analysis, 7th Ed., by H. F. Davis and A. D. Snider, Wm. C. Brown, Publ., 1998. Another good text is Vector ...
Date Added: 2009-02-03 13:46:08

Reimbursementforms5.doc
Path: Berkeley >> MUSIC >> 144 Fall, 2008
Description: PAYINGFOREIGNVISITORS FORRECEIPTEDTRAVELAND/ORLOCALEXPENSES REIMBURSEMENT FORMSANDMOREFORMS Foreignvisitorswillneedto: Providecopiesofthefollowing: Passport Visa(ifnotonvisawaiver)1 I94card(IssuedwhenenteringtheUS) ForAirfareReimbursement: C...
Date Added: 2009-01-10 01:23:20

Reimbursementforms5.doc
Path: Berkeley >> MUSIC >> 145 Fall, 2008
Description: PAYINGFOREIGNVISITORS FORRECEIPTEDTRAVELAND/ORLOCALEXPENSES REIMBURSEMENT FORMSANDMOREFORMS Foreignvisitorswillneedto: Providecopiesofthefollowing: Passport Visa(ifnotonvisawaiver)1 I94card(IssuedwhenenteringtheUS) ForAirfareReimbursement: C...
Date Added: 2009-01-12 05:37:11

Mifflintown.pdf
Path: Bucknell >> X >> 17728 Fall, 2008
Description: Mifflintown Formation BRETT, C.E., 1983, Sedimentology, facies and depositional environments of the Rochester Shale (Silurian; Wenlockian) in western New York and Ontario: Journal of Sedimentary Petrology, v. 53. BRETT, C.E., BAARLI, B.G., CHOWNS, T....
Date Added: 2009-02-04 14:33:27

DMA10_lectureNotes_2.pdf
Path: UCLA >> JAPAN >> 10 Summer, 2008
Description: Desma 10 Design Culture an Introduction 2007 NOTES Meeting 2 (Oct.5,2007) Design Culture - More Basics Design and Art The Etymology of the Word Design The Origins of Design Culture These notes are NOT meant to replace the experience of attending the...
Date Added: 2009-02-02 17:16:51

parh00-asilo-exact-round.pdf
Path: UCSB >> ECE >> 199 Fall, 2008
Description: On Producing Exactly Rounded Results in Digit-Serial on-Line Arithmetic Behrooz Parhami Department of Electrical and Computer Engineering University of California Santa Barbara, CA 93106-9560, USA E-mail: parhami@ece.ucsb.edu Abstract The input and...
Date Added: 2009-01-10 02:13:53

parh00-asilo-exact-round.pdf
Path: UCSB >> ECE >> 254b Fall, 2008
Description: On Producing Exactly Rounded Results in Digit-Serial on-Line Arithmetic Behrooz Parhami Department of Electrical and Computer Engineering University of California Santa Barbara, CA 93106-9560, USA E-mail: parhami@ece.ucsb.edu Abstract The input and...
Date Added: 2009-01-10 02:05:05

parh00-asilo-exact-round.pdf
Path: UCSB >> ECE >> 252b Spring, 2008
Description: On Producing Exactly Rounded Results in Digit-Serial on-Line Arithmetic Behrooz Parhami Department of Electrical and Computer Engineering University of California Santa Barbara, CA 93106-9560, USA E-mail: parhami@ece.ucsb.edu Abstract The input and...
Date Added: 2009-01-10 02:14:29

parh00-asilo-exact-round.pdf
Path: UCSB >> ECE >> 1 Spring, 2008
Description: On Producing Exactly Rounded Results in Digit-Serial on-Line Arithmetic Behrooz Parhami Department of Electrical and Computer Engineering University of California Santa Barbara, CA 93106-9560, USA E-mail: parhami@ece.ucsb.edu Abstract The input and...
Date Added: 2009-01-10 02:10:17

parh00-asilo-exact-round.pdf
Path: UCSB >> ME >> 252a Winter, 2008
Description: On Producing Exactly Rounded Results in Digit-Serial on-Line Arithmetic Behrooz Parhami Department of Electrical and Computer Engineering University of California Santa Barbara, CA 93106-9560, USA E-mail: parhami@ece.ucsb.edu Abstract The input and...
Date Added: 2009-01-11 21:51:09

parh00-asilo-exact-round.pdf
Path: UCSB >> ECE >> 257a Fall, 2008
Description: On Producing Exactly Rounded Results in Digit-Serial on-Line Arithmetic Behrooz Parhami Department of Electrical and Computer Engineering University of California Santa Barbara, CA 93106-9560, USA E-mail: parhami@ece.ucsb.edu Abstract The input and...
Date Added: 2009-01-10 02:10:44

parh00-asilo-exact-round.pdf
Path: UCSB >> HIST >> 254b Fall, 2008
Description: On Producing Exactly Rounded Results in Digit-Serial on-Line Arithmetic Behrooz Parhami Department of Electrical and Computer Engineering University of California Santa Barbara, CA 93106-9560, USA E-mail: parhami@ece.ucsb.edu Abstract The input and...
Date Added: 2009-01-10 02:05:04

parh00-asilo-exact-round.pdf
Path: UCSB >> ECE >> 154 Fall, 2008
Description: On Producing Exactly Rounded Results in Digit-Serial on-Line Arithmetic Behrooz Parhami Department of Electrical and Computer Engineering University of California Santa Barbara, CA 93106-9560, USA E-mail: parhami@ece.ucsb.edu Abstract The input and...
Date Added: 2009-01-10 02:13:23

parh00-asilo-exact-round.pdf
Path: UCSB >> ECE >> 250 Spring, 2008
Description: On Producing Exactly Rounded Results in Digit-Serial on-Line Arithmetic Behrooz Parhami Department of Electrical and Computer Engineering University of California Santa Barbara, CA 93106-9560, USA E-mail: parhami@ece.ucsb.edu Abstract The input and...
Date Added: 2009-01-10 02:05:04

parh00-asilo-exact-round.pdf
Path: UCSB >> ECE >> 254c Fall, 2008
Description: On Producing Exactly Rounded Results in Digit-Serial on-Line Arithmetic Behrooz Parhami Department of Electrical and Computer Engineering University of California Santa Barbara, CA 93106-9560, USA E-mail: parhami@ece.ucsb.edu Abstract The input and...
Date Added: 2009-01-10 02:13:23

parh00-asilo-exact-round.pdf
Path: UCSB >> ECE >> 254a Winter, 2008
Description: On Producing Exactly Rounded Results in Digit-Serial on-Line Arithmetic Behrooz Parhami Department of Electrical and Computer Engineering University of California Santa Barbara, CA 93106-9560, USA E-mail: parhami@ece.ucsb.edu Abstract The input and...
Date Added: 2009-01-10 02:05:04

pset204.pdf
Path: Berkeley >> E >> 101 Fall, 2008
Description: Econ 101A Problem Set 2 Due in class on Tu September 28. No late Problem Sets accepted, sorry! This Problem set tests the knowledge that you accumulated in lectures 4 to 7. It is focused on preferences, utility functions, and utility maximization. G...
Date Added: 2009-02-17 17:40:09

25-xml-4up.pdf
Path: San Diego State >> LING >> 571 Fall, 2008
Description: Homework Open Language Archive Community Midterm Read Standards like TEI are too heavy for many uses Standardization procedure may be inappropriate for special use, first of a kind, or one of a kind documents Metadata standardization is...
Date Added: 2009-01-09 06:59:48

25-xml-4up.pdf
Path: San Diego State >> LING >> 681 Fall, 2008
Description: Homework Open Language Archive Community Midterm Read Standards like TEI are too heavy for many uses Standardization procedure may be inappropriate for special use, first of a kind, or one of a kind documents Metadata standardization is...
Date Added: 2009-01-11 18:07:39

ee357_hw9_sol
Path: USC >> EE >> 357 Spring, 2007
Description: EE 357 Homework 9 Spring 07 Redekopp Name: _Solutions_ Note: Attach all work to receive full credit 1. Perform the following unsigned multiplication using the Add & Shift method. Show each add and shift step in a table similar to the style used in c...
Date Added: 2008-11-26 13:33:30

1.49 Correction
Path: Cal Poly >> PHYS >> 141 Spring, 2008
Description: 1.49 Correction Student first drew motion diagram by copying out of book (as intended), then drew a woman bouncing a tennis ball in the same motion as the motion diagram shows. Picture is artistic and not rushed. Then student cleverly thought up a st...
Date Added: 2008-04-10 15:17:29

China2.pdf
Path: Hawaii >> AGING >> 2 Fall, 2008
Description: Active Aging Programs: A New Focus for YWCA/YMCA in China Wang Chengsi National Committee of YMCAs of China National Committee of YWCAs of China Basics of the YMCA and YWCA in China Non-profit social service organizations (NGOs) with a history of o...
Date Added: 2009-02-17 19:21:00

Accelerating_Ray_Tracing.color.pdf
Path: Johns Hopkins >> CS >> 99 Fall, 2008
Description: Accelerating Ray Tracing Johns Hopkins Department of Computer Science Course 600.456: Rendering Techniques, Professor: Jonathan Cohen Ray Tracing Acceleration Techniques Faster Intersections Faster Ray-Object Intersections Object bounding volumes ...
Date Added: 2009-02-11 16:54:07

CAS 202(1)
Path: Penn State >> CAS >> 202 Spring, 2007
Description: Caitlin Lovey CAS 202 Website Assignment http:/eserver.org Orange Journal: A Study of Theories of Style in Technical Communication. By Lily Sun This article talks about what technical theory is and how its communicators use it. Technical communicat...
Date Added: 2008-04-04 12:49:46

LOYALTY
Path: Michigan State University >> ISS >> 215 Spring, 2008
Description: 1 Due to the fact that humans are social beings with social groups, certain loyalties must be valued more than others eventually because otherwise, there would be too many competing allegiances. Common loyalties include God, family, country, and sel...
Date Added: 2008-03-19 16:30:29

twohalftemplate11x17.ppt
Path: Rice >> OWLNET >> 11 Fall, 2008
Description: v v ...
Date Added: 2009-02-06 20:13:39

hw1.pdf
Path: University of Iowa >> 002 >> 196 Summer, 2008
Description: 22c:196:002 Logic in Computer Science Spring 2007 Homework 1 Due: Monday, Feb 5, at 7pm This is a written assignment. Typed solutions should be submitted in plain ASCII, Word, postscript, or PDF format. Handwritten solutions are allowed but must be s...
Date Added: 2009-02-02 18:52:53

StorrPSC 3183-001 Fall 2008.pdf
Path: Prairie View A & M >> PHYS >> 3183 Spring, 2008
Description: Modern Physics PSC 3183-001 Fall 2008 Instructor: Text: Office: Contact: Classroom: Course Website: Homework Website: Dr. Kevin Storr Modern Physics, 7th ed., Serway, Moses and Moyer 330H New Science Building (936) 261-3132 kastorr@pvamu.edu New Clas...
Date Added: 2009-02-02 15:42:09

L06S08_Matter_Waves%2002-04-08
Path: Berkeley >> CHEM >> 1A Spring, 2008
Description: Chem 1A L6:\"Matter Waves\" Lab 3: Goal: Determine how effective a sunscreen is at absorbing radiation by measuring the extinction coefficient of the active ingredients. Tools and Skills: : UV-Vis absorption UVspectroscopy, Beer\'s Law, and dilution ca...
Date Added: 2008-04-03 21:04:47

14D_w09_activities.pdf
Path: UCLA >> CHEM >> 14d Fall, 2008
Description: Weekly Course Activities Schedule: Chemistry 14D BB = Brian Blank Monday 8 AM DC = Daniel Chan Tuesday Discussion sec A (BB) Botany 133 Chem 14C Lecture Dr H not available Office hour (BL) Young 3077F Winter 2009 Revised 01/07/09 Print your own co...
Date Added: 2009-02-02 17:18:53

New Chapter 1 Class Notes
Path: N.C. State >> BUS >> 320 Fall, 2007
Description: Chapter 1: Overview of Financial Management I. Three main forms of Business Organization A. Sole proprietorship 1. Unincorporated business owned by one individual. 2. Advantages: easily and inexpensively formed, subject to few government regulations,...
Date Added: 2008-03-24 13:54:57

notes4.pdf
Path: Concordia Chicago >> CMSC >> 31100 Fall, 2009
Description: CMSC 31100: Reduce, Reuse, and Recycle: approaches to boosting memory system performance. Lecturer: Anne Rogers 1. Reduce: MST, VF 2. Reuse data: register allocation, cashes/Virtual Memory 3. Recycle space: compacting garbage collection Minimum Span...
Date Added: 2009-04-15 21:55:20

Chapter09
Path: Cal Poly >> EE >> 307 Spring, 2008
Description: CHAPTER 9 9.1 Since VREF = -1.25V , and v I = -1.6V , Q1 is off and Q2 is conducting. vC1 = 0 V and vC 2 = - F I EE RC -I EE RC = -(2mA)(350) = -0.700 V 9.2 V IC 2 0.995 F I EE = exp BE VBE = 0.025ln = 0.132V IC1 0.005 F I EE VT (a) v I = VR...
Date Added: 2008-03-05 20:50:56

sol3.pdf
Path: Wisconsin >> STAT >> 371 Fall, 2002
Description: Solution to Exam 3 Statistics 371, Fall 2004 Suppose that in a population of American adult coee drinkers, the change in measured heart rate ten minutes after drinking 6 ounces of coee is normally distributed with a mean increase of 7.3 beats per m...
Date Added: 2009-02-17 15:57:29

sol3.pdf
Path: SJR CC >> STAT >> 371 Fall, 2002
Description: Solution to Exam 3 Statistics 371, Fall 2004 Suppose that in a population of American adult coee drinkers, the change in measured heart rate ten minutes after drinking 6 ounces of coee is normally distributed with a mean increase of 7.3 beats per m...
Date Added: 2009-02-17 15:57:29

practmdtrm1.05.pdf
Path: Concordia Chicago >> CSPP >> 50102 Fall, 2009
Description: CSPP 50102 Midterm 1: Practice Test Note: This practice test is longer than midterm 1. 1. Let p, q, and r be propositions. Prove or disprove: (p q) (q r) p r 2. Determine the truth value of each of the following propositions. The domain (univers...
Date Added: 2009-04-15 21:55:40

Richard Conti.doc
Path: San Diego State >> ART >> 344 Fall, 2008
Description: Richard Conti Art 596 N. Renaissance Final Essay During the 14th through the 16th centuries art was a very intermingled mix of religious images with secular themes interpolated into them, although there were works that were completely secular, most ...
Date Added: 2009-02-02 16:02:39

Val IT.pdf
Path: University of North Carolina, Wilmington >> MIT >> 516 Fall, 2008
Description: ENTERPRISE VALUE: GOVERNANCE OF IT INVESTMENTS The Val IT Framework 2.0 BASED ON C O B I T THE VAL IT FRAMEWORK 2.0 IT Governance Institute The IT Governance Institute (ITGITM) (www.itgi.org) is a non-profit, independent research entity that prov...
Date Added: 2009-02-02 19:58:51

Soft Machine
Path: Penn State >> ENGL >> 191 Fall, 2007
Description: Daniel Pearson Ms. Shackelford Journal Entry Meaning Hidden in The Soft Machine Easily one of the most vulgar popular literary works, The Soft Machine by William S. Burroughs brings considerable controversy to the science fiction community. Some rega...
Date Added: 2008-03-18 20:42:55

BMB-Hollingsworth-2007.pdf
Path: Michigan State University >> BMB >> 804 Fall, 2008
Description: ...
Date Added: 2009-02-02 14:50:50

stability.pdf
Path: SUNY Albany >> AECO >> 601 Fall, 2009
Description: Notes on dynamic stability of steady-states of Dierence equation systems In general we can have F (xt ; xt 1 ) = 0 where x is a k-dimensional vector, 0 is the k-dimensional nul-vector and F : Rk Rk ! Rk . A Steady state is an x such that F (x ; x ) =...
Date Added: 2009-04-15 21:48:33

stability.pdf
Path: SUNY Albany >> AECO >> 755146 Fall, 2009
Description: Notes on dynamic stability of steady-states of Dierence equation systems In general we can have F (xt ; xt 1 ) = 0 where x is a k-dimensional vector, 0 is the k-dimensional nul-vector and F : Rk Rk ! Rk . A Steady state is an x such that F (x ; x ) =...
Date Added: 2009-04-15 21:48:34

DroughtEconomics08_07v2.pdf
Path: Purdue >> AGRY >> 399v Fall, 2008
Description: CopingwithDrought: EvaluatingtheEconomicsofLivestockProducersOptions GeoffBenson,PhD ExtensionEconomist Dept.ofAgriculturalandResourceEconomics NorthCarolinaStateUniversity Introduction Copingwiththeconsequencesofdroughtiscostlyforlivestockproducers...
Date Added: 2009-01-09 06:33:25

DroughtEconomics08_07v2.pdf
Path: Purdue >> AGRY >> 306 Fall, 2008
Description: CopingwithDrought: EvaluatingtheEconomicsofLivestockProducersOptions GeoffBenson,PhD ExtensionEconomist Dept.ofAgriculturalandResourceEconomics NorthCarolinaStateUniversity Introduction Copingwiththeconsequencesofdroughtiscostlyforlivestockproducers...
Date Added: 2009-01-11 17:51:17

DroughtEconomics08_07v2.pdf
Path: Purdue >> AGRY >> 598d Fall, 2008
Description: CopingwithDrought: EvaluatingtheEconomicsofLivestockProducersOptions GeoffBenson,PhD ExtensionEconomist Dept.ofAgriculturalandResourceEconomics NorthCarolinaStateUniversity Introduction Copingwiththeconsequencesofdroughtiscostlyforlivestockproducers...
Date Added: 2009-01-09 06:33:26

DroughtEconomics08_07v2.pdf
Path: Purdue >> AGRY >> 365t Spring, 2008
Description: CopingwithDrought: EvaluatingtheEconomicsofLivestockProducersOptions GeoffBenson,PhD ExtensionEconomist Dept.ofAgriculturalandResourceEconomics NorthCarolinaStateUniversity Introduction Copingwiththeconsequencesofdroughtiscostlyforlivestockproducers...
Date Added: 2009-01-11 17:51:17

DroughtEconomics08_07v2.pdf
Path: Purdue >> BTNY >> 204 Fall, 2008
Description: CopingwithDrought: EvaluatingtheEconomicsofLivestockProducersOptions GeoffBenson,PhD ExtensionEconomist Dept.ofAgriculturalandResourceEconomics NorthCarolinaStateUniversity Introduction Copingwiththeconsequencesofdroughtiscostlyforlivestockproducers...
Date Added: 2009-01-09 06:33:26

DroughtEconomics08_07v2.pdf
Path: Purdue >> NRES >> 497 Fall, 2008
Description: CopingwithDrought: EvaluatingtheEconomicsofLivestockProducersOptions GeoffBenson,PhD ExtensionEconomist Dept.ofAgriculturalandResourceEconomics NorthCarolinaStateUniversity Introduction Copingwiththeconsequencesofdroughtiscostlyforlivestockproducers...
Date Added: 2009-01-11 17:51:17

DroughtEconomics08_07v2.pdf
Path: Purdue >> AGRY >> 270 Spring, 2008
Description: CopingwithDrought: EvaluatingtheEconomicsofLivestockProducersOptions GeoffBenson,PhD ExtensionEconomist Dept.ofAgriculturalandResourceEconomics NorthCarolinaStateUniversity Introduction Copingwiththeconsequencesofdroughtiscostlyforlivestockproducers...
Date Added: 2009-01-11 17:51:17

DroughtEconomics08_07v2.pdf
Path: Purdue >> AGRY >> 210y Fall, 2008
Description: CopingwithDrought: EvaluatingtheEconomicsofLivestockProducersOptions GeoffBenson,PhD ExtensionEconomist Dept.ofAgriculturalandResourceEconomics NorthCarolinaStateUniversity Introduction Copingwiththeconsequencesofdroughtiscostlyforlivestockproducers...
Date Added: 2009-01-09 06:33:25

DroughtEconomics08_07v2.pdf
Path: Purdue >> AGRY >> 285 Fall, 2008
Description: CopingwithDrought: EvaluatingtheEconomicsofLivestockProducersOptions GeoffBenson,PhD ExtensionEconomist Dept.ofAgriculturalandResourceEconomics NorthCarolinaStateUniversity Introduction Copingwiththeconsequencesofdroughtiscostlyforlivestockproducers...
Date Added: 2009-01-11 17:51:17

DroughtEconomics08_07v2.pdf
Path: Purdue >> AGRY >> 355l Fall, 2008
Description: CopingwithDrought: EvaluatingtheEconomicsofLivestockProducersOptions GeoffBenson,PhD ExtensionEconomist Dept.ofAgriculturalandResourceEconomics NorthCarolinaStateUniversity Introduction Copingwiththeconsequencesofdroughtiscostlyforlivestockproducers...
Date Added: 2009-01-09 06:33:25

DroughtEconomics08_07v2.pdf
Path: Purdue >> AGRY >> 305 Fall, 2008
Description: CopingwithDrought: EvaluatingtheEconomicsofLivestockProducersOptions GeoffBenson,PhD ExtensionEconomist Dept.ofAgriculturalandResourceEconomics NorthCarolinaStateUniversity Introduction Copingwiththeconsequencesofdroughtiscostlyforlivestockproducers...
Date Added: 2009-01-11 17:51:17

Week1_Wed.ppt
Path: Mich Tech >> UN >> 2002 Fall, 2008
Description: Exploring Cultural Identity Huntington Senocak A Fond Kiss Huntington Look at the copyright date. Did Huntington correctly predict events? What has already come to pass, and what might still happen? What is useful to take from the article? De...
Date Added: 2009-01-10 17:14:46

EE 302 - Unit E - BLF339
Path: Texas >> EE >> 302 Fall, 2007
Description: Brian Fontenot EE 302 Telang 16190 10/22/07 Unit E: Technical Seminar The tile of the seminar The name of the speaker and his/her affiliation Your brief summary of the of the seminar A summary of what you felt you learned about the topic My eyes...
Date Added: 2008-03-22 12:50:17

msis 5633.doc
Path: Oklahoma State >> MSIS >> 5633 Fall, 2008
Description: HOMEWORK LOG MSIS 5633 Decision Report & Expert Systems Dr. Meg Kletke Date Logged In 9/28/07 Time Logged In 4:29 pm Delivery Mode Rec. Hand In Logged By KR Students Name Nabin Ghimere Item Mid-term Exam Date Logged Out Time Logged Out Delivery Mode ...
Date Added: 2009-02-03 13:19:02

matla reference manual
Path: Purdue >> ENGR, STAT >> 320, 262, Spring, 2008
Description: Probability and Stochastic Processes A Friendly Introduction for Electrical and Computer Engineers SECOND EDITION MATLAB Function Reference Roy D. Yates and David J. Goodman May 22, 2004 This document is a supplemental reference for M ATLAB functio...
Date Added: 2008-04-09 18:18:49

pulc_v_46_n_3.pdf
Path: Princeton >> LIBWEB5 >> 5 Fall, 2008
Description: ...
Date Added: 2009-02-17 23:00:29

stodis.pdf
Path: Cornell >> VIVO >> 23222 Fall, 2008
Description: Using Randomized Techniques to Build Scalable Intrusion-Tolerant Overlay Networks Robbert van Renesse Department of Computer Science Cornell University, Ithaca, NY 14853 rvr@cs.cornell.edu Abstract Overlay networks provide important routing function...
Date Added: 2009-02-17 21:58:29

license.txt
Path: Hawaii >> SCHOLARSPA >> 10125 Fall, 1989
Description: License granted by sethib@hawaii.edu (sethib@hawaii.edu) on 2008-09-23T03:19:01Z (GMT): NON-EXCLUSIVE DISTRIBUTION LICENSE By signing and submitting this license, you (the author(s) or copyright owner) grants to University of Hawaii at Manoa (UHM) th...
Date Added: 2009-02-17 19:47:44

license.txt
Path: Hawaii >> SCHOLARSPA >> 2606 Fall, 2008
Description: License granted by sethib@hawaii.edu (sethib@hawaii.edu) on 2008-09-23T03:19:01Z (GMT): NON-EXCLUSIVE DISTRIBUTION LICENSE By signing and submitting this license, you (the author(s) or copyright owner) grants to University of Hawaii at Manoa (UHM) th...
Date Added: 2009-02-17 19:47:45

Assignment%2006_table
Path: Colorado State >> BMS >> 302 Spring, 2008
Description: BMS 302 Honors Experiment #6 Spring 2008 Name_ Group # _ th Vander text (11 ): pages 208-213, 227, 228 (Review Experiment #4) Case Study A forty-two year old patient previously diagnosed with myopia and astigmatism is seen by his optometrist compla...
Date Added: 2008-04-17 17:06:07

pastmtgs.pdf
Path: Oregon State >> MB >> 541 Fall, 2008
Description: Western Forest Insect Work Conference: Past Meeting Locations and Dates mtg # 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 4/28/2008 Year 1949 1950 1951 1952 1953 1954 1955 1956 1957 1958 1959 1960 1961 1962...
Date Added: 2009-01-11 19:10:28

AHRM 2676 - EXAM 1 Review
Path: Virginia Tech >> AHRM >> 2676 Spring, 2008
Description: MULTIPLE CHOICE 1. goals of ownership 2. Rent Level and Property Value: Using income capitalization and a cap rate, to find what every dollar of rent reduction reduces property value to Example: 8% cap rate $ 1.00 * 12 months = $ 12.00 $12.00 / .08 c...
Date Added: 2008-04-02 07:33:50

min021802.pdf
Path: Caribbean >> MIN >> 021802 Fall, 2008
Description: 1793 DOCUMENTS OF THE GENERAL FACULTY Following are the minutes of the regular Faculty Council meeting of February 18, 2002. John R. Durbin, Secretary The General Faculty MINUTES OF THE REGULAR FACULTY COUNCIL MEETING OF February 18, 2002 The fifth...
Date Added: 2009-02-17 18:13:57

min021802.pdf
Path: Texas >> MIN >> 021802 Fall, 2008
Description: 1793 DOCUMENTS OF THE GENERAL FACULTY Following are the minutes of the regular Faculty Council meeting of February 18, 2002. John R. Durbin, Secretary The General Faculty MINUTES OF THE REGULAR FACULTY COUNCIL MEETING OF February 18, 2002 The fifth...
Date Added: 2009-02-17 18:13:57

lecture5_1
Path: Virginia Tech >> MATH >> 1205 Spring, 2008
Description: 2.4 One-sided Limits and Limits at Infinity Finite Limits as x Consider f (x) = 1 x as x What if x becomes increasingly large? What if x is negative and its magnitude becomes increasingly large? 1 becomes increasingly x We say is a limit of 1 x...
Date Added: 2008-03-31 12:01:59

Chem106Calender_sp08_Barker_revised5.doc
Path: Alaska Anch >> PS >> A590 Spring, 2008
Description: Course Calendar* for CHEM 106 Spring 2008 Date Chapters in Chemistry: Structure Farrell) Dr. Be...
Date Added: 2009-01-10 01:14:51

BandandLisolvNotes.doc
Path: Berkeley >> MAT SCI >> 130a Fall, 2008
Description: Notes on BAND and LISOLV J. W. Evans and P. Kar Dept. of Materials Science and Engineering University of California, Berkeley, CA 94720 evans@socrates.berkeley.edu These are notes on software frequently used in the past for numerical solution of part...
Date Added: 2009-01-09 19:19:57

BandandLisolvNotes.doc
Path: Berkeley >> MAT SCI >> C113 Fall, 2008
Description: Notes on BAND and LISOLV J. W. Evans and P. Kar Dept. of Materials Science and Engineering University of California, Berkeley, CA 94720 evans@socrates.berkeley.edu These are notes on software frequently used in the past for numerical solution of part...
Date Added: 2009-01-09 19:20:18

MS109-02.pdf
Path: Alaska Anch >> MS >> 109 Fall, 2008
Description: ...
Date Added: 2009-02-18 14:28:19

LegacyNovember.pdf
Path: Minnesota >> THE >> 40 Fall, 2008
Description: THE LEGACY MORRILL HALL 40th ANNIVERSARY ORGANIZING & PLANNING COMMITTEE NEWSLETTER NOVEMBER 2008 Inside this issue: REMEMBERING WHEN WITH PROFESSOR PENN My recollections of the actual events associated with the Morrill Hall takeover have graduall...
Date Added: 2009-02-17 20:34:28

Exam_2__REVIEW.doc
Path: Eckerd >> ES >> 211 Fall, 2009
Description: How to Prepare for Exam 2 Oceanography and Meteorology Bring a number two pencil with a good eraser and a calculator. SPC students also need to bring a green scantron (#882E). In addition to class notes, you may find it useful to get a copy of my pow...
Date Added: 2009-04-15 20:26:25

discuss_consult.txt
Path: Harvard >> HEAD >> 2004 Fall, 2009
Description: Giridhar (New York College)> Why can\'t we have a website like \"Ask the Astrostatistician?\" A panel could visit it on a regular basis and answer questions. [Even once a month answers will be better]. David van Dyk (UC Irvine)> Not practical, because ...
Date Added: 2009-04-16 00:17:06

Syllabus 393 Spring 05.doc
Path: Purdue >> ENGL >> 505b Spring, 2008
Description: English 393 Technical Writing Spring 2005 Section 1102: TuTh 9:30 - 10:45 Section 1201: TuTh 11:00 - 12:15 Section 1302: TuTh 12:30 - 1:45 On Tuesdays, class meets in Susq. 2112 Instructor: Allen Brizee Office: 3119 Susquehanna Mailbox: 3119 Susqueha...
Date Added: 2009-01-09 20:45:26

Syllabus 393 Spring 05.doc
Path: Purdue >> ENGL >> 505m Fall, 2008
Description: English 393 Technical Writing Spring 2005 Section 1102: TuTh 9:30 - 10:45 Section 1201: TuTh 11:00 - 12:15 Section 1302: TuTh 12:30 - 1:45 On Tuesdays, class meets in Susq. 2112 Instructor: Allen Brizee Office: 3119 Susquehanna Mailbox: 3119 Susqueha...
Date Added: 2009-01-09 20:45:26

Syllabus 393 Spring 05.doc
Path: Purdue >> ENGL >> 680a Fall, 2008
Description: English 393 Technical Writing Spring 2005 Section 1102: TuTh 9:30 - 10:45 Section 1201: TuTh 11:00 - 12:15 Section 1302: TuTh 12:30 - 1:45 On Tuesdays, class meets in Susq. 2112 Instructor: Allen Brizee Office: 3119 Susquehanna Mailbox: 3119 Susqueha...
Date Added: 2009-01-09 20:45:26

Syllabus 393 Spring 05.doc
Path: Purdue >> ENGL >> 680t Fall, 2008
Description: English 393 Technical Writing Spring 2005 Section 1102: TuTh 9:30 - 10:45 Section 1201: TuTh 11:00 - 12:15 Section 1302: TuTh 12:30 - 1:45 On Tuesdays, class meets in Susq. 2112 Instructor: Allen Brizee Office: 3119 Susquehanna Mailbox: 3119 Susqueha...
Date Added: 2009-01-09 20:45:27

Syllabus 393 Spring 05.doc
Path: Purdue >> IT >> 393 Fall, 2008
Description: English 393 Technical Writing Spring 2005 Section 1102: TuTh 9:30 - 10:45 Section 1201: TuTh 11:00 - 12:15 Section 1302: TuTh 12:30 - 1:45 On Tuesdays, class meets in Susq. 2112 Instructor: Allen Brizee Office: 3119 Susquehanna Mailbox: 3119 Susqueha...
Date Added: 2009-02-02 15:43:31

Mathcad - ME 330 Exam Solution Score.pdf
Path: Iowa State >> M E >> 330 Fall, 2008
Description: ME 330 Thermodynamics Exam 1 Fall 2005 gmc 100 points Solve Problems 1 & 2 using only conversions in Tables 1-1 (p.5), Appendix A (p. 287), or the following gravitational constants: g c = 9.806 kgm m kgf sec 2 = 1 kgm m N sec 2 = 32.17 lbm f...
Date Added: 2009-02-02 14:36:25

166.pdf
Path: Minnesota >> IMA >> 85 Fall, 2008
Description: ...
Date Added: 2009-02-17 20:53:34

Final W 08 A
Path: UCLA >> CHEM >> 20B Winter, 2008
Description: ...
Date Added: 2009-01-27 22:13:04

Boxplots.pdf
Path: GA Southern >> STAT >> 2231 Fall, 2008
Description: Box Plots on the TI-83 Enter the data in a list in the Stat Editor. Press 2nd, Quit to exit the editor. Press 2nd, StatPlot. Select a plot to define. Make sure that no competing plots are turned on. I am defining Plot1 to be a boxplot with any potent...
Date Added: 2009-02-02 21:32:42

CP9statisticalqualitycontrol.doc
Path: UCF >> ISM >> 3530 Fall, 2008
Description: ISM 3530 Spring 2009 CP9 Statistical Quality Control Concepts: Page 1 of 21 TWO FOCUSES FOR STATISTICAL QUALITY CONTROL Assessing The Quality Of An Ongoing Process This facet is called statistical process control, and relies on the use of process...
Date Added: 2009-01-10 18:09:27

MEM 417_Lab_II_Polymer Micromachining
Path: Drexel >> MEM >> 417 Fall, 2008
Description: Fall 2008 MEM 417 Polymer Micromachining Lakir Patel Drexel University Fall 2008 The objective of Lab # 2 (Polymer Micromachining was to familiarize ourselves with the process of micromachining and the implementation of its use as well as applicat...
Date Added: 2008-11-30 16:24:20

controls hw 1
Path: Johns Hopkins >> BME >> 580.221 Spring, 2008
Description: Homework 1 Biomedical Signal, Systems and Control (BME 580.222) Instructor: Ren Vidal, E-mail: rvidal@cis.jhu.edu e TA: Donavan Cheng, E-mail: donavan.cheng@gmail.com TA: Ertan Cetingul, E-mail: ertan@cis.jhu.edu Due on Monday March 31st, 2008, 1.30P...
Date Added: 2008-04-15 00:15:40

ThompsonBldgHandout.pdf
Path: Lynchburg College >> X >> 13051 Fall, 2008
Description: Thompson Education Building Expansion Bricks and Mortar for Teachers and Nurses: Meeting Critical Community Needs Architects rendering of the expanded Thomson Education Building The Need Central Virginia relies on Lynchburg Colleges School of Educa...
Date Added: 2009-02-06 20:56:53

ThompsonBldgHandout.pdf
Path: Lynchburg College >> X >> 3143 Fall, 2008
Description: Thompson Education Building Expansion Bricks and Mortar for Teachers and Nurses: Meeting Critical Community Needs Architects rendering of the expanded Thomson Education Building The Need Central Virginia relies on Lynchburg Colleges School of Educa...
Date Added: 2009-02-06 20:56:53

PL5.ppt
Path: UConn >> CSE >> 334 Spring, 2008
Description: CSE334 Continuing Continuations. Lecture 5 1 Overview How to. Build user-level threads Write your own backtracking procedure Lecture 5 2 Threads Reminder Continuation represents the future of the computation Threads Several (pseudo) con...
Date Added: 2009-01-10 02:41:59

s136.pdf
Path: YCP >> CHM >> 136 Spring, 2006
Description: CHM136: General Chemistry II York College of PA Instructor: Home Phone: Office: Office Phone: Dr. James B. Foresman 717-927-8437 Campbell Hall 213 717-815-1384 Semester: Email: Office Hours: Spring 2006 JForesma@YCP.EDU Tue 11-2, Fri 10-12 (also by a...
Date Added: 2009-02-04 14:37:18

4Mechanisms of evolution II.ppt
Path: UF >> BSC >> 2011 Fall, 2008
Description: Microevolution Change in the frequencies of genotypes in a population Change in the frequency of alleles in a population Change in the gene pool of a population What causes microevolution? Mutation Gene flow Genetic drift Nonrandom mating Natur...
Date Added: 2009-01-11 22:42:01

doc.pdf
Path: BYU >> HASH >> 0140 Fall, 2009
Description: NORMAN IAMM THE JEWISH CENTER \"GOOD G-D* Bereshit 723 October 27, 1962 The Torah\'s record of the creation of the world by G-d, no matter how you may interpret i t , is one of the major fundamentals of Jewish thought. Without the concept of creation...
Date Added: 2009-04-16 00:01:19

18_InstSolManual_PDF_Part5
Path: Pitt. State >> PHYS >> 114 Spring, 2008
Description: Electric Potential and Capacitance 18-5 18.20. Set Up: For a point charge, V 5 k . r2 5 3r1 . q q q 5 V/3 Solve: V1 5 k . V2 5 k 5 k r1 r2 3r1 q r 18.21. Set Up: From Chapter 17 we know that for a spherical shell the electric eld outside the shel...
Date Added: 2009-03-06 15:40:01

ThesisOutlineExample.doc
Path: MSCD >> PSY >> 4960 Fall, 2008
Description: Student Example of a Thesis Outline TOPIC/Working Title: The Effects of Breastfeeding on Childrens Cognitive, Social, and Emotional Development I. Abstract II. Introduction A. History of Breastfeeding practices B. American Academy of Pediatrics invol...
Date Added: 2009-01-12 03:36:32

10-12 Section Views.ppt
Path: Ohio State >> ENGINEER >> H191 Fall, 2008
Description: First-Year Engineering Program Section Views Goals Recognize various kinds of section views, make full and half section views. Improve visualization of interior features. 1 First-Year Engineering Program Agenda Why section views are needed Ty...
Date Added: 2009-01-10 03:22:52

10-12 Section Views.ppt
Path: Ohio State >> ENGINEER >> H193 Spring, 2008
Description: First-Year Engineering Program Section Views Goals Recognize various kinds of section views, make full and half section views. Improve visualization of interior features. 1 First-Year Engineering Program Agenda Why section views are needed Ty...
Date Added: 2009-01-10 03:22:52

355.pdf
Path: BYU >> DANCE >> 355 Fall, 2008
Description: BRIGHAM YOUNG UNIVERSITY COLLEGE OF HEALTH AND HUMAN PERFORMANCE Department of Dance Student Syllabus for Dance 355 Dance Production, Introduction Instructor: BYU Phone: E-mail: Office: Office Hours: and by appointment 1. Catalog Course Description:...
Date Added: 2009-02-02 13:40:22

CEE 682.pdf
Path: Cincinnati >> CEE >> 682 Spring, 2008
Description: CEE 682 Foundation Engineering II Catalog data: 20-CEE-682. Foundation Engineering II. 3 ug./gr. cr. Structural analysis and design of footings using ACI Code; pedestals, bearing plates, anchor bolts; square, rectangular, combined and mat foundations...
Date Added: 2009-02-02 17:45:29

120-Week2.pdf
Path: UCSD >> LISP >> 120 Fall, 2008
Description: Goal:Encourageyoutokeepupandtowrite. TA/IAsandIreadyourpostingseachweek.EachTA/IA readspostingsfromathirdoftheclass.Theyrotate eachweek. Postsareratedona4pointscale 4isreservedforespeciallyexcellentposts,rare 3forapostthatdemonstratesyouaree...
Date Added: 2009-02-02 17:23:26

120-Lecture3
Path: UCSD >> COGS >> 120 Spring, 2008
Description: Goal:Encourageyoutokeepupandtowrite. TA/IAsandIreadyourpostingseachweek.EachTA/IA readspostingsfromathirdoftheclass.Theyrotate eachweek. Postsareratedona4pointscale 4isreservedforespeciallyexcellentposts,rare 3forapostthatdemonstratesyouaree...
Date Added: 2008-10-22 12:35:05

kctcsvolumeI.pdf
Path: Madisonville Community College >> ENG >> 101 Fall, 2008
Description: TABLE OF CONTENTS KENTUCKY REVISED STATUTES KCTCS BOARD OF REGENTS BYLAWS KCTCS VISION / VALUES / GOALS KCTCS MISSION ORGANIZATION CHARTS KCTCS BOARD OF REGENTS POLICIES KENTUCKY REVISED STATUTES KENTUCKY REVISED STATUTES CHAPTER 164 STATE UNIVERSI...
Date Added: 2009-01-11 18:49:10

Water Planet Syllabus
Path: Rutgers >> GEOLOGY >> 206 Spring, 2008
Description: Course460:204:01;11:628:204:01Syllabus Dr.YairRosenthal Rm.211CIMCS,CookCollege 9326555ext.250 Date 22-Jan 24-Jan 29-Jan 31-Jan 5-Feb 7-Feb 12-Feb 14-Feb 19-Feb 21-Feb 26-Feb 28-Feb 4-Mar 6-Mar 11-Mar 13-Mar 18-Mar 20-Mar 25-Mar 27-Mar 1-Apr 3-Apr 8-...
Date Added: 2008-09-19 12:44:30

Some_sols_Homework5_typeset
Path: Cornell >> MATH >> 4130 Fall, 2007
Description: 1 Solution to Problem 4.1.5.15. By uniform continuity, we have that for every > 0, there exists > 0 such that a < x < y < a + = |f (x) - f (y)| < . Choose n = 1/n, and let n be a corresponding . min(n , 1/n), and choose xn = a + n /2. Then We may ...
Date Added: 2008-02-23 11:40:46

HW6.pdf
Path: UCSD >> PHYS >> 140a Fall, 2008
Description: PHYSICS 140A : STATISTICAL PHYSICS HW ASSIGNMENT #6 (1) Consider a monatomic ideal gas, represented within the grand canonical ensemble. Show that the probability of nding the system to have N atoms is given by the Poisson distribution, 1 N PN = e N...
Date Added: 2009-01-10 01:56:47

ch1
Path: Harvard >> MATH >> 21B Summer, 2008
Description: ISM: Linear Algebra Section 1.1 Chapter 1 1.1 1. x + 2y x + 2y = 1 -y 2x + 3y = 1 -2 1st equation x + 2y = 1 -2 2nd equation x y=1 y 2. 4x + 3y 7x + 5y 3 x + 4y 1 -4y 3 x + 4y = 2 4 =3 7x + 5y =1 = -1 (-1) = -1 , so that (x, y) = (-1, 1). =...
Date Added: 2008-09-16 13:22:09

ch1
Path: UCLA >> MATH >> 262186201 Spring, 2006
Description: ISM: Linear Algebra Section 1.1 Chapter 1 1.1 1. x + 2y x + 2y = 1 -y 2x + 3y = 1 -2 1st equation x + 2y = 1 -2 2nd equation x y=1 y 2. 4x + 3y 7x + 5y 3 x + 4y 1 -4y 3 x + 4y = 2 4 =3 7x + 5y =1 = -1 (-1) = -1 , so that (x, y) = (-1, 1). =...
Date Added: 2008-04-07 22:20:24

ch1
Path: Johns Hopkins >> MATH >> 110.201 Fall, 2007
Description: ISM: Linear Algebra Section 1.1 Chapter 1 1.1 1. x + 2y x + 2y = 1 -y 2x + 3y = 1 -2 1st equation x + 2y = 1 -2 2nd equation x y=1 y 2. 4x + 3y 7x + 5y 3 x + 4y 1 -4y 3 x + 4y = 2 4 =3 7x + 5y =1 = -1 (-1) = -1 , so that (x, y) = (-1, 1). =...
Date Added: 2008-04-15 00:53:20

ch1
Path: Cornell >> MATH >> 2940 Fall, 2007
Description: ISM: Linear Algebra Section 1.1 Chapter 1 1.1 1. x + 2y x + 2y = 1 -y 2x + 3y = 1 -2 1st equation x + 2y = 1 -2 2nd equation x y=1 y 2. 4x + 3y 7x + 5y 3 x + 4y 1 -4y 3 x + 4y = 2 4 =3 7x + 5y =1 = -1 (-1) = -1 , so that (x, y) = (-1, 1). =...
Date Added: 2007-09-23 21:45:01

ch1
Path: Colorado >> MATH >> 3130 Spring, 2008
Description: ISM: Linear Algebra Section 1.1 Chapter 1 1.1 1. x + 2y x + 2y = 1 -y 2x + 3y = 1 -2 1st equation x + 2y = 1 -2 2nd equation x y=1 y 2. 4x + 3y 7x + 5y 3 x + 4y 1 -4y 3 x + 4y = 2 4 =3 7x + 5y =1 = -1 (-1) = -1 , so that (x, y) = (-1, 1). =...
Date Added: 2008-05-01 13:50:00

ch1
Path: Cornell >> MATH >> 2940 Fall, 2007
Description: ISM: Linear Algebra Section 1.1 Chapter 1 1.1 1. x + 2y x + 2y = 1 -y 2x + 3y = 1 -2 1st equation x + 2y = 1 -2 2nd equation x y=1 y 2. 4x + 3y 7x + 5y 3 x + 4y 1 -4y 3 x + 4y = 2 4 =3 7x + 5y =1 = -1 (-1) = -1 , so that (x, y) = (-1, 1). =...
Date Added: 2007-12-13 11:26:40

1. Linear Equations
Path: Princeton >> MAT >> 202 Spring, 2008
Description: ISM: Linear Algebra Section 1.1 Chapter 1 1.1 1. x + 2y x + 2y = 1 -y 2x + 3y = 1 -2 1st equation x + 2y = 1 -2 2nd equation x y=1 y 2. 4x + 3y 7x + 5y 3 x + 4y 1 -4y 3 x + 4y = 2 4 =3 7x + 5y =1 = -1 (-1) = -1 , so that (x, y) = (-1, 1). =...
Date Added: 2008-07-09 06:18:22

ch1
Path: Cornell >> MATH >> 2940 Spring, 2008
Description: ISM: Linear Algebra Section 1.1 Chapter 1 1.1 1. x + 2y x + 2y = 1 -y 2x + 3y = 1 -2 1st equation x + 2y = 1 -2 2nd equation x y=1 y 2. 4x + 3y 7x + 5y 3 x + 4y 1 -4y 3 x + 4y = 2 4 =3 7x + 5y =1 = -1 (-1) = -1 , so that (x, y) = (-1, 1). =...
Date Added: 2008-03-27 16:20:25

Linear Algebra with Application Manual CH1
Path: Texas >> MATH >> 3330 Spring, 2008
Description: ISM: Linear Algebra Section 1.1 Chapter 1 1.1 1. x + 2y x + 2y = 1 -y 2x + 3y = 1 -2 1st equation x + 2y = 1 -2 2nd equation x y=1 y 2. 4x + 3y 7x + 5y 3 x + 4y 1 -4y 3 x + 4y = 2 4 =3 7x + 5y =1 = -1 (-1) = -1 , so that (x, y) = (-1, 1). =...
Date Added: 2008-08-20 20:23:04

ch1
Path: Michigan >> MATH >> 214 Spring, 2008
Description: ISM: Linear Algebra Section 1.1 Chapter 1 1.1 1. x + 2y x + 2y = 1 -y 2x + 3y = 1 -2 1st equation x + 2y = 1 -2 2nd equation x y=1 y 2. 4x + 3y 7x + 5y 3 x + 4y 1 -4y 3 x + 4y = 2 4 =3 7x + 5y =1 = -1 (-1) = -1 , so that (x, y) = (-1, 1). =...
Date Added: 2008-04-01 19:21:56

homework-1_key
Path: Yale >> ECON >> 115 Fall, 2007
Description: Key to homework-1 for Class G&G 160 1. Measuring the age of the earth In class, we have been talking in general about the history of measuring the age of the earth, now we are going to work out some examples. a) De Maillet and the Decline of the Sea:...
Date Added: 2008-04-08 22:15:03

USP 584- Draft Syllabus.pdf
Path: Portland >> USP >> 584 Fall, 2008
Description: Fall 2008 USP 584/684 NEGOTIATION IN THE PUBLIC SECTOR URB 270 - Mondays, 5:30-9:10 p.m. Professor Connie Ozawa Urban Center 370R; x 5-5126; ozawac@pdx.edu Office Hours: Tuesdays, 11:00-1:00 p.m., or by appointment Negotiations play an important part...
Date Added: 2009-02-02 15:41:43

557-fa07.doc
Path: Cornell >> PAM >> 557 Fall, 2008
Description: Department of Policy Analysis and Management PAM 557: Health Care Organizations Fall 2007 John M. Kuder, Ph.D. E-mail: jmk15@cornell.edu (instructor) & Phone: 255-2510 Office: 135 MVR Hall E-mail: jmk15@cornell.edu Class Time: TR 1:25-2:40 Class Room...
Date Added: 2009-02-02 13:59:22

neruda.pdf
Path: UNC >> HIST >> 143 Fall, 2008
Description: La Standard Oil Co. Cuando el barreno se abri paso hacia las simas pedregales y hundi su intestino implacable en las haciendas subterrneas, y los aos muertos, los ojos de las edades, las races de las plantas encarceladas y los sistemas escamosos se h...
Date Added: 2009-02-03 14:06:00

040811WTO.txt
Path: Chester >> ECO >> 343 Fall, 2008
Description: Slovenia Business Week Slovenia\'s Negotiators Comment Consequences of WTO Agreement As for services, the launch of negotiations on further liberalisation of the trade in services for Slovenia could mean a large development incentive. According to Gr...
Date Added: 2009-02-11 19:34:53

400-010.pdf
Path: DeAnza College >> NUTR >> 010 Fall, 2008
Description: Beef 2001 PUBLICATION 400-010 Nutrition and Feeding of the Cow-Calf Herd: Digestive System of the Cow John B. Hall and Susan Silver* Proper nutrition is the foundation for a productive and profitable cow-calf herd. Without good nutrition, cattle ca...
Date Added: 2009-02-02 14:02:36

DNCE 160.pdf
Path: CSU Sacramento >> DNCE >> 160 Fall, 2008
Description: ...
Date Added: 2009-02-02 13:52:02

previewing.pdf
Path: Idaho State >> ACAD >> 210 Fall, 2008
Description: Previewing Amarkofanefficientreaderisbeingabletoselectquicklytheskillsyouneedtoreadaparticular selectioninkeepingwiththepurposeyouhaveforreadingit.Toselectproperskills,youmustspend sometimethinkingaboutaselectionorbookbeforereadingitcompletely.Thisth...
Date Added: 2009-01-09 20:09:46

previewing.pdf
Path: Idaho State >> ACAD >> 220 Fall, 2008
Description: Previewing Amarkofanefficientreaderisbeingabletoselectquicklytheskillsyouneedtoreadaparticular selectioninkeepingwiththepurposeyouhaveforreadingit.Toselectproperskills,youmustspend sometimethinkingaboutaselectionorbookbeforereadingitcompletely.Thisth...
Date Added: 2009-01-09 20:09:46

previewing.pdf
Path: Idaho State >> ACAD >> 101 Fall, 2008
Description: Previewing Amarkofanefficientreaderisbeingabletoselectquicklytheskillsyouneedtoreadaparticular selectioninkeepingwiththepurposeyouhaveforreadingit.Toselectproperskills,youmustspend sometimethinkingaboutaselectionorbookbeforereadingitcompletely.Thisth...
Date Added: 2009-01-09 20:09:46

previewing.pdf
Path: Idaho State >> ACAD >> 102 Fall, 2008
Description: Previewing Amarkofanefficientreaderisbeingabletoselectquicklytheskillsyouneedtoreadaparticular selectioninkeepingwiththepurposeyouhaveforreadingit.Toselectproperskills,youmustspend sometimethinkingaboutaselectionorbookbeforereadingitcompletely.Thisth...
Date Added: 2009-01-09 20:09:46

previewing.pdf
Path: Idaho State >> ACAD >> 103 Fall, 2008
Description: Previewing Amarkofanefficientreaderisbeingabletoselectquicklytheskillsyouneedtoreadaparticular selectioninkeepingwiththepurposeyouhaveforreadingit.Toselectproperskills,youmustspend sometimethinkingaboutaselectionorbookbeforereadingitcompletely.Thisth...
Date Added: 2009-01-09 20:09:46

ENGR 204 Calendar.pdf
Path: Olympic College >> ENGR >> 170 Spring, 2008
Description: Course Outline Item 4159 Spring Quarter, 2008 10 a.m. Daily Class Electrical ENGR 215 Engineering Fundamentals Prof. Jeff Brown Week No. Date 1 31-Mar-08 01-Apr-08 02-Apr-08 03-Apr-08 04-Apr-08 2 07-Apr-08 08-Apr-08 09-Apr-08 10-Apr-08 11-Apr-08 ...
Date Added: 2009-01-09 05:56:26

ENGR 204 Calendar.pdf
Path: Olympic College >> ENGR >> 171 Spring, 2008
Description: Course Outline Item 4159 Spring Quarter, 2008 10 a.m. Daily Class Electrical ENGR 215 Engineering Fundamentals Prof. Jeff Brown Week No. Date 1 31-Mar-08 01-Apr-08 02-Apr-08 03-Apr-08 04-Apr-08 2 07-Apr-08 08-Apr-08 09-Apr-08 10-Apr-08 11-Apr-08 ...
Date Added: 2009-01-09 05:56:26

ENGR 204 Calendar.pdf
Path: Olympic College >> ENGR >> 215 Spring, 2008
Description: Course Outline Item 4159 Spring Quarter, 2008 10 a.m. Daily Class Electrical ENGR 215 Engineering Fundamentals Prof. Jeff Brown Week No. Date 1 31-Mar-08 01-Apr-08 02-Apr-08 03-Apr-08 04-Apr-08 2 07-Apr-08 08-Apr-08 09-Apr-08 10-Apr-08 11-Apr-08 ...
Date Added: 2009-01-09 05:56:28

ENGR 204 Calendar.pdf
Path: Olympic College >> CHEM >> 139 Spring, 2008
Description: Course Outline Item 4159 Spring Quarter, 2008 10 a.m. Daily Class Electrical ENGR 215 Engineering Fundamentals Prof. Jeff Brown Week No. Date 1 31-Mar-08 01-Apr-08 02-Apr-08 03-Apr-08 04-Apr-08 2 07-Apr-08 08-Apr-08 09-Apr-08 10-Apr-08 11-Apr-08 ...
Date Added: 2009-01-09 15:16:21

ENGR 204 Calendar.pdf
Path: Olympic College >> PHYS >> 110 Spring, 2008
Description: Course Outline Item 4159 Spring Quarter, 2008 10 a.m. Daily Class Electrical ENGR 215 Engineering Fundamentals Prof. Jeff Brown Week No. Date 1 31-Mar-08 01-Apr-08 02-Apr-08 03-Apr-08 04-Apr-08 2 07-Apr-08 08-Apr-08 09-Apr-08 10-Apr-08 11-Apr-08 ...
Date Added: 2009-01-09 15:16:21

chromium.doc
Path: Morgan >> IEGR >> 309 Fall, 2009
Description: Chromium Report Chromium (Cr), chemical element of Group VIb of the periodic table. It is a hard, steel-gray metal that takes a high polish and is used in alloys to increase strength and corrosion resistance. The element is one of the transition elem...
Date Added: 2009-04-15 23:56:12

genkooyooshi.pdf
Path: Amherst >> JAPA >> 02 Fall, 2008
Description: ...
Date Added: 2009-02-11 21:52:35

SamplePrelim1Solutions
Path: Cornell >> ORIE >> 3300 Fall, 2008
Description: Sample Prelim Solutions: Problem #1: (a): x3 , x4 and x5 are slack variables that were added to put the original problem into canonical form so that the Simplex method can be used. (b): The 3 B= 3 1 basis isx1 , x2 , x3 , so the basis matrix is: 11 ...
Date Added: 2008-10-05 19:41:33

Exam 2 A solutions
Path: CUNY City >> MATH >> 201 Spring, 2008
Description: Math 201 Exam 2 A 04/08/08 Show all work to get full credit, each question is worth the same Name:_ 1. 2. Find 1 dy at 1, 2 dx 3. 4. 5. 6.Graph f ( x) x 3 3x 2 . Indicate coordinates of all local max/min points, and points of inflection. You...
Date Added: 2008-05-06 01:21:02

CangelosiResearchGuide.pdf
Path: Tulane >> ENLS >> 200 Fall, 2008
Description: ...
Date Added: 2009-01-11 19:52:02

POSC 343€”Women
Path: Delaware >> POSC >> POSC343 Spring, 2009
Description: POSC 343Women, Healthcare, and Politics M. Palley http:/www.udel.edu/poscir/faculty/mPalley/mpalley.html February 11, 2009 *At the present time, according to Commerce Dept, 15% of nations GDP is associated with health care *The largest spender of hea...
Date Added: 2009-03-15 07:32:07

TRADE LIBERALIZATION AND POVERTY SM
Path: Vanderbilt >> ECON >> 305 Spring, 2008
Description: TRADE LIBERALIZATION AND POVERTY Winters, McCulloch, McKay Introduction Most economists accept that, in the long run, open economies fare better in aggregate than closed ones. However one of the steps towards openness trade liberalization harms po...
Date Added: 2008-04-19 13:41:24

6OHDA_Lab_report_instructions.doc
Path: Amherst >> NEUR >> 26 Fall, 2008
Description: Introduction to Neuroscience 6OHDA Lesion Lab Report Instructions Your lab report should be organized into the following sections: Introduction: Give a brief explanation of the system in which we are working and why the experiments were done. What hy...
Date Added: 2009-02-11 21:53:28

180.pdf
Path: University of Illinois, Urbana Champaign >> ENVS >> 180 Spring, 2008
Description: Course Schedule - Fall 2004 Environmental Studies 180 Natural Disasters Credit: 3 hours. (ENVST 180) Same as GEOL 118, and GLBL 118. See GEOL 118. This course satisfies the General Education Criteria for a Physical Sciences course. CRN 41059 Type l...
Date Added: 2009-02-02 18:42:32

Riess-etal-2007.pdf
Path: Rutgers >> 560 >> 633 Fall, 2008
Description: The Astrophysical Journal, 659:98Y121, 2007 April 10 # 2007. The American Astronomical Society. All rights reserved. Printed in U.S.A. A NEW HUBBLE SPACE TELESCOPE DISCOVERIES OF TYPE Ia SUPERNOVAE AT z ! 1: NARROWING CONSTRAINTS ON THE EARLY BEHAV...
Date Added: 2009-01-10 00:01:57

Riess-etal-2007.pdf
Path: Rutgers >> 690 >> 372 Spring, 2008
Description: The Astrophysical Journal, 659:98Y121, 2007 April 10 # 2007. The American Astronomical Society. All rights reserved. Printed in U.S.A. A NEW HUBBLE SPACE TELESCOPE DISCOVERIES OF TYPE Ia SUPERNOVAE AT z ! 1: NARROWING CONSTRAINTS ON THE EARLY BEHAV...
Date Added: 2009-01-12 05:24:32

2006 Response to Survey - Improvement.doc
Path: NJ City >> SURVEY >> 05 Fall, 2008
Description: CONGRESSMAN FRANK J. GUARINI LIBRRY NEW JERSEY CITY UNIVERSITY LIBRARY IMPROVEMENTS IN RESPONSE TO LIBRARY SURVEY Thank you for your participation in the library survey last fall. This document outlines some of the improvements the library has made a...
Date Added: 2009-02-11 20:52:05

kimdaejungtolisteraug10,1989.pdf?id=txu-blac-glp-423
Path: Texas >> LAW >> 423 Fall, 2008
Description: e,-xv Mr. George Lister t mila. The m~s gratifying event was the triumphant struggle of June, 1987 in which t h e will o f our people. finally oovetcasie t h e .military . ,\" . ., \' . . I< C. ? : : \' ...
Date Added: 2009-02-03 14:13:30

b3
Path: SUNY Albany >> HIST >> 327 Spring, 2008
Description: ...
Date Added: 2008-04-08 00:27:59

p1-4midtermKey
Path: UCLA >> BIOCHEM >> 153A Spring, 2007
Description: Seat # _ Last initial _ Chemistry and Biochemistry 153A Winter 2005 Midterm Examination -KEY _KEY_ Print your full name (last name first) Question # 1 2 3 4 5 6 TOTAL Value 28 21 32 28 15 28 152 INSTRUCTIONS READ EACH QUESTION CAREFULLY! SHOW YOUR CA...
Date Added: 2008-06-09 16:31:34

Huxman_lecture5.2008.pdf
Path: Arizona >> BIOSCI >> 19 Fall, 2008
Description: Evolution of Photoautotrophy (and Plant Diversity) Ecol 182 3-4-2008 Posted on web 3-3-08 at 5:30 pm Summary from last time We talked about? Figure 29.1 What Is a Plant? Diversity of Embrophytes Embryophytes fall out into 10 phyla Three phyla (l...
Date Added: 2009-02-18 13:32:18

Huxman_lecture5.2008.pdf
Path: McGill >> BIOSCI >> 19 Fall, 2008
Description: Evolution of Photoautotrophy (and Plant Diversity) Ecol 182 3-4-2008 Posted on web 3-3-08 at 5:30 pm Summary from last time We talked about? Figure 29.1 What Is a Plant? Diversity of Embrophytes Embryophytes fall out into 10 phyla Three phyla (l...
Date Added: 2009-02-18 13:32:18

010703Factsheet.txt
Path: Chester >> ECO >> 343 Fall, 2008
Description: Globalist Factsheet: Our Top Facts on Mexico Globalist Factsheet Mexico > State of Affairs Vicente Fox\'s Mexico Mexico\'s new president Vicente Fox has promised to overhaul the country\'s economic and social policies. He has reason for his optimis: Me...
Date Added: 2009-02-11 17:26:11

CMP Cheat Sheet
Path: Michigan State University >> CMP >> 101 Fall, 2008
Description: Construction Divisions- Div. 1-General Requirements, Div. 2-Site Construction, Div. 3-Concrete, Div. 4-Masonry, Div. 5-Metals, Div. 6-Wood and Plastics, Div. 7Thermal and Moisture Protection, Div. 8-Doors and Windows, Div. 9-Finishes, Div. 10-Special...
Date Added: 2008-04-07 11:57:32

malott ch14
Path: USC >> PSYC >> 305 Fall, 2008
Description: Quiz 8: Malott Ch.14 I. Malott Ch. 14: Imitation A. Imitation: the form of behavior by an imitator is controlled by a model of similar behavior 1. Form of behaviorDoes NOT occur simply when behavior of the imitator is similar to the behavior of the m...
Date Added: 2009-02-11 21:22:38

23-Applications of the First Law
Path: Texas >> CH 301 >> 53750 Spring, 2009
Description: Applications of the First Law B. A. Rowland 53750/53760 Types of Enthalpies You will need to be able to classify certain types of enthalpy reaction, and be able to give an example of each: Hrxn = The Enthalpy of Reaction: the enthalpy for any given c...
Date Added: 2009-02-02 17:46:58

DI_defense1.pdf
Path: UC Irvine >> PSYCH >> 145p Fall, 2008
Description: Final Dissertation Defense: General Guidelines The Dissertation defense is typically conducted within a two-hour time period. Approximately the first half hour is devoted to the presentation of the Dissertation by the candidate. Another hour or so i...
Date Added: 2009-01-12 05:05:17

DI_defense1.pdf
Path: UC Irvine >> SOC SCI >> 195a Fall, 2008
Description: Final Dissertation Defense: General Guidelines The Dissertation defense is typically conducted within a two-hour time period. Approximately the first half hour is devoted to the presentation of the Dissertation by the candidate. Another hour or so i...
Date Added: 2009-01-12 05:05:17

DI_defense1.pdf
Path: UC Irvine >> MATH >> 192 Winter, 2008
Description: Final Dissertation Defense: General Guidelines The Dissertation defense is typically conducted within a two-hour time period. Approximately the first half hour is devoted to the presentation of the Dissertation by the candidate. Another hour or so i...
Date Added: 2009-01-12 05:05:17

DI_defense1.pdf
Path: UC Irvine >> PSYCH >> 121a Winter, 2008
Description: Final Dissertation Defense: General Guidelines The Dissertation defense is typically conducted within a two-hour time period. Approximately the first half hour is devoted to the presentation of the Dissertation by the candidate. Another hour or so i...
Date Added: 2009-01-12 05:05:17

CS-441-0001-Spring-2008.pdf
Path: UVA >> CS >> 441 Spring, 2008
Description: C S 441-0001 Principles Of Software Design - Spring 2008 School Of Engineering And Applied Science (1006x) INSTRUCTORS: Bloomfield, Aaron S. (asb2t) Respondents: 22 / Enrollment: 33 Summary: C S 441-0001 Principles Of Software Design - Spring 2008 (...
Date Added: 2009-02-02 20:26:44

101L Final Exam Study Guide
Path: UNC >> CHEM LAB >> 101L Spring, 2008
Description: Study Guide For Chem 101L Final Exam 1. Names, uses, and differences of Chemical Glassware Erlenmeyer flask vs. a side-arm flask Volumetric pipette vs. graduated pipette Volumetric flask vs. graduated cylinder vs. beaker Burette, cuvette, pipette, et...
Date Added: 2008-04-08 18:08:05

31295017084434.pdf
Path: Texas Tech >> ETD >> 07312008 Fall, 2009
Description: INHERITANCE OF FIBER LENGTH MUTANTS OF UPLAND COTTON AND RELATIONSHIPS AMONG LINT YIELD, FIBER QUALITY, AND ECONOMIC INDICES by SCOTT W. MOFFETT, B.S. A THESIS IN CROP SCIENCE Submitted to the Graduate Faculty of Texas Tech University in Partial Fulf...
Date Added: 2009-04-15 20:35:08

Workiraf208.doc
Path: UGA >> HAL >> 3010 Fall, 2008
Description: Worksheet for CCD Exercise #2 Enter your conclusions here when you see Q in the tutorial. Q1 Bias mean std dev Zero mean std dev Q2 Rows trimmed off Columns trimmed off , Rows kept Columns kept Q3 paste vm3 long header (shrink font to 8 or 9) Q4. ...
Date Added: 2009-02-18 13:54:37

Problem Set 2
Path: UCSB >> CHEM >> 173A Spring, 2008
Description: Problem Set 2 Chemistry 173a/268a Due: Oct 26, 2007 1. Draw the Lewis dot structures for the following molecules: a) ClF3 b) XeF4 c) SO2 d) ClO2F3 e) TeCl4 f) IO3- g) ICl2+ 2. Using the VSEPR model, predict the shape of each of the molecules above. P...
Date Added: 2008-08-06 11:04:14

050124business.txt
Path: Chester >> ECO >> 343 Fall, 2008
Description: BUDAPEST BUSINESS JOURNAL - Business (print view)BUDAPEST BUSINESS JOURNAL http:/www.bbj.hu/?module=displaystoryformat=html Business By Matv Rts board decided on a rebrand, introducing its parent Deutsche Telekoms T-brand and chang...
Date Added: 2009-02-11 20:10:45

peak_shift.xls
Path: N. Illinois >> PSYC >> 431s Spring, 2008
Description: -0.9 0.1 0.2 0.3 0.4 0.5 0.6 0.7 0.8 0.9 0 1 -0.8 -0.7 -0.6 -0.5 -0.4 -0.3 -0.2 -0.1 -1 Co lu mn A Co lu mn D Co lu mn G Co lu mn J Co lu mn M Co lu mn P Co lu mn S Co lu mn V Co lu mn Y Co lu mn AB Co lu mn AE Co lu mn AH Co lu mn AK Co lu...
Date Added: 2009-01-11 17:08:42

peak_shift.xls
Path: N. Illinois >> PSYC >> 411 Fall, 2008
Description: -0.9 0.1 0.2 0.3 0.4 0.5 0.6 0.7 0.8 0.9 0 1 -0.8 -0.7 -0.6 -0.5 -0.4 -0.3 -0.2 -0.1 -1 Co lu mn A Co lu mn D Co lu mn G Co lu mn J Co lu mn M Co lu mn P Co lu mn S Co lu mn V Co lu mn Y Co lu mn AB Co lu mn AE Co lu mn AH Co lu mn AK Co lu...
Date Added: 2009-01-11 17:08:35

peak_shift.xls
Path: N. Illinois >> PSYC >> 431 Fall, 2008
Description: -0.9 0.1 0.2 0.3 0.4 0.5 0.6 0.7 0.8 0.9 0 1 -0.8 -0.7 -0.6 -0.5 -0.4 -0.3 -0.2 -0.1 -1 Co lu mn A Co lu mn D Co lu mn G Co lu mn J Co lu mn M Co lu mn P Co lu mn S Co lu mn V Co lu mn Y Co lu mn AB Co lu mn AE Co lu mn AH Co lu mn AK Co lu...
Date Added: 2009-01-11 17:08:42

bishopposter.pdf
Path: IUPUI >> ME >> 462 Fall, 2008
Description: Bishop Steering Technology CNC Fixture Design The Product Customer Requirements 1 Rack deects/shifts < 0.1 microns under tool load (i.e. 100% of racks pass DIN Class 9) (pitch & roll, yaw is a bonus) Background | Bishop Steering Technology designs r...
Date Added: 2009-01-09 01:56:34

Bowling.pdf
Path: USF >> USFWEB >> 2 Fall, 2009
Description: UNIVERSITY OF SOUTH FLORIDA CAMPUS RECREATION INTRAMURAL SPORTS BOWLING Revised 1/14/09 PLAYERS AND ATTIRE All players MUST wear bowling shoes. A team can consist of up to six (6) bowlers; a combination of only four (4) can bowl each game. Must have...
Date Added: 2009-04-16 00:31:54

EE562a_Lecture_01_082707
Path: USC >> EE >> EE562a Fall, 2007
Description: Aug 27 - 5:01 PM 1 Aug 27 - 5:13 PM 2 Aug 27 - 5:16 PM 3 Aug 27 - 5:20 PM 4 Aug 27 - 5:22 PM 5 Aug 27 - 5:26 PM 6 Aug 27 - 5:30 PM 7 Aug 27 - 5:35 PM 8 Aug 27 - 5:39 PM 9 Aug 27 - 5:42 PM 10 Aug 27 - 5:46 PM 11 Aug 27 - 5:50 PM ...
Date Added: 2008-02-28 10:14:24

Fiscal%20Services.pdf
Path: George Mason >> DOCUMENT >> 28976 Fall, 2009
Description: , Fiscal Services Office of the Controller MSN 4B2 ebrockl@gmu.edu Phone: (703) 993-2660 Fax: (703) 993-2920 MEMORANDUM To: MauriceScherrens Beth Brock December 2004 22, Fiscal Services ThreeYear Plan: FiscalYears2006 - 2008 From: Date: Subject:...
Date Added: 2009-04-16 01:19:44

cal Test 1
Path: U. Houston >> MATH >> 1432 Spring, 2008
Description: PRINTABLE VERSION Test 1 You scored 60 out of 60 Question 1 Your answer is CORRECT. Calculate the integral. a) b) c) d) e) f) None of the above. Question 2 Your answer is CORRECT. Determine the derivative. a) b) c) d) e) f) None of the above. ...
Date Added: 2008-05-05 19:23:03

FRBR+and+Chapter+25+bibliography.doc
Path: Rochester >> DOCUMENT >> 1815 Fall, 2009
Description: FRBR and Chapter 25: Recommended Sources Association for Library Collections and Technical Services (ALCTS). 2003 November 3. Back to the Future: Understanding the Functional Requirements of Bibliographic Records Model (FRBR) and its Impact on Users,...
Date Added: 2009-04-15 23:07:53

starbucks data for illustrating desc stats,corr, regress.xls
Path: UCF >> ECO >> 6416 Fall, 2008
Description: STORE COUNTRY 1 USA 2 USA 3 USA 4 USA 5 USA 6 USA 7 USA 8 USA 9 USA 10 USA 11 USA 12 USA 13 USA 14 USA 15 USA 16 USA 17 USA 18 USA 19 USA 20 USA 21 USA 22 USA 23 USA 24 USA 25 USA 26 USA 27 USA 28 USA 29 USA 30 USA 31 USA 32 USA 33 USA 34 USA 35 USA ...
Date Added: 2009-01-10 02:32:00

Expos 2 final
Path: Harvard >> EXPOS >> 20 Fall, 2008
Description: Zheng 1 Dennis Zheng November 18, 2008 Essay 2 Cain and Able The blessings of the 21stcentury bring along with them many curses. As we increase the possibilities of what we can do on microscopic levels, the larger moral implications for our way of l...
Date Added: 2009-03-09 13:54:16

03Norsworthy_wildradishfinal report.pdf
Path: Clemson >> H R D >> 450 Summer, 2008
Description: Sensitivity of Vegetable Crops, Weeds, and a Soilborne Pathogen to Wild Radish Jason Norsworthy Dept. of Entomology, Soils, Plant Sciences PROBLEM ADDRESSED Herbicides are used extensively i...
Date Added: 2009-01-10 17:52:28

03Norsworthy_wildradishfinal report.pdf
Path: Clemson >> I P M >> 800 Fall, 2008
Description: Sensitivity of Vegetable Crops, Weeds, and a Soilborne Pathogen to Wild Radish Jason Norsworthy Dept. of Entomology, Soils, Plant Sciences PROBLEM ADDRESSED Herbicides are used extensively i...
Date Added: 2009-01-10 17:52:28

Herr.pdf
Path: Berkeley >> E >> 251 Fall, 2008
Description: Does it Pay to Delay? Understanding the Eect of First Birth Timing on Womens Wage Growth Jane Leber Herr University of California - Berkeley November 2007 Job Market Paper Abstract In this paper I estimate the eect of the timing of a womans rst birt...
Date Added: 2009-02-17 17:39:09

MCB 101 Syllabus F 08.pdf
Path: University of Illinois, Urbana Champaign >> UP >> 101 Fall, 2008
Description: MCB 101, Introductory Microbiology Fall 2008 Course Policies and Schedule Course Web Site: http:/www.life.uiuc.edu/mcb/101 User Name: mcb101, Password: cocci Course Instructor: Dr. Kenneth Chapman 202A Burrill Hall (217) 244-4941 kenchap@uiuc.edu Off...
Date Added: 2009-02-02 18:49:49

hands2.pdf
Path: Towson >> CHEM >> 332 Spring, 2008
Description: ...
Date Added: 2009-01-09 07:26:37

hands2.pdf
Path: Towson >> ART >> 373 Spring, 2008
Description: ...
Date Added: 2009-01-09 07:26:03

hands2.pdf
Path: Towson >> SOCI >> 373 Summer, 2008
Description: ...
Date Added: 2009-01-09 07:26:04

AldKet-1.ppt
Path: St. Mary's CA >> CHEM >> 02 Fall, 2009
Description: Alde s and Ke s hyde tone SH O O CH3CCH3 =O CH2=O CH3 O O OH CH3 O CH CH3 HO CH CH3 O O CH3 CH2 Nom nclature e Carbon atoms 1 2 3 4 5 6 7 8 Parent alkane Methane Ethane Propane Butane Pentane Hexane Heptane Octane 1) Select and number ...
Date Added: 2009-04-15 23:38:03

jb228.txt
Path: Lehigh >> DMD >> 1 Fall, 2008
Description: Subject: Distribution.List Date: Wed, 28 Feb 2001 16:56:32 +0100 (CET) From: Juergen Bokowski <bokowski@mathematik.tu-darmstadt.de> > > > > > > > > > > > > > > > > > > > > > > > > > > > > > > > > > > > > > > > > > > > > > > > > > > > > > > Hello Joan...
Date Added: 2009-02-17 23:13:56

az1350.pdf
Path: Arizona >> AZ >> 1350 Fall, 2008
Description: Cooperative Extension A HOMEOWNERS GUIDE TO CAMELTHORN Description Camelthorn (Alhagi pseudalhagi) is a perennial desert shrub introduced into the United States from western Asia and Mediterranean areas. Initial infestations were rst documented in C...
Date Added: 2009-02-06 20:31:40

coun5230_grot_dt.pdf
Path: Webster >> FALL >> 2 Fall, 2008
Description: College of Arts and Sciences Daytona Beach, FL Course Syllabus Course Term Instructor COUN 5230 Psychodiagnostics Fall 2, 2008 S. Bradley Grot, M.A.; N.C.C. samgrot@yahoo.com 386-898-3770 Office Hours: available upon request. COUN 5230 Psycho-diagnos...
Date Added: 2009-02-04 14:22:17

Chem103F04T2
Path: Delaware >> CHEM >> 103 Fall, 2009
Description: ...
Date Added: 2009-03-01 23:23:48

brooks-montanez-www06.pdf
Path: San Diego State >> LING >> 681 Fall, 2008
Description: Improved Annotation of the Blogopshere via Autotagging and Hierarchical Clustering Christopher H. Brooks Computer Science Department University of San Francisco 2130 Fulton St. San Francisco, CA 94117-1080 Nancy Montanez Computer Science Department ...
Date Added: 2009-01-09 07:00:02

Koreanmajorchanges.cover.doc
Path: Ohio State >> GERMAN >> 530 Winter, 2008
Description: December 14, 2007 Summary of revisions to Korean major changes 398 Hagerty Hall 1775 College Road Columbus, OH 432101340 Phone (614) 2925816 Fax (614) 2923225 Website address: Department of East Asian Languages and Literatures http:/deall.osu.edu/ ...
Date Added: 2009-01-10 03:24:15

Koreanmajorchanges.cover.doc
Path: Ohio State >> MUSIC >> 422 Winter, 2008
Description: December 14, 2007 Summary of revisions to Korean major changes 398 Hagerty Hall 1775 College Road Columbus, OH 432101340 Phone (614) 2925816 Fax (614) 2923225 Website address: Department of East Asian Languages and Literatures http:/deall.osu.edu/ ...
Date Added: 2009-01-11 22:25:38

Social Influence
Path: Tufts >> PSYCH >> 1 Fall, 2007
Description: Social Influence Most direct pressure vs Most indirect Pressure Obedience orders, commands Tuesday, October 16, 2007 Compliance request, appeal Conformity expectations Two Types of Conformity Private Conformity: Internalizing attitude, sta...
Date Added: 2008-10-01 20:23:05

MBA 719.docx
Path: George Mason >> MBA >> 719 Fall, 2008
Description: George Mason University Graduate Council Graduate Course Approval Form All courses numbered 500 or above must be submitted to the Graduate Council for final approval after approval by the sponsoring College, School or Institute. Graduate Council r...
Date Added: 2009-02-02 14:21:46

040519policy.txt
Path: Chester >> ECO >> 343 Fall, 2008
Description: The New York Times > Business > World Business > Market Place: Old Reflexes Hurting 2 Asian Economic Giants May 19, 2004 MARKET PLACE Old Reflexes Hurting 2 Asian Economic Giants By KEITH BRADSHER ONG KONG, May 18 - The more signs China and India ha...
Date Added: 2009-02-11 18:08:34

Expt_1_notebook.pdf
Path: UCSC >> CHEM >> 1m Winter, 2008
Description: Chemistry 1M & 1N Lab Lecture Notebook (lecture note skeleton) Winter 2003 to compliment Lab Lecture by One Sun for the Department of Chemistry and Biochemistry at the University of California in Santa Cruz Lecture Note Skeleton This notebook is d...
Date Added: 2009-02-02 17:42:19

PFSHS 114 160-163.pdf
Path: UF >> HOS >> 4304 Fall, 2008
Description: ...
Date Added: 2009-01-10 18:37:35

PFSHS 114 160-163.pdf
Path: UF >> FRC >> 3212 Fall, 2008
Description: ...
Date Added: 2009-01-12 06:18:15

PFSHS 114 160-163.pdf
Path: UF >> VEC >> 2100 Fall, 2008
Description: ...
Date Added: 2009-01-12 06:18:52

PFSHS 114 160-163.pdf
Path: UF >> FRC >> 1010 Spring, 2008
Description: ...
Date Added: 2009-01-10 18:31:09

PFSHS 114 160-163.pdf
Path: UF >> VEC >> 3221c Fall, 2008
Description: ...
Date Added: 2009-01-12 06:18:52

PFSHS 114 160-163.pdf
Path: UF >> HOS >> 1014 Fall, 2008
Description: ...
Date Added: 2009-01-10 18:36:07

PFSHS 114 160-163.pdf
Path: UF >> HOS >> 3020 Fall, 2008
Description: ...
Date Added: 2009-01-10 18:36:50

The Depression and the New Deal
Path: USC >> HIST >> 200gm Fall, 2007
Description: The Depression and the New Deal- Depression, New Deal; what happened, why? What were the causes and conditions? How does the US react to these conditions and try to resolve it. does it work? Dustbowl essay is pretty good resource along with text) A) ...
Date Added: 2008-02-28 21:50:21

hmwk3.pdf
Path: Arizona >> MATH >> 565b Fall, 2008
Description: Math 565b - Homework 3 1. Recall that we dened a function x(t) on Q+ (the positive rationals) to be regularizable if its left and right hand limits both exist and are nite. In class I stated but did not prove Proposition: Let x(t) : Q+ R be regulari...
Date Added: 2009-01-09 15:45:52

Min_WomenStud.pdf
Path: Keene State >> PE >> 460 Fall, 2008
Description: For Advising Purposes Only. See Catalog for Official Requirements. 2002- 2003 Catalog KEENE STATE COLLEGE WOMEN\'S STUDIES MINOR This minor provides students with an interdisciplinary program that explores, from a feminist and global perspective, t...
Date Added: 2009-01-11 16:24:09

Min_WomenStud.pdf
Path: Keene State >> SPED >> 465 Fall, 2008
Description: For Advising Purposes Only. See Catalog for Official Requirements. 2002- 2003 Catalog KEENE STATE COLLEGE WOMEN\'S STUDIES MINOR This minor provides students with an interdisciplinary program that explores, from a feminist and global perspective, t...
Date Added: 2009-01-11 16:24:09

Min_WomenStud.pdf
Path: Keene State >> PSYC >> 470 Fall, 2008
Description: For Advising Purposes Only. See Catalog for Official Requirements. 2002- 2003 Catalog KEENE STATE COLLEGE WOMEN\'S STUDIES MINOR This minor provides students with an interdisciplinary program that explores, from a feminist and global perspective, t...
Date Added: 2009-01-11 16:24:09

Min_WomenStud.pdf
Path: Keene State >> PPS >> 0203 Fall, 2008
Description: For Advising Purposes Only. See Catalog for Official Requirements. 2002- 2003 Catalog KEENE STATE COLLEGE WOMEN\'S STUDIES MINOR This minor provides students with an interdisciplinary program that explores, from a feminist and global perspective, t...
Date Added: 2009-02-18 01:40:35

Min_WomenStud.pdf
Path: Keene State >> PSYC >> 496 Fall, 2008
Description: For Advising Purposes Only. See Catalog for Official Requirements. 2002- 2003 Catalog KEENE STATE COLLEGE WOMEN\'S STUDIES MINOR This minor provides students with an interdisciplinary program that explores, from a feminist and global perspective, t...
Date Added: 2009-01-11 16:24:09

Min_WomenStud.pdf
Path: Keene State >> PSYC >> 499 Fall, 2008
Description: For Advising Purposes Only. See Catalog for Official Requirements. 2002- 2003 Catalog KEENE STATE COLLEGE WOMEN\'S STUDIES MINOR This minor provides students with an interdisciplinary program that explores, from a feminist and global perspective, t...
Date Added: 2009-01-11 16:24:09

Min_WomenStud.pdf
Path: Keene State >> ESEC >> 465 Fall, 2008
Description: For Advising Purposes Only. See Catalog for Official Requirements. 2002- 2003 Catalog KEENE STATE COLLEGE WOMEN\'S STUDIES MINOR This minor provides students with an interdisciplinary program that explores, from a feminist and global perspective, t...
Date Added: 2009-01-11 16:24:08

Min_WomenStud.pdf
Path: Keene State >> SPED >> 401 Fall, 2008
Description: For Advising Purposes Only. See Catalog for Official Requirements. 2002- 2003 Catalog KEENE STATE COLLEGE WOMEN\'S STUDIES MINOR This minor provides students with an interdisciplinary program that explores, from a feminist and global perspective, t...
Date Added: 2009-01-11 16:24:09

Min_WomenStud.pdf
Path: Keene State >> PE >> 150 Fall, 2008
Description: For Advising Purposes Only. See Catalog for Official Requirements. 2002- 2003 Catalog KEENE STATE COLLEGE WOMEN\'S STUDIES MINOR This minor provides students with an interdisciplinary program that explores, from a feminist and global perspective, t...
Date Added: 2009-01-11 16:24:08

Min_WomenStud.pdf
Path: Keene State >> SPED >> 460 Fall, 2008
Description: For Advising Purposes Only. See Catalog for Official Requirements. 2002- 2003 Catalog KEENE STATE COLLEGE WOMEN\'S STUDIES MINOR This minor provides students with an interdisciplinary program that explores, from a feminist and global perspective, t...
Date Added: 2009-01-11 16:24:09

FoundersRates.pdf
Path: UGA >> ROCKEAGLE4 >> 4 Fall, 2008
Description: Founders Lodge At Rock Eagle 4-H Center 350 Rock Eagle Road Eatonton, Georgia 31024 Rate Structure Lodging at Founders Lodge is $70.00 per person and includes the use of the Conference Room, Class room, Internet access, unlimited beverages (tea, bott...
Date Added: 2009-02-18 13:55:10

im_ch32
Path: McGill >> EAPR >> 250 Summer, 2007
Description: 32 Finding and Evaluating Sources 32a QUOTATION: ONLINE RESEARCH To provide students with the clearest, most up-to-date information on how to do library research, I have included throughout this chapter many examples of real screens accessed through ...
Date Added: 2008-04-19 13:20:51

MU_Career_Manager090507.pdf
Path: Marquette >> REAL >> 157 Spring, 2008
Description: MU Career Manager 414.288.7423 career.services@marquette.edu www.marquette.edu/csc Holthusen Hall, 1st floor MU Career Manager is the on-line career management tool for Marquette University students. The system allows students and alumni access to ...
Date Added: 2009-01-10 17:53:27

lc2.short.pdf
Path: Wisconsin >> STAT >> 541 Fall, 2008
Description: 1 2 Probability Theory Before studying statistics, it is necessary to learn some fundamentals of probability theory. Well start with a few denitions in ordinary set theory, and use them as we move into probability. The set of all elements that bel...
Date Added: 2009-02-17 15:57:49

lc2.short.pdf
Path: SJR CC >> STAT >> 541 Fall, 2008
Description: 1 2 Probability Theory Before studying statistics, it is necessary to learn some fundamentals of probability theory. Well start with a few denitions in ordinary set theory, and use them as we move into probability. The set of all elements that bel...
Date Added: 2009-02-17 15:57:49

lecture3compl-09[1]
Path: MIT >> 18 >> 18.02 Spring, 2009
Description: Math 18.02 (Spring 2009): Lecture 3 Matrices. Inverse Matrices February 6 Reading Material: From Course Notes M. Last time: Cross product and determinant Today: Matrices and Inverse Matrices Recall: A matrix A is dened as a11 a12 a1n . A= . =...
Date Added: 2009-03-01 15:01:07

hw6_322_06_solns.pdf
Path: Eastern Oregon >> PHYS >> 322 Fall, 2008
Description: PHYS 322 Homework Set #6 Due May 3 1. Verify that the parity of the one-electron eigenfunctions 300 , 310 , 320 , and 322 , is determined by (1) . These wavefunctions are listed here. The As are just normalization constants, and ao is the rst Bohr ra...
Date Added: 2009-02-18 14:03:09

thermo5_00.pdf
Path: UCSC >> PHYS >> 112 Winter, 2008
Description: Physics 112 Problem Set #5 Winter 2000 DUE: THURSDAY FEBRUARY 10, 2000 All problems are taken from Baierlein unless otherwise indicated. In order to earn total credit for a problem solution, you must show all work involved in obtaining the solutio...
Date Added: 2009-01-11 21:56:02

projdesc.pdf
Path: Kentucky >> CS >> 499 Fall, 2008
Description: CS 499 Senior Design Project Fall 2008 Project Description and Milestones 2 September 2008 This document describes the process, milestones and required deliverables for your team project in CS 499, Fall 2008. You may begin working on the project a...
Date Added: 2009-02-03 13:53:02

Macro HW 3
Path: Willamette >> ECON >> 231 Fall, 2008
Description: Homework 3 1. The main differences between the classical and Keynesian models are those dealing with unemployment and wages. In the classical model unemployment is optional and thus they are always at the NAIRU or the natural rate of unemployment. I...
Date Added: 2008-04-07 08:36:36

mid_stduid.pdf
Path: Maryland >> EE >> 434 Spring, 2002
Description: File: e:\\courses\\spring2006\\434\\mid_stduid.doc RWN 03/14/06 ENEE 434 Midterm Study Guide Open book, open notes Possible topics are (with some related pages but also ideas from class) 1. Hopfield continuous time neural networks and Lyapunov functio...
Date Added: 2009-02-06 19:16:47

HD 216 Prelim 1 SG
Path: Cornell >> HD >> 2160 Spring, 2008
Description: - Study guide Notes Readings (Case Studies & Packet) Changes of Adolescence Social Transitions Steinberg, Introduction, pp. 3-20: How do different perspectives influence how we define the beginning and ending of adolescence? A complete understandi...
Date Added: 2008-10-23 18:33:04

proj2.pdf
Path: Berkeley >> STAT >> 133 Fall, 2008
Description: Who plays video games Ninety-ve of the 314 students in Statistics 2, Section 1, during Fall 1994 were selected at random to participate in a survey of video game playing. Completed questionnaires were obtained from 91 of the 95 students. The data ava...
Date Added: 2009-04-16 02:03:10

L1.Introduction
Path: Cornell >> ECE >> 4750 Fall, 2008
Description: ECE 475/CS 416 Computer Architecture - Introduction Edward Suh Computer Systems Laboratory suh@csl.cornell.edu Todays Agenda Question 1: What is this course about? What will I learn from it? Question 2: How will the course be run? What do I need to...
Date Added: 2008-10-15 19:59:09

ECO365 Week 4 Lecture Notes
Path: University of Phoenix >> BUS >> ECO 365 Spring, 2009
Description: Chapter 2 I. The last chapter emphasized that an economic system must coordinate individuals wants and desires. A. 1. 2. 3. An economic system has to solve three coordination problems: What, and how much, to produce. How to produce it. For whom to pr...
Date Added: 2009-03-02 10:03:37

350 syll S08 Groves.pdf
Path: CSU Chico >> LAST >> 350 Spring, 2008
Description: CHLD 350: Prenatal-Infant Development Spring 2008 Professor: Office: Phone: Course Email: Melissa Groves, Ph.D. 105 Modoc 898-5564 Email: mgroves@csuchico.edu For any class assignment or course communication use email within the VISTA (WebCT) envir...
Date Added: 2009-02-02 13:48:33

433sylF05.doc
Path: JMU >> ISAT >> 433 Fall, 2008
Description: INTEGRATED SCIENCE AND TECHNOLOGY ISAT 433 - Selected Problems In Manufacturing Fall 2005 Course Objectives: This course will address selected problems in manufacturing. The three major areas of manufacturing - materials, processes and systems - will...
Date Added: 2009-02-02 14:40:14

statCJan20.pdf
Path: N.C. State >> WWW4 >> 4 Fall, 2007
Description: North Carolina Basis Corn, Jan, At Market panto (20) The CAPABILITY Procedure Fitted Normal Distribution for nc_20 Parameters for Normal Distribution Parameter Symbol Estimate Mean Std Dev Mu Sigma 0.086538 0.105411 15:56 Wednesday, December 20, 200...
Date Added: 2009-02-17 22:59:27

pc-31-Moderns.ppt
Path: Minnesota >> ANTH >> 1602 Fall, 2008
Description: Class Slides Set 31 Homo sapiens sapiens Moderns Cro-Magnon I (France) Understanding Physical Anthropology and Archaeology, 9th Ed., p. 285. Homo Genus Species Homo rudolfensis ( early ) habilis ( early ) erectus Java (Trinil) Pithecanthro...
Date Added: 2009-02-17 21:19:15

In what ways was the westward movement central to
Path: UGA >> HIST 2111 >> NOT SURE Spring, 2009
Description: In what ways was the westward movement central to (white) Americas sense of itself? How do James Fennimore Cooper, Thomas Cole, and Davy Crockett exemplify Americas search for its national character? Movement West Between 1790 and 1840, 4.5 mill...
Date Added: 2009-03-22 10:50:46

ch20
Path: Pacific >> PHYS >> 23 Spring, 2008
Description: CHAPTER 20 ELECTRIC CIRCUITS CONCEPTUAL QUESTIONS _ 1. REASONING AND SOLUTION a. When S1 is set to position A, current can flow from the generator only along the path that requires S2 to be set to position A. Hence, the light will be on when S2 is ...
Date Added: 2008-05-09 16:06:08

homework2.pdf
Path: DeAnza College >> MATH >> 251 Fall, 2008
Description: Texas A&M University Department of Mathematics Volodymyr Nekrashevych Fall 2008 Math 251 Problem Set 2 Issued: 09.07 Due: 09.16 2.1. Find the cross product a b for 1. a = 2, 3, 4 , b = 3, 0, 1 , 2. a = i + j + k, b = i + j k. 2.2. Find a unit ve...
Date Added: 2009-02-02 14:02:13

102s00mt1
Path: Boğaziçi University >> C >> CMPE 150 Spring, 2008
Description: fC Q E q @Df A 9 5 7 R 5 7 7 5 5 |SUPSR@h7QrY9ISVY|9 y XkVk7Uk|PQI@Vk7Q\"FnCfCFS@9X87SVk|PSRYq7Q 7 @9C |9 } % q8f Hq F |QkSV|rYpk SUPSRYq7QrQSY@...
Date Added: 2008-04-30 14:25:59

050904exotic.txt
Path: Chester >> ECO >> 343 Fall, 2008
Description: Water Buffalo? Swamps? This Is Japan? - New York Times September 4, 2005 Water Buffalo? Swamps? This Is Japan? By NORIMITSU ONISHI SAY Okinawa, and the word conjures up one of the last major battles of World War II and the enduring presence of Ameri...
Date Added: 2009-02-11 17:49:47

10.pdf
Path: Idaho State >> ACAD >> 220 Fall, 2008
Description: ASystematicMethodofAnsweringMultipleChoiceQuestions READthestemofthequestion. Checkforunknownwordsorwordsthatmayhaveaspecificdefinitionfortheparticular subjectarea.Ifawordisunknownasktheinstructorormakeanintelligentguessatmeaning. Notekeywordsork...
Date Added: 2009-01-11 20:40:22

10.pdf
Path: Idaho State >> ACAD >> 103 Fall, 2008
Description: ASystematicMethodofAnsweringMultipleChoiceQuestions READthestemofthequestion. Checkforunknownwordsorwordsthatmayhaveaspecificdefinitionfortheparticular subjectarea.Ifawordisunknownasktheinstructorormakeanintelligentguessatmeaning. Notekeywordsork...
Date Added: 2009-01-10 17:52:55

10.pdf
Path: Idaho State >> ACAD >> 210 Fall, 2008
Description: ASystematicMethodofAnsweringMultipleChoiceQuestions READthestemofthequestion. Checkforunknownwordsorwordsthatmayhaveaspecificdefinitionfortheparticular subjectarea.Ifawordisunknownasktheinstructorormakeanintelligentguessatmeaning. Notekeywordsork...
Date Added: 2009-01-10 17:52:55

10.pdf
Path: Idaho State >> ACAD >> 101 Fall, 2008
Description: ASystematicMethodofAnsweringMultipleChoiceQuestions READthestemofthequestion. Checkforunknownwordsorwordsthatmayhaveaspecificdefinitionfortheparticular subjectarea.Ifawordisunknownasktheinstructorormakeanintelligentguessatmeaning. Notekeywordsork...
Date Added: 2009-01-11 20:40:22

10.pdf
Path: Idaho State >> ACAD >> 102 Fall, 2008
Description: ASystematicMethodofAnsweringMultipleChoiceQuestions READthestemofthequestion. Checkforunknownwordsorwordsthatmayhaveaspecificdefinitionfortheparticular subjectarea.Ifawordisunknownasktheinstructorormakeanintelligentguessatmeaning. Notekeywordsork...
Date Added: 2009-01-11 20:40:22

ME114_S06 HW Assignment 13.doc
Path: San Jose State >> ME >> 114 Fall, 2008
Description: ME 114: Spring 2006 Homework Assignment #13 (Chapters 11 and 12) Due May 11, 2006 (Problem numbers based on Second Edition) Prob # #12-8 (10 points) Problem statement Determine the view factors F13, F3(1+2), and F23 rectangular surfaces shown in the ...
Date Added: 2009-02-02 16:06:05

PI_Nugget_Template_new.doc
Path: Oklahoma >> CS >> 2007 Fall, 2008
Description: Project Highlights Award No: 0453545 Project Title: REU Site: Embedded Machine Learning Systems Investigators: Andrew H. Fagg, Dean F. Hougen, Amy McGovern, Terran Lane Institution: University of Oklahoma Website: http:/www-symbiotic.cs.ou.edu/reu ...
Date Added: 2009-02-17 22:39:11

PolishPensionReform.pdf
Path: Illinois State >> THE >> 380 Spring, 2008
Description: ...
Date Added: 2009-01-09 01:47:37

PolishPensionReform.pdf
Path: Illinois State >> SOA >> 333 Fall, 2008
Description: ...
Date Added: 2009-01-11 18:44:20

PolishPensionReform.pdf
Path: Illinois State >> COM >> 350 Summer, 2008
Description: ...
Date Added: 2009-01-09 01:48:00

PolishPensionReform.pdf
Path: Illinois State >> SOA >> 366 Spring, 2008
Description: ...
Date Added: 2009-01-12 03:22:03

PolishPensionReform.pdf
Path: Illinois State >> COM >> 485 Fall, 2008
Description: ...
Date Added: 2009-01-09 01:48:26

PolishPensionReform.pdf
Path: Illinois State >> COM >> 283 Fall, 2008
Description: ...
Date Added: 2009-01-09 01:46:56

PolishPensionReform.pdf
Path: Illinois State >> THE >> 280 Spring, 2008
Description: ...
Date Added: 2009-01-12 03:22:03

PolishPensionReform.pdf
Path: Illinois State >> THE >> 480 Fall, 2008
Description: ...
Date Added: 2009-01-09 01:48:26

PolishPensionReform.pdf
Path: Illinois State >> THE >> 283 Fall, 2008
Description: ...
Date Added: 2009-01-09 01:46:56

PolishPensionReform.pdf
Path: Illinois State >> THE >> 414 Fall, 2008
Description: ...
Date Added: 2009-01-12 04:28:00

PolishPensionReform.pdf
Path: Illinois State >> SOA >> 310 Fall, 2008
Description: ...
Date Added: 2009-01-09 01:49:47

PolishPensionReform.pdf
Path: Illinois State >> COM >> 310 Fall, 2008
Description: ...
Date Added: 2009-01-09 01:47:37

PolishPensionReform.pdf
Path: Illinois State >> THE >> 350 Fall, 2008
Description: ...
Date Added: 2009-01-11 16:11:50

SET04.pdf
Path: Drexel >> CS >> 04 Fall, 2008
Description: Automatically Transforming GNU C Source Code Christopher Dahn, Spiros Mancoridis Department of Computer Science Drexel University, Philadelphia, PA, USA {chris.dahn}@computer.org {mancors}@drexel.edu Abstract To perform automated transformation techn...
Date Added: 2009-02-06 20:37:55

LATEST-TA-MEMO.doc
Path: UC Irvine >> SOC SCI >> 10a Fall, 2008
Description: SOC SCI TA INFORMATION WELCOME! Here are some guidelines/suggestions/advice I have come up with to help you all maintain consistent policies, avoid exceptions (We are dealing with many students!) and bureaucratic problems, and optimize your use of ...
Date Added: 2009-01-09 19:45:56

99a1474_1dn.pdf
Path: Wisconsin >> M E >> 699 Fall, 2008
Description: DRAFTERS NOTE FROM THE LRBa1474/1dn JEO:kmg:km LEGISLATIVE REFERENCE BUREAU February 25, 2000 Representative La Fave: This amendment limits the coverage of AB699 to persons convicted of a violent felony, which is defined as any of the following fe...
Date Added: 2009-02-03 14:25:35

Get Started With Course Hero Today!

Get study guides, join study groups, and more!
Sign up in seconds with your Facebook account!
Course Hero is a Facebook Application Partner.
Click below to sign-up for FREE.
 

Our Social Learning Network was built to provide students and key learning partners like professors a platform to share, meet and collaborate while accelerating their comprehension of course-related theories and concepts. We are committed to providing you immediate access to a growing wealth of study materials and an unparalleled academic network of students, professors and other key partners.

Why do you care? Because you want the best grade possible and at times need a 24/7 resource that’s responsive to your needs.

What People Are Saying About Course Hero

“I was going to fail my Evidence exam, but then I found a great outline on Course Hero!”
- Kim Cowan, Cornell University



“I worked for tens of hours on my chemistry lab reports this semester, and now I can publish my hard work to thousands of people who care to read about what I found.”
- David Grauer, Princeton University




“Many times, students learn best from other students, their peers, rather than from a teacher.  Course Hero provides such a forum for students to teach students.”
- Somerset Perry, Georgetown University


“Course Hero is a great new research tool for college students.  Students can find lots of pertinent information to their studies that they previously could not find or have access to.  It’s for sure an educational innovation and potentially an educational revolution.”
- Andy Suiter, UCLA and UC Davis



“As a freshman, Course Hero will help me to decide what I am actually interested in studying in college.”
- Caity Feindt, Ithaca College



“I have found lecture notes on corporate finance created by students from multiple schools, which has really helped me learn more about the subject.”
- John Stacey III, UCSB



“I study less and learn more with Course Hero.”
- John Sweazey, CU-Boulder



 

Explore the benefits of joining Course Hero's social learning network.

Get millions of study materials now!

Need lecture notes for a missed class or want insightful explanation of the theories and concepts you learn in class? Look no further, Course Hero’s Study Materials empowers you to find a broad and deep set of materials that can help you right now!

Click below to sign-up for FREE.
 

Get over 200,000 textbook solutions now!

Having difficulty with your homework and need documents that are relevant for your Textbook? Don't be frustrated. Course Hero's Textbook Help presents you study materials from many college courses.

Click below to sign-up for FREE.
 

Meet over 300,000 students and your fellow classmates now!

Want to meet your current classmates or those that took the class last year? Don’t worry or have anxiety. Course Hero’s Study Groups gives you the seamless opportunity to develop both anonymous or direct relationships with those classmates whom you want to meet and get help from right now!

Click below to sign-up for FREE.
 

Course Hero is not sponsored or endorsed by any college or university.