Course Solutions And Notes - 02-over 3c

Displaying 12001-12500 of 23299 documents:
next page of documents

1954rcs0-88.pdf
Path: Neumont >> CSC >> 1954 Fall, 2009
Description: ...
Date Added: 2009-04-24 22:45:44

part1.pdf
Path: Maple Springs >> CSE >> 3421 Fall, 2009
Description: Course Information Introduction to Database Management Systems Four Assignments (7%, 3%, 10%, 10%) Mid-term Test (25%) Final Exam (45%) Course Web Site: www.cs.yorku.ca/course/3421 Late Assignment Submission: within 24 hours receives 20% penalty; no ...
Date Added: 2009-04-24 22:46:15

BUS303E01.TXT
Path: Sveriges lantbruksuniversitet >> BUS >> 19991 Fall, 2009
Description: Sheet1 PROFILE OF STUDENTS IN SFU COURSES COURSE: BUS 303-3 E01 LOCATION: SFU TITLE: BUS/SOCIETY/ETHICS SECTION TYPE: LEC SEMESTER: 1999-1 ENROL: 79 = PROGRAM OF STUDENT (Top 5 programs reported in each category Programs with < 3 students not shown s...
Date Added: 2009-04-24 22:47:42

7l.pdf
Path: UPenn >> VHM >> 802 Fall, 2009
Description: Fy yx%kITl4y4vT2Ip yp (d\"vd r m p r p p n r t v r yx%kITl t 2p4TIp yp r m p v p n r tv q 9ot rdIp yp n r tv n v T(r\"wt t ru4T5(\"4k\"4(m p v p n rv r v r DdSk $ D5v x r n g p g v t vt n p Fwt w%ndIndIfy4I(\"v9 i p t...
Date Added: 2009-04-24 22:50:40

12_030.txt
Path: UPenn >> VHM >> 801 Fall, 2009
Description: Exercise 12.30 - Minitab commands for analysis, with comments: MTB > Retrieve \"C:\\DATA.AVC\\teaching\\vhm801\\data_mtb\\Ch12\\EX12_030.MTP\"; SUBC> Portable. Retrieving worksheet from file: C:\\DATA.AVC\\teaching\\vhm801\\data_mtb\\Ch12\\EX12_030.MTP # Work...
Date Added: 2009-04-24 22:50:41

note10.pdf
Path: Air Force Academy >> EP >> 225 Fall, 2009
Description: ! ! \" # $ % % ! \" # \' ( ...
Date Added: 2009-04-24 22:50:55

handout_4.ppt
Path: Air Force Academy >> HANDOUT >> 316 Fall, 2009
Description: Spatial Mechanism: Kinematics Topics: Spatial motion construction Rotation about a fixed point Equation for rotation about a point ME 316 Handout 4 1 Spatial motion construction z Motion of the disk is our concern Motion sequence: P 1. Rotati...
Date Added: 2009-04-24 22:51:23

v03.n182.txt
Path: Air Force Academy >> STA >> 575 Fall, 2009
Description: Date: Wed, 20 Oct 1999 12:09:05 -0600 Message-Id: <199910201809.MAA20321@broadway.sfn.saskatoon.sk.ca> X-Authentication-Warning: broadway.sfn.saskatoon.sk.ca: majordomo set sender to owner-cdn-firearms-digest@sfn.saskatoon.sk.ca using -f From: owner-...
Date Added: 2009-04-24 22:52:06

matlab2.pdf
Path: W. Alabama >> ECE >> 204 Fall, 2009
Description: X i X xQy`clx |yQ clx `Q`p s(Iie$3|u |(Iie$x|u Q 3Iue$SuXypi3 Q IsXxixi33Q uueiui3 Q 3|xeyuyX|Q l xQ IsQyy IlIpXl |IlxS$QyXl Q $(k| Q Isxi3 Q IeQ...
Date Added: 2009-04-24 22:52:35

LC_Art_and_Design_Full_Time_2009_2010.pdf
Path: East Los Angeles College >> FULLTIME >> 0910 Fall, 2009
Description: Art and Design Art and Design The art and design department has a great reputation for its high standard of teaching, and 2007/2008 was no exception with four of our A level students achieving outstanding grades, all gaining one of the top five mark...
Date Added: 2009-04-24 22:53:22

htc.pdf
Path: Toledo >> PHY >> 326 Fall, 2009
Description: ADVANCED UNDERGRADUATE LABORATORY EXPERIMENT 13, HTC High TC Superconductors Last revision: Mar. 2006 by Jason Harlow Original Version by Malcolm Graham and Bryan Statt 1 Introduction Superconductivity was first discovered in pure metals, which ha...
Date Added: 2009-04-24 22:53:51

Q1sol.pdf
Path: W. Alabama >> STAT >> 231 Fall, 2009
Description: Statistics 231 Spring 2003 Quiz 1 Solutions Read the following article (which we have edited) taken from the web site (http:/www.cfah.org/hbns/newsrelease/cholesterol8-20-02.cfm) of the Centre for Advancement of Health. Release Date: Aug. 20, 2002 R...
Date Added: 2009-04-24 22:55:26

performance.pdf
Path: Toledo >> MGT >> 430 Fall, 2009
Description: Fixed Income Securities Lecture: Performance Measurement Contents 1 Performance Measurement 1.1 Return Measures: Measuring Investment Returns . . . . . . . . . . . . . . 1.1.1 Return Measures . . . . . . . . . . . . . . . . . . . . . . . . . . . . . ...
Date Added: 2009-04-24 22:57:04

cs211_27.ppt
Path: UWO >> CS >> 211 Fall, 2009
Description: Compiler Directives The C Preprocessor x x The C preprocessor (cpp) changes your source code based on instructions, or preprocessor directives, embedded in the source code. The preprocessor creates a new version of your program and it is this new ...
Date Added: 2009-04-24 22:58:00

bach_siciliano_bmv_1031-let.pdf
Path: W. Alabama >> BWV >> 1031 Fall, 2009
Description: Siciliano from the Flute Sonata no. 2 BMV 1031 J.S. Bach (1685 - 1750) Flute 6 8 6 8 Guitar 4 7 11 15 Public Domain 2 18 21 24 27 30 Sheet music from www. MutopiaProject .org Free to download, with the freedom to distribute, modify and...
Date Added: 2009-04-24 22:58:42

Assignment2Solutions_2005.pdf
Path: Toledo >> PHY >> 180 Fall, 2009
Description: PHY 180F SOLUTIONS TO ASSIGNMENT 2 2005 1) After the mass is hung on the spring: kX = mg mg X= k If down is positive, the total force on the mass is: F = - kx + mg (1) Newton\'s second law is: d 2x F = ma = m 2 (2) dt Equating (1) and (2) d 2x m 2 = ...
Date Added: 2009-04-24 22:59:05

p903-oneil.pdf
Path: UWO >> CS >> 853 Fall, 2009
Description: ORDPATHs: Insert-Friendly XML Node Labels Patrick ONeil, Elizabeth ONeil1 University of Massachusetts Boston {poneil, eoneil}@cs.umb.edu 1 Shankar Pal, Istvan Cseri, Gideon Schaller, Nigel Westbury Microsoft Corporation {shankarp, istvanc,gideons}@m...
Date Added: 2009-04-24 23:00:05

08-problem-frame-concerns-pt1.pdf
Path: Virgin Islands >> SENG >> 321 Fall, 2009
Description: University of Victoria f Department of Computer Science SENG 321 REQUIREMENTS ENGINEERING DR. KEITH POTTER ECS 621 TEL 472-5726 POTTERK@UVIC.CA HTTP:/WWW.ENGR.UVIC.CA/~SENG321/ \"There is no unified thinking tool\" (Jim Highsmith) Recall: Problem Fr...
Date Added: 2009-04-24 23:02:00

20041_09.pdf
Path: East Los Angeles College >> JOURNAL >> 20041 Fall, 2009
Description: Art on the line EXHIBITION REVIEW Dream Factory Communism at the Schirn Kunsthalle, Frankfurt, Germany Joanne Harold Department of History of Art, University of Bristol, 43 Woodland Road, Bristol, BS8 1UU, England J.M.Harold@bristol.ac.uk We were ...
Date Added: 2009-04-24 23:02:09

Farm_Plan_Equations.pdf
Path: UMass (Amherst) >> CC >> 61353 Fall, 2009
Description: FarmPlan Equations Cash Income Cash Expenses Net Cash Income Crop Inventory Change Livestock Inventory Change Supplies Inventory Change Accounts Receivable Change Accounts Payable Change Accrued Interest Change Depreciation Accrued Net Income Accrued...
Date Added: 2009-04-24 23:03:06

stat946syllabus.pdf
Path: W. Alabama >> STAT >> 946 Fall, 2009
Description: UNIVERSITY OF WATERLOO STAT 946 Winter 2009 Kernels and Ensembles Mu Zhu, PhD Associate Professor Description The support vector machine and the AdaBoost algorithm have spawned a wave of research in statistical machine learning. This course will focu...
Date Added: 2009-04-24 23:03:54

PSYC303D01.TXT
Path: Sveriges lantbruksuniversitet >> PSYC >> 19993 Fall, 2009
Description: Sheet1 PROFILE OF STUDENTS IN SFU COURSES COURSE: PSYC 303-4 D01 TITLE: PERCEPTION SEMESTER: 1999-3 LOCATION: SFU SECTION TYPE: LEC ENROL: 55 = PROGRAM OF STUDENT (Top 5 programs reported in each category Programs with < 3 students not shown separat...
Date Added: 2009-04-24 23:05:47

11_LTWT_3.pdf
Path: Sveriges lantbruksuniversitet >> ENSC >> 424 Fall, 2009
Description: ENSC 424 - Multimedia Communications Engineering Lapped Transform and Wavelet Transform 3 Jie Liang Engineering Science Simon Fraser University JieL@sfu.ca J. Liang: SFU ENSC 424 11/14/2005 1 Outline Nobel Identity Polyphase Format Wavelet and its L...
Date Added: 2009-04-24 23:06:41

chem218d01.txt
Path: Sveriges lantbruksuniversitet >> CHEM >> 19972 Fall, 2009
Description: PROFILE OF STUDENTS IN SFU COURSES COURSE: CHEM 218-3 D01 LOCATION: SFU TITLE: ANALYTICAL CHEMISTRY SECTION TYPE: LEC SEMESTER: 1997-2 ENROL: 46...
Date Added: 2009-04-24 23:07:25

security.pdf
Path: Arkansas Little Rock >> CS >> 391 Fall, 2009
Description: Database Security Database Security Models discretionary access control mandatory access control Security in statistical databases Classification of Secured Databases Encryption CMPUT 391 8 Security and Authorization 8-1 Discretionary Security...
Date Added: 2009-04-24 23:07:55

8c_IFT785_Actors_ABCL.ppt
Path: Rush >> IFT >> 785 Fall, 2009
Description: ABCL/1 ABCL\\1 Actor More Based Concurrent Language pragmatic approach than ACTORS Types of Message Passing in ABCL Message sending order from one object to another is preserved in ABCL. Three types of message passing mechanisms Past Non-...
Date Added: 2009-04-24 23:09:24

1981rcs1-401.pdf
Path: Neumont >> EN >> 1981 Fall, 2009
Description: R.C.S COMM EMPLO ET IMMIGRATION MACDONALD TOBACCO 401 Employment and Immigration Commission Canada Appellant and of MacDonald Tobacco and Inc Respondent Her Majesty The Queen Mis 1981 March 18 1981 April en cause Present and Laskin Ci...
Date Added: 2009-04-24 23:09:25

1981rcs1-401.pdf
Path: Neumont >> CSC >> 1981 Fall, 2009
Description: R.C.S COMM EMPLO ET IMMIGRATION MACDONALD TOBACCO 401 Employment and Immigration Commission Canada Appellant and of MacDonald Tobacco and Inc Respondent Her Majesty The Queen Mis 1981 March 18 1981 April en cause Present and Laskin Ci...
Date Added: 2009-04-24 23:09:25

ws.pdf
Path: Maple Springs >> CSE >> 6421 Fall, 2009
Description: Winter 2007 COSC-6421: Advanced Databases-Godfrey p. 1 Ground Transformation The ground transformation DBG of DB is defined as follows: for each clause C in DB for each grounding substitution from the variables of C to constants in LDB add clau...
Date Added: 2009-04-24 23:10:32

T5_82.pdf
Path: Virgin Islands >> MECH >> 141 Fall, 2009
Description: 5-82. Determine the tension in the cables and the components of reactions acting on the smooth collar at A necessary to hold the 50 lb sign in equilibrium. The center of gravity for the sign is at G. ...
Date Added: 2009-04-24 23:11:01

Rxn3Outline.doc
Path: Toledo >> SOC >> 394 Fall, 2009
Description: SOC 394 Y1: Urban Health in Toronto - Class Outline for Friday October 8, 2004 Clarifying the Many Determinants of Neighbourhood Health: A Theoretical Review themes: upstream and downstream approaches; proximal causes; approaches to disease preventio...
Date Added: 2009-04-24 23:11:07

formabe395-3.pdf
Path: Air Force Academy >> ABE >> 395 Fall, 2009
Description: Form # ABE 395-3 APPROVAL FOR PROJECT EXPENDITURES (ABE 395.3 and ABE 495.3) (RETAINED BY FACULTY ADVISOR(S) PROJECT NUMBER: _ NAME OF STUDENT(S):_ DETAILS OF EXPENDITURE: _ _ __ _ _ ESTIMATED EXPENDITURE: __ APPROVAL-FACULTY ADVISOR(S):_ * PROJECT ...
Date Added: 2009-04-24 23:13:29

mmpl-lecture-36.pdf
Path: East Los Angeles College >> EMAT >> 10004 Fall, 2009
Description: Section 8: Differential equations Differential equations are central to all of engineering: used to describe anything that moves or changes Lots of examples pendulum, angular position , mass m, length l d2 l 2 = g sin dt small deections w of a ...
Date Added: 2009-04-24 23:13:59

Ch2.pdf
Path: Air Force Academy >> P >> 812 Fall, 2009
Description: Chapter 2 Electrostatics II. Potential Boundary Value Problems 2.1 Introduction (r) and consequent r for a given static charge distribution (r): In a system involving conductor is speci.ed on electrode surfaces and one is asked to .nd the po- In Ch...
Date Added: 2009-04-24 23:14:54

v04-n279.txt
Path: Air Force Academy >> STA >> 575 Fall, 2009
Description: From: owner-cdn-firearms-digest@sfn.saskatoon.sk.ca on behalf of Cdn-Firearms Digest [owner-cdn-firearms-digest@sfn.saskatoon.sk.ca] Sent: Tuesday, 13 November, 2001 16:32 To: cdn-firearms-digest@broadway.sfn.saskatoon.sk.ca Subject: Cdn-Firearms Dig...
Date Added: 2009-04-24 23:15:09

CHEM286D04.TXT
Path: Sveriges lantbruksuniversitet >> CHEM >> 20003 Fall, 2009
Description: Sheet1 PROFILE OF STUDENTS IN SFU COURSES COURSE: CHEM 286-2 D04 LOCATION: SFU TITLE: ORGANIC CHEM LAB II SECTION TYPE: LAB SEMESTER: 2000-3 ENROL: 33 = PROGRAM OF STUDENT (Top 5 programs reported in each category Programs with < 3 students not shown...
Date Added: 2009-04-24 23:16:38

D0_Conference_Database.pdf
Path: Sveriges lantbruksuniversitet >> D >> 02005 Fall, 2009
Description: Brad Abbott babbott@fnal.gov Mark Adams adams@uic.edu Todd Adams tadams@hep.fsu.edu Mathieu Agelou magelou@hep.saclay.cea.fr Miruna Anastasoaie miruna@fnal.gov Lucian-Stefan Ancu lucian@hef.ru.nl Stefan Anderson sanderso@fnal.gov Bernard Andrieu andr...
Date Added: 2009-04-24 23:16:42

lec21x.pdf
Path: Toledo >> CSC >> 412 Fall, 2009
Description: HMM Junction Tree Lecture 21: Junction Tree Derivation of HMM Inference Cliques of moralized-triangulated: (qt, qt+1) and (qt, yt). Many maximal spanning trees, so many junction trees. For standard algorithms, select this one: ( q0 , y0 ) ( q0 , ...
Date Added: 2009-04-24 23:17:43

EC115-1_outline.pdf
Path: East Los Angeles College >> EC >> 115 Fall, 2009
Description: UNIVERSITY OF ESSEX Session 200809 DEPARTMENT OF ECONOMICS SANNA NURMIKKO (Autumn) DOMENICO TABASSO (Spring) EC115 Methods of Economic Analysis Reading List and Course Outline Details of assessment and submission deadlines are contained in the Unde...
Date Added: 2009-04-24 23:17:48

UNIT5-ANTENATAL-BLOCK1.pdf
Path: East Los Angeles College >> MME >> 102 Fall, 2009
Description: UNIT 5 Structure 5.0 5.1 5.2 5.3 5.4 5.5 Objectives Introduction MEDICAL TERMINATION OF PREGNANCY History and Definition Guidelines for MTP Selection of a Patient Methods of First Trimester Pregnancy Termination 5.5.1 5.5.2 Medical Methods Surgical...
Date Added: 2009-04-24 23:21:41

BITSC481_09-10.pdf
Path: East Los Angeles College >> BITSC >> 481 Fall, 2009
Description: Today\'s Menu Network Applications File Transfer-FTP DNS FTP: the file transfer protocol FTP FTP user client interface local file system file transfer FTP server remote file system user at host Transfer file to/from remote host Client/server model ...
Date Added: 2009-04-24 23:22:38

dual1.ppt
Path: East Los Angeles College >> AAOC >> 222 Fall, 2009
Description: Dual Problem of an LPP Given a LPP (called the primal problem), we shall associate another LPP called the dual problem of the original (primal) problem. We shall see that the Optimal values of the primal and dual are the same provided both have finit...
Date Added: 2009-04-24 23:22:57

midterm2003.pdf
Path: McGill >> PHYSICS >> 559 Fall, 2009
Description: Advanced Statistical Mechanics PHYS 559 50-minute Midterm Class Test, October 17th, 2003 1. In the sky of the distant !Dog-zar planet in a galaxy far far away, a simple pendulum of length , mass m, and color fuchsia is hung. The gravitational constan...
Date Added: 2009-04-24 23:23:56

lecture4.pdf
Path: Allan Hancock College >> CITS >> 3241 Fall, 2009
Description: 4 ,t\\ 5w era,wp6\' -fWttn+;*t is j^ i* - (r*q) b t toy tl^t- -MaJnT \' q a. uqTx J , J L 4 i\' + b.i ( cl T w n s ( a , \\ c )= t I o o o c I t l L o a ,.J., lra\"sl,&t!. {i \\ ( t o o a I l o ( o b l tM \'tl.uv- -4rts bq 2 Z J i l l \' \\ I: : : ...
Date Added: 2009-04-24 23:26:15

ERRATA.TXT
Path: UCLA >> CACHE >> 0019 Fall, 2009
Description: Sheet1 PDS_VERSION_ID = PDS3 RECORD_TYPE = STREAM OBJECT = TEXT PUBLICATION_DATE = 2005-05-06 NOTE = \"This file describes known errors or deficiencies in this archive volume set.\" END_OBJECT = TEXT END Users are encouraged to provide comments back to...
Date Added: 2009-04-24 23:27:41

lecture4.pdf
Path: Allan Hancock College >> CITS >> 2230 Fall, 2009
Description: Operating Systems 2230 Computer Science & Software Engineering Lecture 4: Hardware and Processes An Overview of Computer Hardware Any study of operating systems requires a basic understanding of the components of a computer system. Although the var...
Date Added: 2009-04-24 23:27:49

Midterm.pdf
Path: Allan Hancock College >> HB >> 315 Fall, 2009
Description: ANHB3315 Mid-term take-home essay Drawing on material from lectures and readings describe the role of the infant-mother attachment process - including its developmental consequences - in the positive feedback loops that characterized hominid evolutio...
Date Added: 2009-04-24 23:28:14

lineq_R.txt
Path: Allan Hancock College >> ATT >> 20491 Fall, 2009
Description: lineq <- function(a){ r <- rep(NA,14) v <- a[1] O1 <- a[2] O2 <- a[3] O0 <- v*O1 + (1-v)*O2 r <- rep(-1,14) kount <- 0 while (any(r < 0) { kount <- kount + 1 x <- runif(7) U0 <- x[1] U1 <- x[2] U2 <- x[3] q0 <- x[4] q1 <- x[5] q2 <- x[6] p <- x[...
Date Added: 2009-04-24 23:28:31

whole.txt
Path: Allan Hancock College >> ATT >> 27580 Fall, 2009
Description: UPN STATP SURVP STATNRMP STATREP STATEFP SURVEFP AGEBMT_med AGEBMT_dec SEX DXCODE DX1 DXBMT? STAGEGRP BSYMDX BMINVDX PS IPIGROUP INITXGRP PRIXRT INICHEMO PRIPURAN PRIRITU PRICHOP PRICHEMO PRIRESP DXBMTMON CON1_3 CON1_2 STATUS 318 1 41 1 0 1 41 0 ...
Date Added: 2009-04-24 23:28:33

Lec21.pdf
Path: Allan Hancock College >> ELEC >> 519 Fall, 2009
Description: ELEC4410 Control Systems Design Lecture 21: Design Considerations Julio H. Braslavsky julio@ee.newcastle.edu.au School of Electrical Engineering and Computer Science The University of Newcastle The University of Newcastle Lecture 21: Design Consi...
Date Added: 2009-04-24 23:28:46

10-Farsite.pdf
Path: Allan Hancock College >> CS >> 9242 Fall, 2009
Description: Federated, Available, and Reliable Storage for an Incompletely Trusted Environment Atul Adya, Bill Bolosky, Miguel Castro, Gerald Cermak, Ronnie Chaiken, John Douceur, Jon Howell, Jay Lorch, Marvin Theimer, Roger Wattenhoffer Project Goal Build a sc...
Date Added: 2009-04-24 23:30:34

car200312003n165325.txt
Path: Allan Hancock College >> CAR >> 200312003 Fall, 2009
Description: CRIMES AMENDMENT REGULATIONS 2003 (NO. 1) 2003 NO. 165 CRIMES AMENDMENT REGULATIONS 2003 (NO. 1) 2003 NO. 165 - TABLE OF PROVISIONS 1. Name of Regulations 2. Commencement 3. Amendment of Crimes Regulations 1990 SCHEDULE 1 Amendment...
Date Added: 2009-04-24 23:33:05

108.1.battles.pdf
Path: Allan Hancock College >> V >> 108 Fall, 2009
Description: 102 Journal of English and Germanic Philology, January 2009 collection set for future studies in the field. As a whole, the essays draw on an impressive range of scholarly expertise and represent an exemplary achievement in interdisciplinary studie...
Date Added: 2009-04-24 23:33:53

48.2.platt.pdf
Path: Allan Hancock College >> V >> 048 Fall, 2009
Description: SEL 48, 2 Platt Peter G. (Spring 2008): 443517 ISSN 0039-3657 443 443 Recent Studies in Tudor and Stuart Drama PeTeR G. PlaTT All of what youve heard is true. I did buy an extra bookcase. The review did take over my life. Friends and familyand esp...
Date Added: 2009-04-24 23:34:00

CapstoneProjectAssessment2.doc
Path: Rose-Hulman >> CSSE >> 221 Fall, 2009
Description: Capstone Project Names of Team Members: Project Title: _(10 points) Executive Summary: Does it include all the required information? i.e. Problem Statement Implemented Solution Statement Discussion of implemented features Discussion of non-implemente...
Date Added: 2009-04-24 23:45:04

270_120091_1003009_C.doc
Path: University of Illinois, Urbana Champaign >> FSDB >> 270 Fall, 2009
Description: UNIVERSITY OF ILLINOIS AT URBANA-CHAMPAIGN College of Business DEPARTMENT OF FINANCE FINANCE 300: Financial Markets Spring 2009, Sections C&D (10:00am 11:20am and 11:30am 12:50pm), 241 Wohlers Instructor: Professor Z. Jay Wang Office: 463 Wohle...
Date Added: 2009-04-24 23:46:48

rgb.txt
Path: St. Francis IL >> STAT >> 472 Fall, 2009
Description: Colours known to GrapphApp (\"name\", {red,green,blue} \"AliceBlue\", {240,248,255}, \"AntiqueWhite\", {250,235,215}, \"AntiqueWhite1\", {255,239,219}, \"AntiqueWhite2\", {238,223,204}, ...
Date Added: 2009-04-24 23:50:48

pb_ex5_1.txt
Path: UPenn >> VHM >> 882 Fall, 2009
Description: # Exercise 5.1 in Pinheiro - lme(weight~Time*Diet, data=BodyWeight, random=~Time) plot(fm1BW.lme, resid(.)~as.integer(Diet), abline=0) # (b) fm1BW.lme.het <- update(fm1BW.lme, weights=v...
Date Added: 2009-04-25 20:28:30

bme340s_2006_exam.pdf
Path: Toledo >> BME >> 340 Fall, 2009
Description: ...
Date Added: 2009-04-25 20:29:56

gsa1999318.txt
Path: Allan Hancock College >> GSA >> 1999318 Fall, 2009
Description: GOVERNMENT SUPERANNUATION ACT 1999 No. 8 of 1999 Version incorporating amendments as at 15 August 2007 Government Superannuation Act 1999 - TABLE OF PROVISIONS Section Page PART 1-PRELIMINARY 1. Purpose 2. Commencement 3. Definitions 4. In...
Date Added: 2009-04-25 20:32:34

amar200112001n176469.txt
Path: Allan Hancock College >> AMAR >> 200112001 Fall, 2009
Description: AUSTRALIAN MILITARY AMENDMENT REGULATIONS 2001 (NO. 1) 2001 NO. 176 AUSTRALIAN MILITARY AMENDMENT REGULATIONS 2001 (NO. 1) 2001 NO. 176 - TABLE OF PROVISIONS 1. Name of Regulations 2. Commencement 3. Amendment of Australian Military Regu...
Date Added: 2009-04-25 20:32:56

266Daily.pdf
Path: Purdue >> MA >> 266 Summer, 2001
Description: Summer 2006 MA 266 Monday 6/12 Tuesday 6/13 Lesson 1 HW due sect. 1.2 dfield6 6/19 Le...
Date Added: 2009-04-25 20:33:09

lect06.ppt
Path: Allan Hancock College >> CSE >> 1303 Fall, 2009
Description: Pointers,characters andgrouping LectureB06 LecturenotessectionB06 04/24/09 CSE1303PartBlecturenotes 1 Lasttime Byteorder bitwiseoperations AND,OR,NOT,XOR masking shifting relationshiptomultiplicationanddivision rightshifts 04/24/09 CSE13...
Date Added: 2009-04-25 20:36:04

cse460-5b.pdf
Path: Allan Hancock College >> CSE >> 460 Fall, 2009
Description: Quadratic Programming max/min v x where v v f ( x ) subject to C( x ) v f ( x ) = f (x1,K x n ) is a quadratic function f : R n R and v C( x ) = c1 (x1,K x n ) K c k (x1,K, x n ) is a conjunction of linear constraints c i of forms f i (x1,K, x n )...
Date Added: 2009-04-25 20:36:17

ims2102_2005_lc02.pdf
Path: Allan Hancock College >> IMS >> 2603 Fall, 2009
Description: Revision IMS2102 Information Management 3 Earlier lecture looked at: Administrative issues Overview of topics Revision of some common terms Purpose of Information in some enterprises Lecture 2 More Introduction www.sims.monash.edu.au www.sims....
Date Added: 2009-04-25 20:36:57

5121-2008-sem1-topic4-part2.ppt
Path: Allan Hancock College >> LAW >> 5121 Fall, 2009
Description: Failureofconsiderationand Servicescases Plaintiffisinnocentparty. PcontractstobuildanewhouseforD. Startsworkandreachespointoffirst instalment. Drefusestopayinstalmentpricewhen tendered. 2ndservicesexample PcontractswithDtobuildnewcabine...
Date Added: 2009-04-25 20:37:47

CntntsL.pdf
Path: Allan Hancock College >> CSE >> 2330 Fall, 2009
Description: This is page xiii Printer: Opaque this Contents Foreword Preface Acknowledgments 1 Introduction 1.1 For whom is this book? . . . . . . . . 1.2 What is in the book? . . . . . . . . . 1.3 Do I need a computer for this book? Software . . . . . . . . ....
Date Added: 2009-04-25 20:38:42

recordingsheet.doc
Path: East Los Angeles College >> ZOOL >> 0376 Fall, 2009
Description: Recording Sheet (please complete one for each larval group) Collection Information Species: Small Tortoiseshell / Peacock (please circle appropriate) Number of Larvae Collected: .. Location of Collection Point: Place name . County.. Ordnance Surv...
Date Added: 2009-04-25 20:39:51

Chapter01.pdf
Path: Allan Hancock College >> FIT >> 2022 Fall, 2009
Description: Operating Systems: Internals and Design Principles, 6/E William Stallings Chapter 1 Computer System Overview Patricia Roy Manatee Community College, Venice, FL 2008, Prentice Hall Operating System Exploits the hardware resources of one or more pr...
Date Added: 2009-04-25 20:40:01

7079-2008-trim1-lec-week7-2008-letterwriting.ppt
Path: Allan Hancock College >> LAW >> 7079 Fall, 2009
Description: Professional legal writing an introduction Melissa Castan Law 7079 Drafting legal correspondence What does this letter really need to say? Mssrs JD Lawyers 200 Monash Street UNITOWN VIC 3999 24 February 2006 Dear Sirs Re: Purchase of Rabbit Hutch,...
Date Added: 2009-04-25 20:41:37

Bathymetry.pdf
Path: Allan Hancock College >> ERTH >> 3212 Fall, 2009
Description: The Bathymetry of Heron Reef Heron Island and Reef Heron Reef is located approximately 80km NE of Gladstone, Australia, at 23 26 31S, 151 54 47. It is one of the 14 reefs in the Capricorn Group at the southernmost end of the Great Barrier Reef (Figur...
Date Added: 2009-04-25 20:41:56

2006sem2mid-sem.pdf
Path: Allan Hancock College >> MATH >> 1052 Fall, 2009
Description: $ 65 3 2 \' )\'% # \" 74!010(0 cFdF009 lllllllllllllllllllllllllllllllllllllllllllllll b`Yb e b e` h e h iiiiiiiiiiiciiiiciii{ikg`yTb0Q&gfe $uB$0tTHwtQ n uuqHTeeti n $iup n RkH@|uHt0 ...
Date Added: 2009-04-25 20:42:43

geos427studyguide_2007.pdf
Path: Allan Hancock College >> GEOS >> 427 Fall, 2009
Description: MACQUARIE UNIVERSITY Department of Earth and Planetary Sciences GEOS427 PALAEOECOLOGY AND BIOGEOGRAPHY STUDY GUIDE 2007 WEB address: http:/www.es.mq.edu.au/courses/GEOS427 Introduction Communication Logistics Outline of Unit Assessment Written Assig...
Date Added: 2009-04-25 20:44:18

07asst3.pdf
Path: Allan Hancock College >> STAT >> 371 Fall, 2009
Description: 2007 Stat371/810 E1. Assignment 3. Assignment 3 is due in class on 28th of May 2007. The problems to solve are from Wackerly et al. 6th Edition. 1. Wackerly et al. Chapter 9. Exercise 9.15, p. 427 2. Wackerly et al. Chapter 9. Exercise 9.52, p. 441 ...
Date Added: 2009-04-25 20:44:33

pipaaoaab2006669.txt
Path: Allan Hancock College >> PIPAAOAAB >> 2006669 Fall, 2009
Description: Queensland Personal Injuries Proceedings (Legal Advertising) and Other Acts Amendment Bill 2006 Queensland Personal Injuries Proceedings (Legal Advertising) and Other Acts Amendment Bill 2006 Cont...
Date Added: 2009-04-25 20:45:10

MATH334_Guide_05.doc
Path: Allan Hancock College >> MATH >> 334 Fall, 2009
Description: Department of Mathematics Macquarie University MATH233 Mathematics II Advanced 2005 D1 MATH334 Mathematics III Advanced 2005 D1 Lecturers. Professor Paul SMITH E7A 402 (tel. 8944), pdsmith@maths.mq.edu.au Dr Elena VINOGRADOVA E7A 302 (tel. 8920), evi...
Date Added: 2009-04-25 20:45:14

Hints.pdf
Path: Allan Hancock College >> MATH >> 237 Fall, 2009
Description: COMMENTS AND HINTS FOR MATH237 PROJECT Let L denote the regular language (A + B + C) (0 + 1), and let M denote the collection of all strings that satisfy the parity property. We then need to design a nite state automaton that accepts precisely all t...
Date Added: 2009-04-25 20:45:24

lecture6.pdf
Path: Allan Hancock College >> COMP >> 170 Fall, 2009
Description: Network Commands remote login Equivalent to running a process on a remote machine For these commands you need an account on the remote host. For instance, external students with a home computer connected to the Internet can access their turing acc...
Date Added: 2009-04-25 20:45:59

Seminararchive.pdf
Path: East Los Angeles College >> THEO >> 0038 Fall, 2009
Description: Hilary Term 2007 Jan 18 Dr Kelly James Clark Reformed Epistemology and the Deliverances of Cognitive Science Jan 25 Prof Michael Marsh The Out-of-Body and Near-Death Experience Feb 8 Prof Magda Stavinschi Tradition and Crisis: religion and science in...
Date Added: 2009-04-25 20:46:36

assignments07.pdf
Path: Allan Hancock College >> STAT >> 300 Fall, 2009
Description: School of Mathematics, Statistics and and Computer Science Assignments Statistical Modelling - STAT300 Printed at the University of New England, May 9, 2007 i ii Approximate submission dates. The dates given are Mondays on which to post the assign...
Date Added: 2009-04-25 20:46:36

tele.txt
Path: Allan Hancock College >> CITA >> 405 Fall, 2009
Description: Lynch Barbara 0395641730 blynch@hcot.com.Au Kascamanidis Bill 0395641731 billk@acslink.com.Au Apps Tim 0395641732 tapps@hcot.com.Au Blain Jenny 0395641732 jblain@acslink.com.Au Wrobel John 0395641734 jwrobel@pcuser.com.Au Maine Leah 035641735 lmain@a...
Date Added: 2009-04-25 20:47:14

Copyright@Swinburne.ppt
Path: Allan Hancock College >> VBH >> 056 Fall, 2009
Description: Copyright and Multimedia Robin Wright Manager, Copyright & Digital Projects Material to be covered What is copyright? How does it work? Types of works protected Rights created Using copyright material in multimedia Questions What is Copyrigh...
Date Added: 2009-04-25 20:48:29

2008-postgrad-brochure.pdf
Path: Allan Hancock College >> BUSINESS >> 6553737 Fall, 2009
Description: www.uq.edu.au UQ BUSINESS SCHOOL POSTGRADUATE COURSEWORK PROGRAMS Postgraduate Coursework Programs ABOUT THE UNIVERSITY OF QUEENSLAND The largest and oldest university in Queensland, The University of Queensland (UQ) is one of Australias premier...
Date Added: 2009-04-25 20:49:21

Subquery.txt
Path: Allan Hancock College >> COMP >> 3420 Fall, 2009
Description: SQL> - Print the names and addresses of the customers SQL> - who buy only G and PG movies. SQL> SQL> SET FEEDBACK 1 SQL> SQL> SET LINESIZE 132 SQL> SET PAGESIZE 200 SQL> SQL> COLUMN CustomerAddress FORMAT A50 WORD_WRAPPED SQL> SQL> REPHEADER SKIP...
Date Added: 2009-04-25 20:49:56

Lect9a.pdf
Path: Allan Hancock College >> COMP >> 3320 Fall, 2009
Description: COMP3320/COMP6464: Post Risc, the Intel Family and beyond! Alistair Rendell See: High Performance Computing, Dowd and Severance, Appendix A Structured Computer Organization, Andrew S. Tanenbaum, Edition 4 COMP3320 Lecture 9-0 Copyright c 2008 The Au...
Date Added: 2009-04-25 20:52:04

Muller_Python_C.pdf
Path: Allan Hancock College >> COMP >> 3320 Fall, 2009
Description: Python Short Course Lecture 5: Extending Python Richard P. Muller Materials and Process Simulation Center Spring, 2000 Extending Python Python is great for rapid application development Little overhead in creating classes, functions, etc. Can be...
Date Added: 2009-04-25 20:52:05

C3.4u.pdf
Path: Allan Hancock College >> COMP >> 2300 Fall, 2009
Description: Pointers, Arrays and Structures Pointers as Parameters q passing a pointer as a parameter to a function allows the function to change the variable the pointer refers to q pointers: example, as parameters q dynamically allocated arrays q command li...
Date Added: 2009-04-25 20:52:22

1119Test1.pdf
Path: ECCD >> MATH >> 1119 Fall, 2009
Description: ...
Date Added: 2009-04-25 20:52:54

Lecture18.pdf
Path: Allan Hancock College >> ENGN >> 2228 Fall, 2009
Description: Lecture #18 Overview Line Codes Binary Digital Signalling In binary digital signalling the transmitted signal consists of a sequence consisting of two possible waveform pulses. One type of pulse represents a binary 1 and the other represents a binar...
Date Added: 2009-04-25 20:53:07

Lab6.doc
Path: Allan Hancock College >> ICT >> 219 Fall, 2009
Description: ICT 219 Intelligent Systems Laboratory 6 In this lab, we will learn how to simulate neural networks using the Java Neural Network Simulator. The JavaNNS manual is based on a manual concerning SNNS which you should read first from http:/www-ra.informa...
Date Added: 2009-04-25 20:55:32

ANOVA.pdf
Path: East Los Angeles College >> MATH >> 61004 Fall, 2009
Description: 11 ANOVA: testing many means at once This section is about a single test that asks whether all of a large number (well, more than two) of samples appear to have the same mean. Ill introduce it by way of an example. Example 11.1 A barmaid at the Bul...
Date Added: 2009-04-25 20:55:33

AttachIII-CourseProfile.doc
Path: Allan Hancock College >> IAF >> 20042006 Fall, 2009
Description: Charles Sturt University Educational Profiles 20042006 Attachment III Proposed changes to the Course Profile Page 1 (a) Course Profile The following variations to the CSU course profile are proposed for the 2004-2006 triennium. (i) Health Programs...
Date Added: 2009-04-25 20:56:51

html4-1.pdf
Path: East Los Angeles College >> CS >> 153 Fall, 2009
Description: HTML Forms Forms provide the means for gathering information from users who visit a Web page. Applications include user feedback, queries, E-commerce. Simple feedback and queries normally require the form data to be emailed to a specific email addre...
Date Added: 2009-04-25 20:57:39

assignment4_micro_sptial_plan_3099802.pdf
Path: Allan Hancock College >> BP >> 250 Fall, 2009
Description: MICRO SPATIAL PLAN FERIZAJ EXISTING ROAD CONDITION ROAD STATE RAILWAY NEW ROAD PROPOSAL ROAD STATE RAILWAY FUTURE CBD CORE AREA CBD ROAD STATE RAILWAY FUTURE BUSINESS DEVELOPMENT CBD PARK BUSINESS AREA ROAD STATE RAILWAY FUTURE BUSINESS DEV...
Date Added: 2009-04-25 20:59:27

linton_ex1_thurs.pdf
Path: Allan Hancock College >> BP >> 250 Fall, 2009
Description: FEDERATION SQUARE - LAB ARCHITECTS WAR MUSEUM - DANIEL LIBESKIND TODS BUILDING - TOYO ITO ARTS MEDIA CENTRE RHEINHAFEN - FRANK GEHRY ...
Date Added: 2009-04-25 20:59:31

Scanner.pdf
Path: Allan Hancock College >> ARTS >> 1002 Fall, 2009
Description: On a Projected Film of Philip K. Dicks A Scanner Darkly Adrian Heathcote (Intended for Black+White Magazine, 1997) ou are reading this magazine. Something catches your attention at the corner of your eye, a sliver of something not right, something t...
Date Added: 2009-04-25 21:01:28

Sampling6.pdf
Path: Allan Hancock College >> ISYS >> 3015 Fall, 2009
Description: Population, sample and individual cases Selecting samples Week 5 Lecture 2 Friday, Apr 15, 2005 1 Friday, Apr 15, 2005 4 Agenda Basic sampling concepts Probability sampling Non-probability sampling Why sample? Save time and money (study of who...
Date Added: 2009-04-25 21:01:47

tutwk02.pdf
Path: Allan Hancock College >> MATH >> 1003 Fall, 2009
Description: The University of Sydney Math1003 Integral Calculus and Modelling Semester 2 Exercises for Week 2 2008 Assumed Knowledge: Sigma notation for sums. The ideas of a sequence of numbers and of the limit of a sequence. Sketching a curve given a functi...
Date Added: 2009-04-25 21:02:28

domainmodel2.pdf
Path: Allan Hancock College >> COMP >> 5028 Fall, 2009
Description: Domain Model Lecture 3 August 10, 2005 1 Agenda Case Requirements Elaboration process Domain model Introduction and definition How to create a domain model Refine domain model COMP5028 Object-Oriented Analysis and Design (S2 2005) Dr. Ying Zhou...
Date Added: 2009-04-25 21:03:05

lecture04-2-08.pdf
Path: Allan Hancock College >> COMP >> 5426 Fall, 2009
Description: Network-Based High Performance Computing Analytical Modeling of Parallel Systems (cont.) Scalability of Parallel Systems How do we extrapolate performance from small problems and small systems to larger problems on larger configurations? Consider th...
Date Added: 2009-04-25 21:03:10

LOLITA.ppt
Path: Allan Hancock College >> ENGL >> 2627 Fall, 2009
Description: Nabokov Moved to US 1940, trilingual since childhood: Serious Lepidopterist (butterflies) Lecturer in Comparative Literature: Wellesley 1941-48, Cornell 1948-58 Translator & Editor of Pushkin Publication History Olympia Press, Maurice Girodias, ...
Date Added: 2009-04-25 21:03:59

Ass_1_Winter_2001_TicTacToe.doc
Path: Allan Hancock College >> WIN >> 11134 Fall, 2009
Description: Assignment 1 : Tic Tac Toe Due Date : Weighting : Start Work : Workload : Friday of Week 7. 10% of your overall mark. It is highly recommended that you start work on this assignment at least 3 weeks prior to the due date. 250 lines of C+ Code (approx...
Date Added: 2009-04-25 21:05:49

lectureweek06.ppt
Path: Allan Hancock College >> COIT >> 29222 Fall, 2009
Description: #D#lectureweek06.ppt# =ml# #)ttiF,S6EQ,#M}#F#9v#xK uo vIZMa#n4nZmaqPG5A`I#Zh#hk#E # G`H#fg{of yq3e=D>#[Y#k# )9|.SB8>E| >t#P=s#jwCM#orr/# # #2R4rW#`#p1t=#e Kw#[Q|#^8 ]#`#q Q| zqc#)SaU: *brW#f =b#J\\\'#:#yf# #Ex D#2uO~Z( {K9#Fw#,kQ.S#!# EYL#^#)ci~...
Date Added: 2009-04-25 21:06:18

ECE493T2_Tutorial9.pdf
Path: W. Alabama >> ECE >> 493 Fall, 2009
Description: Tutorial 9 Derek Wright Wednesday, March 16th, 2005 Mass Storage Devices Storage Principles Hard Disk Drives Magneto-Optical Discs Compact and Digital Versatile Discs AFM Based Mass Storage Storage Principles Classified by type: Prewritten ...
Date Added: 2009-04-25 21:08:02

fhsar20061n205o2006570.txt
Path: Allan Hancock College >> FHSAR >> 20061 Fall, 2009
Description: EXPLANATORY STATEMENT Select Legislative Instrument 2006 No. 205 Issued by Authority of the Minister for Agriculture, Fisheries and Forestry Farm Household Support Act 1992 ...
Date Added: 2009-04-25 21:08:10

green01.pdf
Path: Allan Hancock College >> MATH >> 3403 Fall, 2009
Description: Application to Circles apr University of Queensland Green\'s Functions Green\'s Functions p.1/11 Green\'s function for a circle (r = a) xb d x0 d 0 d d x0 =Const 1 1 1 2 2 G(x, x0 ) = ln |x - x0 | - ln |x - x0 | - ln k 4 4 4 If we choose |x0 |...
Date Added: 2009-04-25 21:08:48

ans8.pdf
Path: East Los Angeles College >> MA >> 210 Fall, 2009
Description: MA 210 DIFFERENTIAL EQUATIONS II Solutions Exercise Sheet 8: PDE\'s: separation of variables 1. (a) Let y(x, t) = X(x)T (t), so 1T X = 2 = X c T X - X = 0 Using X(0) = 0 and X(l) = 0 = - Thus Xn (x) = An sin nx l nct nct Tn (t) = Bn sin + Cn cos l...
Date Added: 2009-04-25 21:12:27

MG_4.pdf
Path: Allan Hancock College >> MATH >> 1070 Fall, 2009
Description: \" ! # % ! ! +, $ ! \" $( # %) $- . . ! ! 1 ! ! $ ! 4 5$ 6\' $ $ 8 $ 9 $ -: $ # ! # !# \' $ ! ! 6 1 $ 0 ; \'$ < ! \' . !\' # \'...
Date Added: 2009-04-25 21:12:45

Continuing-Studies.pdf
Path: East Los Angeles College >> FULLTIME >> 0809 Fall, 2009
Description: Continuing Studies Independent Living Skills Continuing Education Studies Learning for Independence 16 to 25 Provision (Transitional) Skills for Working Life BTEC Certicate Certicate in Life Skills 58 58 59 59 60 60 C ontinuing Studies offers co...
Date Added: 2009-04-25 21:14:04

07n1897.pdf
Path: Allan Hancock College >> N >> 1851 Fall, 2009
Description: ISO/IEC JTC1/SC7 Software Engineering Secretariat: CANADA (SCC) ISO/IEC JTC1/SC7 N1897 1998-04-27 Doc. Type Title Source Project Status References Action ID Due Date Mailing Date Distribution Medium No. of Pages Note BPG/AG Meeting Agenda Draft Ag...
Date Added: 2009-04-25 21:14:14

07n1897.pdf
Path: Allan Hancock College >> SC >> 1851 Fall, 2009
Description: ISO/IEC JTC1/SC7 Software Engineering Secretariat: CANADA (SCC) ISO/IEC JTC1/SC7 N1897 1998-04-27 Doc. Type Title Source Project Status References Action ID Due Date Mailing Date Distribution Medium No. of Pages Note BPG/AG Meeting Agenda Draft Ag...
Date Added: 2009-04-25 21:14:14

07n2590.pdf
Path: Allan Hancock College >> N >> 2551 Fall, 2009
Description: ISO/IEC JTC1/SC7 Software JTC1...
Date Added: 2009-04-25 21:14:15

07n2590.pdf
Path: Allan Hancock College >> SC >> 2551 Fall, 2009
Description: ISO/IEC JTC1/SC7 Software JTC1...
Date Added: 2009-04-25 21:14:15

ws5sols.pdf
Path: Allan Hancock College >> STAT >> 501 Fall, 2009
Description: STAT501 Multivariate Analysis Workshop 5 The data in Table 1 gives nancial ratios for a sample of 24 rms, the 12 mostadmired rms and the 12 leastadmired rms. The nancial ratios are : EBITASS, earnings before interest and taxes to total assets, and RO...
Date Added: 2009-04-25 21:15:53

macb2007333.pdf
Path: Allan Hancock College >> MACB >> 2007333 Fall, 2009
Description: 2004-2005-2006-2007 The Parliament of the Commonwealth of Australia HOUSE OF REPRESENTATIVES Presented and read a first time Migration Amendment (Maritime Crew) Bill 2007 No. , 2007 (Immigration and Citizenship) A Bill for an Act to amend the Mig...
Date Added: 2009-04-25 21:16:44

quiz1.pdf
Path: Purdue >> MA >> 153 Fall, 2003
Description: Ma 153 Fall 2006 Quiz I 1. A teacher has 30 children in her class. They hold an election for class president. Each student is a candidate, each student must vote, and a student is not allowed to vote for himself or herself. A student named Mary recei...
Date Added: 2009-04-25 21:18:06

3506Slides-4-3.pdf
Path: Allan Hancock College >> COMP >> 3506 Fall, 2009
Description: Week 4 - Linear Structures COMP3506 / 7505 Algorithms and Data Structures Week 4 Linear Structures Lecture 1 Exhibition Day Lecture 2 Array-based Linear Structures Lecture 3 Link-based Linear Structures Lecture Overview Singly linked list...
Date Added: 2009-04-25 21:19:06

TA2001CMMLigation.pdf
Path: East Los Angeles College >> DPLB >> 0149 Fall, 2009
Description: TETRAHEDRON: ASYMMETRY Pergamon Tetrahedron: Asymmetry 12 (2001) 249261 Expanding the utility of proteases in synthesis: broadening the substrate acceptance in non-coded amide bond formation using chemically modied mutants of subtilisin Kanjai Khum...
Date Added: 2009-04-25 21:22:03

week8_examanswers.pdf
Path: Allan Hancock College >> CHEM >> 1904 Fall, 2009
Description: CHEM1902/4 2004-N-4 November 2004 Marks Teeth are made from hydroxyapatite, Ca5(PO4)3OH. Why does an acidic medium promote tooth decay and how can the decay be stopped using fluoridation of drinking water? Use chemical equations where appropriate...
Date Added: 2009-04-25 21:24:40

quiz1B-2006.pdf
Path: Allan Hancock College >> MATH >> 2069 Fall, 2009
Description: THE UNIVERSITY OF SYDNEY MATH2069/2969 DISCRETE MATHEMATICS Semester 1 Quiz 1B 2006 Name (with surname underlined): Student No.: Circle one of: MATH2069 MATH2969 This quiz lasts 35 minutes and is worth 30 marks. 1+z 1 - 3z + 2z 2 A B + . 1-z 1 ...
Date Added: 2009-04-25 21:25:47

reliab3.pdf
Path: East Los Angeles College >> STAT >> 353 Fall, 2009
Description: SECTION 3 RELIABILITY 3.1 INTRODUCTION When manufacturers claim that their products are very reliable they essentially mean that the products can function as required for a long period of time, when used as specified. In order to assess and improv...
Date Added: 2009-04-25 21:26:42

definition.pdf
Path: Charleston Law >> MA >> 100 Fall, 2009
Description: Definitions INFLATION is a persistent rise over time in the average price of goods and servicesin the \"cost of living.\" It also represents a decline in the real value of money a loss of purchasing power per dollar, i.e. a loss in the amount of value...
Date Added: 2009-04-25 21:29:27

Exam3.pdf
Path: CSU San Marcos >> EXAMS >> 201 Fall, 2009
Description: Exam #3 (100 Points) Economics 201[F03] Introduction to Microeconomics Professor Shawn Humphrey I. Multiple Choice Questions (2 points each/10 points total): 1. When goods are available in an economy free of charge a. the good will be overused. b. to...
Date Added: 2009-04-25 21:30:01

HOMEWORK-math262-spring2006.pdf
Path: CSU Northridge >> RD >> 1955 Fall, 2009
Description: Homework Assignments and Chapter Reading for MATH 262, Spring 2006 Week 1 2 3 4 5 6 7 8 9 11 11 12 13 14 15 16 17 Date 1/ 30 2/ 01 2/06 2/08 2/13 2/15 2/20 2/22 2/27 3/01 3/06 3/08 3/13 3/15 3/20 3/22 3/27 3/29 4/03 4/05 4/10 4/12 4/17 4/19 4/24 4/26...
Date Added: 2009-04-25 21:30:55

Chapter5.pdf
Path: UNF >> CHEM >> 2045 Fall, 2009
Description: Chapter 5 Thermochemistry Thermochemistry is an aspect of thermodynamics involving the study of the relationships between chemical reactions and energy changes involving heat. Work Energy used to cause an object that has mass to move. w=F d Heat E...
Date Added: 2009-04-25 21:32:48

chapter6.pdf
Path: CSU Northridge >> KKD >> 61657 Fall, 2009
Description: NOTES OUTLINE FOR ASSIGNED PAGES OF CHAPTER 6 I. RACIAL HARASSMENT a. [\"hostile work environment\" created when conduct regarding a protected category, like race or sex, is severe and pervasive so that it makes it more difficult than not to work in th...
Date Added: 2009-04-25 21:33:38

pp9.pdf
Path: Maple Springs >> MATH >> 481 Fall, 2009
Description: 481/580 Practice Problems 7 : Bayesian Inference 1. Lets look more carefully at the Beta prior / Bernoulli likelihood example. If we choose the Beta(1,1) as our prior on the Bernoulli parameter, then we have chosen a non-informative prior - ie. it p...
Date Added: 2009-04-25 21:33:41

Homology_and_Analogy_FAQ.pdf
Path: SEMO >> BI >> 151 Fall, 2009
Description: Homology and Analogy FAQ If two organisms aren\'t related, any similarity between them has to be an analogy (or maybe just chance). If two organisms are related, they may show both homologies and analogies. If a similarity between two organisms i...
Date Added: 2009-04-25 21:35:32

pac10.pdf
Path: SPSU >> ECET >> 6002 Fall, 2009
Description: ispPAC 10 In-System Programmable Analog Circuit Features IN-SYSTEM PROGRAMMABLE (ISP) ANALOG CIRCUIT Four Instrument Amplifier Gain/Attenuation Stages Signal Summation (Up to 4 Inputs) Precision Active Filtering (10kHz to 100kHz) No External C...
Date Added: 2009-04-25 21:36:42

227f08Chptr10.pdf
Path: George Mason >> HONORS >> 227 Fall, 2009
Description: Honors 227 Fall 2008 Chapter 10 Atoms in Combination: The Chemical Bond Presented by Prof. Geller Atoms in Combination: The Chemical Bond Chapter 10 Great Idea: Atoms bind together in chemical reactions by the rearrangement of electrons Chapter Ou...
Date Added: 2009-04-25 21:38:38

Geog5011Munit3.pdf
Path: East Los Angeles College >> GEOG >> 5015 Fall, 2009
Description: Geog5011M Principles of GIS Unit 3 Notes Spatial Data Models The aims of this unit are to: define the characteristics of geographical data introduce different types of spatial data model introduce the structure of spatial data, and compare the di...
Date Added: 2009-04-25 21:40:01

week6.pdf
Path: East Los Angeles College >> COMP >> 202 Fall, 2009
Description: Connectivity information Connectivity information is present, e.g., in city maps, where the objects are roads, and also in the routing tables for the Internet, when the objects are computers. Connectivity information is also present in the parent chi...
Date Added: 2009-04-25 21:41:11

Sample_Project.pdf
Path: UCF >> FIN >> 4514 Fall, 2008
Description: Sample Worksheet Project 1 Mean, Standard Deviation, and Covariance Matrix for ETF\'s SPY MDY IWM TLT IYR SPY 0.000983 0.000973 0.001187 -0.00022366 0.00067078 MDY 0.000973 0.001223 0.001497 -0.00022576 0.000911195 IWM 0.001187 0.001497 0.002 -0.00032...
Date Added: 2009-04-25 21:41:42

CP2exercise05.pdf
Path: East Los Angeles College >> CP >> 0607 Fall, 2009
Description: CP2 Exercise 5 1. 20/11/2006 Modify exercise 2 (part c) from last week to use a singly linked list (nodes added to the tail of the list) instead of an array to store the dates data. Use a linked list structure similar to this one: typedef struct _n...
Date Added: 2009-04-25 21:41:44

Midterm1-f99.pdf
Path: Berkeley >> EE >> 141 Fall, 2008
Description: University of California College of Engineering Department of Electrical Engineering and Computer Science J. M. Rabaey B. Nikolic TuTh9:30-11am ee141@eecs EECS 141: FALL 99 - MIDTERM 1 For all problems, you can assume the following transistor para...
Date Added: 2009-04-25 21:42:44

ex09.pdf
Path: East Los Angeles College >> EC >> 371 Fall, 2009
Description: U NIVERSITY OF E SSEX Session 200809 D EPARTMENT OF E CONOMICS R. E. Bailey EC371 Economic Analysis of Asset Prices Exercise 9: Intertemporal Choice and the Equity Premium Puzzle 1. Explain and justify the Fundamental Valuation Relationship for an ...
Date Added: 2009-04-25 21:44:38

08-01-17.pdf
Path: East Los Angeles College >> AW >> 548 Fall, 2009
Description: CAR Complexity 17 Jan 08 Generally the more hardware you make, the slower it gets done. Just because of propagation delay. If a pathway takes 25ns, then you can do 40 million operations per second 40 MHz. Also, generally adding a new instruction s...
Date Added: 2009-04-25 21:46:01

modifiedexam1review.pdf
Path: University of Illinois, Urbana Champaign >> LIFE >> 240 Fall, 2009
Description: MCB 240: Review sheets for Exam 1 MCB/Physiology 240. Spring 09 Review Questions for Exam 1 (Wed Feb 11, 7-9 p.m.) Please note that in this first exam of the semester, there will be 60 multiple-choice questions (worth 180 points) and 10 fill-in (wor...
Date Added: 2009-04-25 21:48:29

meaningofought.a4.pdf
Path: East Los Angeles College >> MERT >> 1230 Fall, 2009
Description: THE MEANING OF OUGHT Ralph Wedgwood What does the word ought mean? Strictly speaking, this is an empirical question, about the meaning of a word in English. Such empirical semantic questions should ideally be answered on the basis of extensive empi...
Date Added: 2009-04-25 21:49:11

2007SemiFinalistsandMentors.pdf
Path: East Los Angeles College >> NR >> 3322 Fall, 2009
Description: Ref 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 YBD Team Leader Kefa Mwangi Esther Karanja Alex Bunde Turyasingura Nuwasasira Mwololo Cosmas Masilo Oscar Kimani Emmanuel Lartey Emmanuel Br...
Date Added: 2009-04-25 21:51:18

p01.pdf
Path: East Los Angeles College >> M >> 0405 Fall, 2009
Description: MATH332: Problem set 1 Set 2004/09/28 ; Due 2004/10/05 1. In summer, growth of a phytoplankton population can be described by continuoustime Malthusian dynamics, with the reproduction rate rs day1 . The summer lasts ts days. Find the population size ...
Date Added: 2009-04-25 21:51:28

ch5.pdf
Path: East Los Angeles College >> CS >> 2092 Fall, 2009
Description: CS2092: Object Oriented Programming in Java Chapter 5: Visibility Issues C. C. Kirkham Visibility Apart from the occasional appearance of the words public and private I have avoided saying anything about this. It is a slightly complicated story, but...
Date Added: 2009-04-25 21:53:16

l11.pdf
Path: East Los Angeles College >> M >> 0405 Fall, 2009
Description: MATH332 Set 11 2004/11/02 Age structured populations cont\'d Example Let F0 = 0, F1 = F2 = 4, P1 = 3/4, P2 = 2/3. Leslie matrix: 0 0 L = 3/4 4 4 0 0 2/3 0 Characteristic equation: 3 - 3 - 2 = 0 Eigenvalues: {-1, -1, 2}. 1 Example ...
Date Added: 2009-04-25 21:53:19

web_appl_security.pdf
Path: Acton School of Business >> GW >> 4314 Fall, 2009
Description: Malicious Input Attacks on Web and other Applications Last updated: Tuesday, 01 May 2007 Prof. Amir Herzberg Computer Science Department, Bar Ilan University http:/AmirHerzberg.com 01/05/200704/10/06 http:/AmirHerzberg.com 1 Malicious Input Att...
Date Added: 2009-04-25 21:53:38

Belt_and_Tire_Tractive_Performance.pdf
Path: Virginia Tech >> BSESRV >> 214 Fall, 2009
Description: SAE TECHNICAL PAPER SERIES 972731 Belt and Tire Tractive Performance Frank M. Zoz John Deere Product Engineering Center Reprinted from: Belt and Tire Traction in Agricultural Vehicles (SP-1291) INTERNATIONAL The Engineering Society For Advancing...
Date Added: 2009-04-25 21:54:51

hw9.pdf
Path: UPenn >> CIS >> 610 Fall, 2009
Description: Homework IV (due March 17), Math 603, Spring 2003. (GJZ) B II(a). In this problem, we assume that A is a noetherian integral domain. Furthermore, in this question, A is a normal domain, not a eld. In this question, of course, we assume that a A is n...
Date Added: 2009-04-25 21:55:50

CIVL3206_2007_design_assignment_4_frame.pdf
Path: Allan Hancock College >> CIVL >> 3206 Fall, 2009
Description: School of Civil Engineering CIVL3206 Steel Structures 1: Semester 2, 2007 Design Assignment Submission 4 Frame Design Due: Wednesday 24 October, 9 am This assignment should be done either individually or in pairs (you may not have the same pair as ...
Date Added: 2009-04-25 21:59:28

FE2003Q5.pdf
Path: Allan Hancock College >> CIVL >> 3612 Fall, 2009
Description: 14 m TOTAL HEAD PIEZOMETRIC HEAD PUMP H note not at peak efficiency new operating operating point point Q ...
Date Added: 2009-04-25 21:59:40

homework2.pdf
Path: Penn State >> A >> 451 Fall, 2009
Description: Astro 451 Fall 2004 Problem Set 2 Distributed: 9/20/2004 Due: 9/27/2004 Probability and Statistics: Discrete Distributions Problem 1 [25 points] If an experiment has only two possible outcomes that can be described as a \"success\" or a \"failure\", ...
Date Added: 2009-04-25 22:01:35

lab8.pdf
Path: Syracuse >> CIS >> 252 Spring, 2008
Description: Lab 8: Higher-Order Patterns for Processing Lists Overview This lab will give you some practice with Haskell\'s higher-order functions map and filter. These generalize some idioms for list processing that we\'ve already seen. Caveat: While parts of thi...
Date Added: 2009-04-25 22:02:52

Stat516_Midterm2009_solution.pdf
Path: Iowa State >> STAT >> 516 Spring, 2008
Description: Statistics 516 Solutions for Midterm Exam Distribution of grades: Score 90 94 85 - 89 76 - 84 70 - 75 60 69 estimated letter grade A AB+ B Bcounts 3 1 5 3 1 1 of 9 1. [12 points] Choose the right answer among the choices A, B, C, and D. a) Wh...
Date Added: 2009-04-25 22:05:56

p10301.pdf
Path: LSU >> V >> 103 Fall, 2009
Description: Problem B Rings and Glue Input: standard input Output: standard output Time Limit: 1 second Memory Limit: 32 MB Little John is in big trouble. Playing with his different-sized (and colored!) rings and glue seemed such a good idea. However, the rings...
Date Added: 2009-04-25 22:05:56

HortHappenings26.pdf
Path: Iowa State >> NR >> 15412 Fall, 2009
Description: Horticulture Happenings An Iowa State University Extension Newsletter for Mid-Iowa Gardeners July 2005 Vol. 2 No. 6 In This Issue: Events Calendar.p.2 Recipe Corner.p.2 Canner Testing.p. 2 Meet a Master Gardener .p.3 Master Conservationist Training...
Date Added: 2009-04-25 22:07:04

l40.pdf
Path: Duke >> CPS >> 001 Fall, 2009
Description: Todays Topics Computer Science Noncomputability Upcoming Review Reading Great Ideas, Chapter 15 CPS 001 40.1 On the Limits of Computing Noncomputability Certain Problems Not Amenable to Computer Solution Examples given here may seem strained and...
Date Added: 2009-04-25 22:09:37

99-124-05386.pdf
Path: UCSB >> AP >> 9912405386 Fall, 2009
Description: FLIGHT SUMMARY REPORT Flight Number: 99-124 Calendar/Julian Date: 11 September 1999 254 Sensor Package: Wild Heerbrugg RC-10 Airborne Visible and Infrared Imaging Spectrometer (AVIRIS) Thematic Mapper Simulator (TMS) Southern California Coast Ar...
Date Added: 2009-04-25 22:14:03

solution12.pdf
Path: East Los Angeles College >> MATH >> 12001 Fall, 2009
Description: SOLUTIONS TO LAB 12: APPROXIMATION BY POLYNOMIALS (1) Find the Taylor polynomial TN of f at the point of expansion a where (a) f (x) = ex sin x, a = 0, N = 4. > T := convert(taylor(exp(x)*sin(x),x,5),polynom); > plot({T,exp(x)*sin(x)},x=-2.2); (b) ...
Date Added: 2009-04-25 22:14:28

aslantestpaper.pdf
Path: UCSB >> CS >> 266 Fall, 2009
Description: Aslantest: A Symbolic Execution Tool for Testing Asian Formal Specifications * Jef?ey Douglas Richard Reliable Department A. Kemnterer Software Group Science of Computer University of California Santa Barbara, CA 93106 Abstract This paper introduc...
Date Added: 2009-04-25 22:14:42

malware.pdf
Path: UCSB >> CS >> 177 Fall, 2009
Description: CMPSCI 177 Computer Security and Privacy Christopher Kruegel chris@cs.ucsb.edu Malicious Code Overview Introduction to malicious code taxonomy, history, life cycle Virus infection strategies, armored viruses, detection Worms email- and ex...
Date Added: 2009-04-25 22:14:43

TermWritingProject.pdf
Path: Mich Tech >> CM >> 4710 Fall, 2008
Description: MEMORANDUM Department of Chemical Engineering Michigan Technological University TO: FROM: CM4710 Students David R. Shonnard; Professor and CM4710 Instructor Room 202I, email: drshonna@mtu.edu, 487-3468 21 October, 2007 Instructions for Writing Assign...
Date Added: 2009-04-25 22:16:27

krantz2007.pdf
Path: N.C. State >> MA >> 798 Fall, 2008
Description: How to Write Your First Paper Steven G. Krantz This article is the third in an occasional series intended for graduate students. The series is coordinated by Associate Editor Lisa Traynor. In todays world, most any math department wants each of its ...
Date Added: 2009-04-25 22:16:35

en1001.8b.learning-case-studies.pdf
Path: Mich Tech >> GENENG >> 1001 Fall, 2009
Description: Engineering Fundamentals ENG1001- Session 8b Learning From Ethics Case Studies 1 Last Time Introduction to Engineering Ethics Professional Engineer Code of Ethics Part I of Class Ethics Case Study 2 Today\'s Agenda Analyze case studies 3 W...
Date Added: 2009-04-25 22:17:04

hw5_sol.pdf
Path: N.C. State >> CSC >> 570 Fall, 2008
Description: Homework 5 Solution Guidelines ECE/CSC 570-001, Fall 2008 1. (Ungraded) (Adapted from Tanenbaum, 1.17) In some networks, the data link layer handles transmission errors by requesting damaged frames to be retransmitted. (Naturally, the sending DLC la...
Date Added: 2009-04-25 22:17:21

maine_pi.pdf
Path: Alabama >> ECE >> 593 Fall, 2008
Description: prowler PROBABILISTIC WIRELESS NETWORK SIMULATOR Features: Event-driven Deterministic or Probabilistic Command line / GUI Visualization Statistics / Optimization Any number of motes / any application Fast application prototyping MATLAB-based Copyrig...
Date Added: 2009-04-25 22:20:47

2000c_m151_x3a.pdf
Path: Texas A&M >> M >> 151 Fall, 2009
Description: Math 151, Fall 2000 Solutions to Exam 3A 1. What is the domain of the function f (x) = sin1 a) [1, 1] b) (, ) c) 1 ? x d) , 2 2 (, 1] [1, ) e) (, 0) (0, ) The domain of the arcsin function is |x| 1. Thus, we need to |x| 1 or answer c. ln x =...
Date Added: 2009-04-25 22:24:34

LiteratureReviewOpioids&Hydration.pdf
Path: UNC >> EDUCATION >> 40248 Fall, 2009
Description: ...
Date Added: 2009-04-25 22:25:58

EviewsTutorial.pdf
Path: Rutgers >> ECMT >> 322 Fall, 2009
Description: Econometrics 322 Prof. Paczkowski Eviews Tutorial Spring, 2004 Version 1.0 Page 1 Eviews Blank Screen You will type commands here Output will appear here Version 1.0 Page 2 Create a Workspace First Click File/New/WorkFile Version 1.0 Page...
Date Added: 2009-04-25 22:26:13

chapter21material.pdf
Path: NYU >> PJK >> 233 Fall, 2009
Description: Chapter 21: Carboxylic Acid and Nucleophilc Acyl Substitution Reactions Please review naming of carboxylic acid derivatives on pages 771-772 McMurry. Nucleophilic Acyl Substitution Reaction: O O O Y R Y R Nu Y R Nu Y is a stable anion Nu=water, alc...
Date Added: 2009-04-25 22:27:17

Nevalainen_2005.pdf
Path: Washington >> ENVH >> 572 Fall, 2009
Description: Indoor Air 2005; 15 (Suppl 9): 5864 www.blackwellpublishing.com/ina Printed in Singapore. All rights reserved Copyright Blackwell Munksgaard 2005 INDOOR AIR Of microbes and men Abstract Moisture accumulation in building structures, the microbial e...
Date Added: 2009-04-25 22:31:31

2-26-excel.pdf
Path: Pittsburgh >> CS >> 131 Spring, 2008
Description: x Total Average STDEV x^2 x+x^2 2*x 1 1 2 2 2 4 6 4 3 9 12 6 4 16 20 8 5 25 30 10 6 36 42 12 7 49 56 14 8 64 72 16 9 81 90 18 10 100 110 20 11 121 132 22 12 144 156 24 13 169 182 26 14 196 210 28 105 1015 1120 210 7.5 72.5 80 15 4.183300133 64.5096...
Date Added: 2009-04-25 22:32:03

HW2.pdf
Path: New Mexico >> PHYS >> 151 Fall, 2009
Description: ...
Date Added: 2009-04-25 22:32:19

midterm3asol.pdf
Path: Maryland >> MATH >> 220 Fall, 2008
Description: Wednesday December 10, 2008 Midterm 3 Group A Solutions Elementary Calculus I MATH 220 This exam has 4 questions for a total of 100 points. You have 50 minutes to answer all questions. Instructions: Write your name and SID on the exam booklet. Beg...
Date Added: 2009-04-25 22:33:09

rtg.pdf
Path: Duke >> AB >> 216 Fall, 2009
Description: STATISTICS ON MANIFOLDS FRECHET MEANS AND THEIR ESTIMATION Project Submitted by: Abhishek Bhattacharya Advisor: Dr.Rabi Bhattacharya 1 Overview Frechet mean on Metric Spaces Extrinsic Mean Examples on some common Manifolds Intrinsic Mean Exam...
Date Added: 2009-04-25 22:34:30

144.pdf
Path: Utah >> LAW >> 144 Fall, 2009
Description: THE ADMISSION OF UNRELIABLE EXPERT TESTIMONY OFFERED BY THE PROSECUTION: WHATS WRONG WITH DAUBERT AND HOW TO MAKE IT RIGHT Elizabeth L. DeCoux* I. INTRODUCTION On December 29, 1992, Phoenix, Arizona letter carrier Ray Krone answered a knock at his do...
Date Added: 2009-04-25 22:38:19

exam5.pdf
Path: Utah >> MATH >> 1210 Fall, 2008
Description: Name: Final Exam Math 1210-7 15 Dec 2006 Casey Johnson Copy # 0 Instructions: Throughout this exam, you should observe the following rules: 8. Each answer should be reasonably simplied. For example, sin has an exact value that 4 should be known...
Date Added: 2009-04-25 22:38:28

pracexam4.pdf
Path: Utah >> MATH >> 1170 Fall, 2008
Description: Practice Exam 4 MATH 1170, Fall 2007 1. Find all of the critical points of the following functions in the given domains and state whether they are local maxima or local minima. Also state what the global maxima and minima are of each function over t...
Date Added: 2009-04-25 22:38:32

GEOL1122H_sgoldst_spring2004.pdf
Path: UGA >> GEOL >> 1122 Fall, 2008
Description: GEOL 1122H - Earth=s History of Global Change (Honors) Spring, 2004 Dr. Susan T. Goldstein, 309B GG Bldg., phone: 542-2397; email: sgoldst@gly.uga.edu Date: 1/8 1/13 1/15 1/20 1/22 1/27 1/29 2/3 2/5 2/10 2/12 2/17 2/19 2/24 2/26 3/2 3/4 3/9 3/11 3/16...
Date Added: 2009-04-25 22:40:21

2006713_f01c_064065.pdf
Path: Stanford >> KLAC >> 1036 Fall, 2009
Description: Case 3:06-cv-04065-MJJ Document 3 Filed 07/13/2006 Page 1 of 1 2 3 4 5 Robert S. Green ( State Bar No . 136183) Elizabeth C. Guarnieri (State Bar No . 208733) GREEN WELLING LLP 595 Market Street, Suite 2750 San Francisco , California 94105 Tel: ...
Date Added: 2009-04-25 22:42:39

e2.pdf
Path: Michigan State University >> MATH >> 421 Fall, 2009
Description: M421 Exam 2 Monday Nov. 13 NAME: 1 2 3 4 TOTAL The value of each question is indicated next to the question. No calculators, books, or notes are permitted. Except where indicated otherwise, you may use any Theorem we have proved in this class, ...
Date Added: 2009-04-25 22:44:57

hw3.pdf
Path: Michigan State University >> MATH >> 421 Fall, 2009
Description: M421 HW 3 Due Friday Oct. 5 From Wade Section 8.3 8.4 9.1 Page Number 248 254 262 Problems 3, 5 9ab, 10a 4, 7, 8 Non-book Exercises 1) Suppose that A B Rn . Prove that A B and A B . For the following exercises, the lp norm is defined on Rn by n...
Date Added: 2009-04-25 22:44:57

Project1Presentation.pdf
Path: Michigan State University >> ME >> 417 Fall, 2008
Description: ME 417 Design of Alternative Energy Systems Project 1 Politics/Economics of Conversion to Alternative Energy Due Friday, February 6, 2009 DEPARTMENT OF MECHANICAL ENGINEERING The Utilities Companies of America (UCA) has hired the engineering firm o...
Date Added: 2009-04-25 22:45:14

ChE244_FINAL_2007.pdf
Path: Rochester >> CHE >> 244 Fall, 2009
Description: ChE 244: Heat and Mass Transfer Final Exam 12-20-2007 NAME: _ INSTRUCTIONS: You have 3 hours to complete the exam. The exam includes two reference pages followed by 7 pages of problems. The first page is conceptual, followed by 6 pages of word prob...
Date Added: 2009-04-25 22:48:04

20051011_r01o_035517.pdf
Path: Stanford >> CERS >> 1029 Fall, 2009
Description: 1 2 3 4 5 6 7 8 9 MELVIN R. GOLDMAN (BAR NO. 34097) JORDAN ETH (BAR NO. 121617) TERRI GARLAND (BAR NO. 169563) RAYMOND M. HASU (BAR NO. 200058) MORRISON & FOERSTER LLP 425 Market Street San Francisco, California 94105-2482 Telephone: (415) 268-7000 ...
Date Added: 2009-04-25 22:48:11

P3K_tm7.pdf
Path: Caltech >> PALM >> 3000 Fall, 2009
Description: Electronics PALM-3000 Stephen Guiwits Palm 3000 Team Meeting #7 Caltech, 023 Robinson Room February 27, 2008 PALM-3000 Agenda RTC Hardware Procurements Inventory Costs RTC Installation and Configuration DM 3368 chassis test DM 3368 Elect...
Date Added: 2009-04-25 22:51:59

assignment_2_07_soln.pdf
Path: Stanford >> EE >> 369 Fall, 2009
Description: EE369C: Assignment 2 Solutions Most people did very well on this assignment. The most common problem by far was not scaling the kernel properly for the 2x grid, as described in the solutions for questions 3 and 4. 1. The simple gridding reconstructio...
Date Added: 2009-04-25 22:53:37

20040722_r02x_024770.pdf
Path: Stanford >> QMDCE >> 1025 Fall, 2009
Description: ...
Date Added: 2009-04-25 22:54:13

1306spring05-20030.pdf
Path: U. Houston >> DT >> 1306 Fall, 2009
Description: History 1306United States History after 1877 www.uhd.edu/~rydend Section 20030 Spring 2005 Meeting Time: TR 8:30-9:45 Classroom: A629 Prerequisites: English 1301 Instructor: Dr. David Ryden Catalogue Description This course traces the development and...
Date Added: 2009-04-25 22:54:34

pghatpande.pdf
Path: Uni. Worcester >> ETD >> 080808 Fall, 2009
Description: Study of Fixturing Accessibilities in Computer-Aided Fixture Design By Puja Ghatpande A Thesis Submitted to the faculty of WORCESTER POLYTECHNIC INSTITUTE In partial fulfillment of the requirements for the Degree of Master of Science In Mechanical E...
Date Added: 2009-04-25 22:55:52

hw1.pdf
Path: Princeton >> CS >> 594 Spring, 2009
Description: CS 594: Approximation Algorithms Homework 1 Due: Mon, Mar 10 1. The following problem arises in telecommunications networks, and is known as the SONET ring loading problem. The network consists of a cycle on n nodes, numbered 0 through n 1 clockwis...
Date Added: 2009-04-25 22:56:18

Chapter3.pdf
Path: UNL >> ECON >> 212 Fall, 2008
Description: Economics 212X Principles of Microeconomics Chapter 3 Individual Markets: Demand and Supply I. Markets A. A market is a mechanism or institution that brings together buyers (demanders) and sellers (suppliers) of a particular good or service 1. May...
Date Added: 2009-04-25 22:58:59

script_LastLecture.pdf
Path: UNL >> CHEM >> 105 Fall, 2008
Description: CHEM 105 B02: Chemistry in Context I Script from Last Lecture Script from Last Lecture Congratulations! Youve made it to the end of the course! You should pat yourself on the back for getting this far. I imagine that you feel a little bit like the c...
Date Added: 2009-04-25 22:59:03

rbsb2005282.pdf
Path: Allan Hancock College >> RBSB >> 2005282 Fall, 2009
Description: Passed by both Houses New South Wales Royal Blind Society (Merger) Bill 2005 Contents Page 1 2 3 4 5 Name of Act Commencement Definitions Gifts, devises and bequests Repeal 2 2 2 2 3 I certify that this PUBLIC BILL, which originated in the LEG...
Date Added: 2009-04-25 22:59:28

Chapter6_Inclassexercises.pdf
Path: Midwestern State University >> ECONS >> 352 Fall, 2009
Description: Perfect Competition Price Fixed Costs Quantity 0 1 2 3 4 5 6 7 8 9 10 Revenue $0 $48 $96 $144 $192 $240 $288 $336 $384 $432 $480 $48 $100 Variable Costs $0 $50 $78 $98 $112 $130 $150 $172 $210 $255 $310 Total Costs $100 $150 $178 $198 $212 $230 $2...
Date Added: 2009-04-25 23:00:36

2006922_r01k_052165.pdf
Path: Stanford >> OCA >> 1034 Fall, 2009
Description: US District Court Civil Docket as of 3/10/2009 Retrieved from the court on Monday, March 16, 2009 U. S. District Court Eastern District of Louisiana (New Orleans) CIVIL DOCKET FOR CASE #: 2:05-cv-02165-SSV-DEK Santopietro v. OCA Inc et al Date Filed...
Date Added: 2009-04-25 23:02:02

WhitneyM_1.pdf
Path: Maryville MO >> ELE >> 382 Fall, 2009
Description: BIO-SHIRT Whitney Michalek ELE382 10/30/06 The Bio-Shirt is a shirt developed for athletes by Korean scientists at the Electronics and Telecommunications Research Institute in South Korea. The shirt monitors different physiological parameters (heart ...
Date Added: 2009-04-25 23:03:01

l6.pdf
Path: Minnesota >> D >> 3512 Fall, 2009
Description: Comparing sizes of sets Sets A and B are the same size if there is a bijection from A to B. (That was a denition!) For nite sets A, B, it is not dicult to verify that there is a bijection from A to B i |A| = |B|. Lets do it. . . Take arbitrary nite s...
Date Added: 2009-04-25 23:03:02

callicott2_guide.pdf
Path: Minnesota >> RHET >> 1315 Fall, 2009
Description: Philippon/Rhet 1315 Reading Guide: An Ojibwe Land Ethic Leopold, \"The Land Ethic\" 1. What is the ethical sequence (118)? 2. How is the land ethic related to the community concept (119-20)? 3. What is \"[o]ne basic weakness in a conservation system bas...
Date Added: 2009-04-25 23:03:03

10.pdf
Path: Oregon State >> ECE >> 441 Fall, 2008
Description: Project Description Description Design a set of devices to convert wired speakers into wireless speakers. One module will connect to the receiver/amp and will transmit the audio signal wirelessly to the receiver module connected to the speaker. This ...
Date Added: 2009-04-25 23:03:22

educationprescription.pdf
Path: USF >> HEALTH >> 31163 Fall, 2009
Description: Office of Educational Affairs Education Prescriptions Teaching in a clinic or ward can be fatiguing. Simultaneously, certain constraints on an instructors availability make the teachable moment elusive. Yet, unquestionably, situations that might nor...
Date Added: 2009-04-25 23:11:23

q3.56.doc?rev=1.1.1.1;cvsroot=cvsroot%2Fpias;sortby=log
Path: Cornell >> BTRY >> 601 Fall, 2008
Description: <?xml version=\"1.0\" encoding=\"UTF-8\"?> <Error><Code>NoSuchKey</Code><Message>The specified key does not exist.</Message><Key>3ccc98dded5aa9c922e4a5f5575053f054f7118d.4%3Bcontenttyp</Key><RequestId>5DE52E8300C79BED</RequestId><HostId>2wahfi/XzTgy9uwn/...
Date Added: 2009-04-25 23:12:08

ece525-s43.pdf
Path: Idaho >> EE >> 525 Fall, 2009
Description: ...
Date Added: 2009-04-25 23:13:07

CSCE611(Fall02)-Lectures8&9.pdf
Path: Portland >> CLASS >> 573 Fall, 2009
Description: CSCE 611 High-level VLSI Design 2002/9/8 Fall 2002 - Lecture 8 State Machine Design Methods 2002 Dr. James P. Davis Outline Methods. Structural decomposition, refinement Functional input/output response specification. Behavioral/ASM sequencing ...
Date Added: 2009-04-25 23:13:17

sample_final_sol.doc
Path: Sveriges lantbruksuniversitet >> CMPT >> 120 Fall, 2009
Description: CMPT 120, Fall 2004, Surrey Sample Final Page 1 of 6 CMPT-120: Sample Final Last name exactly as it appears on your student card First name exactly as it appears on your student card Student Number SFU Email Section if you know it! This is a 120 m...
Date Added: 2009-04-25 23:18:17

hw2Rev.pdf
Path: Mines >> PHGN >> 520 Fall, 2009
Description: Physics 520, Spring 2009 Problem Set #2 Due: Friday , January 23 Read Le Bellac Chapter 2, then do 1. Hermitian operators [Goswami Problem 3.15] For each of the following operators depending on the hermitian operators A and B , determine when the o...
Date Added: 2009-04-25 23:22:53

handout_L23.2008.04.03_ProbitAnalysis_SPSS.pdf
Path: Mississippi State >> JHS >> 9533 Fall, 2009
Description: Probit Analysis Page 1 of 1 Probit Analysis Next This procedure measures the relationship between the strength of a stimulus and the proportion of cases exhibiting a certain response to the stimulus. It is useful for situations where you have a d...
Date Added: 2009-04-25 23:31:29

handout_L23.2008.04.03_ProbitAnalysis_SPSS.pdf
Path: Mississippi State >> PHD >> 9533 Fall, 2009
Description: Probit Analysis Page 1 of 1 Probit Analysis Next This procedure measures the relationship between the strength of a stimulus and the proportion of cases exhibiting a certain response to the stimulus. It is useful for situations where you have a d...
Date Added: 2009-04-25 23:31:29

midterm1.pdf
Path: Fayetteville State University >> PHY >> 5246 Fall, 2009
Description: Theoretical Dynamics PHY 5246 Midterm I October 24, 2005 1. (30 pts) A pendulum consists of a mass m attached to the end of a massless rod of length l. The pivot point of the pendulum slides without friction on a straight wire which makes a xed ang...
Date Added: 2009-04-25 23:34:48

User_Task_Goals_for_Virtual_Pantry.pdf
Path: Mich Tech >> CS >> 5760 Fall, 2009
Description: User-Task-Goals for Virtual Pantry Analysis by John Roepke Group Members Derek Johnson Tim Park Michael Blaser Kekoa Kaaikala Joshua Fahey Timothy Root Overview The Virtual Pantry TDA application is primarily a food inventory, recipe and ingredient...
Date Added: 2009-04-25 23:38:19

EE303Sp09_PS07_soln.doc.pdf
Path: Naval Academy >> EE >> 303 Fall, 2009
Description: ...
Date Added: 2009-04-25 23:40:51

lecture.doc
Path: UC Santa Cruz >> FILM >> 20 Fall, 2009
Description: ARTIFICIAL INTELLIGENCE AND TURING\'S IMITATION GAME Warren Sack April 2003 This lecture borrows from three published or presented works. All of them can be found online here: http:/www.media.mit.edu/~wsack/pubs.html Warren Sack, Replaying Turing\'s Im...
Date Added: 2009-04-26 02:03:01

ir06_bdo.pdf
Path: UCSD >> IR >> 06 Fall, 2009
Description: IR6_3 FA9503 WHP.DOC 1 CRUISE REPORT IR6 FA9503 and FA9508 WOCE IR6, RV Franklin Cruise 9503 and 9508 in the East Indian Ocean Expedition Designation (EXPOCODE): 09FA9503 and 09FA9508 Chief Scientist: Susan E. Wijffels CSIRO Division of Marine Rese...
Date Added: 2009-04-26 02:04:29

01_Front_Pages.pdf
Path: Virginia Tech >> ETD >> 01302006 Fall, 2009
Description: An Experimental Study of the Dynamic Behavior of Slickensided Surfaces Christopher L. Meehan Dissertation submitted to the Faculty of the Virginia Polytechnic Institute and State University in partial fulfillment of the requirements for the degree ...
Date Added: 2009-04-26 02:06:09

2007_Invitation_email.doc
Path: Texas >> MSG >> 00000 Fall, 2009
Description: NONPROFIT AND PUBLIC SECTOR CAREER FAIR March 28, 2007 10:00 am 3:00 pm Texas Union Ballroom December 4, 2006 Greetings! The University of Texas at Austins Coalition for Careers in the Nonprofit Sector (CCINS) cordially invites you to an exciting e...
Date Added: 2009-04-26 02:06:26

Currie_Cole_AER93.pdf
Path: CSU Channel Islands >> ECON >> 141 Fall, 2009
Description: Welfare and Child Health: The Link Between AFDC Participation and Birth Weight Janet Currie; Nancy Cole The American Economic Review, Vol. 83, No. 4. (Sep., 1993), pp. 971-985. Stable URL: http:/links.jstor.org/sici?sici=0002-8282%28199309%2983%3A4%3...
Date Added: 2009-04-26 02:09:08

Sch02b.pdf
Path: UCSD >> ECE >> 267 Fall, 2009
Description: CHAPTER 2 COMMUNICATION ENERGY-AWARENESS 2.1. BACKGROUND The oldest and most straightforward technique to reduce the energy consumption of a system is to shut down unused parts. Shutdown-based power management has been explored for hard disks [Dou...
Date Added: 2009-04-26 02:10:11

2003113_r01c_0201821.pdf
Path: Stanford >> PMTR >> 1025 Fall, 2009
Description: UNITED STATES DISTRICT COUR T DISTRICT OF MINNESOTA In re PEMSTAR, INC . SECURITIES LITIGATION This Document Relates To : ALL ACTIONS . Master File No. 02-1821 -DWF/SRN CLASS ACTION [CORRECTED] CONSOLIDATED COMPLAINT FOR VIOLATION OF THE FEDERAL SEC...
Date Added: 2009-04-26 02:11:04

200735_r05d_022270.pdf
Path: Stanford >> VRSN >> 1024 Fall, 2009
Description: 1 2 3 4 5 6 7 8 9 10 11 12 13 14 LERACH COUGHLIN STOIA GELLER RUDMAN & ROBBINS LLP PATRICK J . COUGHLIN (111070) JEFFREY W . LAWRENCE (166806) DENNIS J . HERMAN (220163) CHRISTOPHER P. SEEFER (201197) SHIRLEY H . HUANG ( 206854) 100 Pine Street, Su...
Date Added: 2009-04-26 02:11:34

Lecture8b.ppt
Path: Texas Tech >> AAEC >> 4306 Fall, 2008
Description: Tariffs In real world, each country maintain extensive tariff structures with different level for different products. Some products enjoy large protection, whereas others have little or no protection. How to come up with a measure of overall tarif...
Date Added: 2009-04-26 02:12:26

quiz05.pdf
Path: Arizona >> MATH >> 240 Fall, 2009
Description: D V B@\" $ $ @\" @ ! Q $ @\" ! V B $Q B@ 2 Q 3689a IB 3WG68TEAvXtS3B 3WG68y9VAQ3~3E3tAY36369E@F5$ t$ T@Q |6A@FIF8X3FuI9W$uT7{zQF96 EXXu x B \" V \" G V Q ! v @ ! V B G B 0 0 x 0 0 0 0 0 0 0 f 0 0 & 0 ( u u 0 D 0 0 0 D 0 ...
Date Added: 2009-04-26 02:16:01

topgraph80_12.txt
Path: VCU >> CMSC >> 691 Fall, 2008
Description: total 554 edges X Y myid neighborid 554 1860 4164 0 0 1860 4164 0 13 1860 4164 0 32 1860 4164 0 44 1860 4164 0 62 559 4804 1 1 559 4804 1 29 559 4804 1 32 559 4804 1 36 559 4804 1 45 559 4804 1 58 559 4804 1 74 3146 704 2 2 3146 704 2 6 3146 704 2 8 ...
Date Added: 2009-04-26 02:19:12

Jackson_Matthew_Diss.pdf
Path: Texas Tech >> ETD >> 03122007 Fall, 2009
Description: A QUANTITATIVE ANALYSIS OF THE FLAME PRODUCED BY A GAS-FUELED PROPELLANT SIMULATING BURNER INCLUDING: SOOT FIELD CHARACTERIZATION, TEMPERATURE DIAGNOSTIC TECHNIQUES, SPECTRAL ANALYSIS, HEAT FLUX, AND ALUMINUM PARTICLE COMBUSTION by MATT JACKSON, B.S....
Date Added: 2009-04-26 02:19:54

abstracts2003.pdf
Path: Michigan >> NRE >> 540 Fall, 2008
Description: NRE 540 GIS Poster Symposium Friday, December 5, 2003 Room 2024, Dana Building 8:40am-9:00am 9:00am-9:20am Amy Komendera Lori Ivan Analysis of Lake St. Clair Water Quality Indicator Data in Relation to Distance from the Clinton River GIS-based Modeli...
Date Added: 2009-04-26 02:20:05

31295017081851.pdf
Path: Texas Tech >> ETD >> 06272008 Fall, 2009
Description: MODULAR APPROACH TO PERFORMANCE TESTING IN JAVA by SIDDHARTHA S. KHOAT, B.E. A THESIS IN ELECTRICAL ENGINEERING Submitted to the Graduate Faculty of Texas Tech University in Partial Fulfillment of the Requirements for the Degree of MASTER OF SCIENCE ...
Date Added: 2009-04-26 02:20:07

rowlandb45604.pdf
Path: Texas >> ROWLANDB >> 45604 Fall, 2009
Description: Copyright By Bradley Allen Rowland 2007 This Dissertation Committee for Bradley Allen Rowland certifies that this is the approved version of the following dissertation: COMPLEX QUANTUM TRAJECTORIES FOR BARRIER SCATTERING Committee: _ Robert E. Wy...
Date Added: 2009-04-26 02:24:01

lect26.pdf
Path: Maryland >> CS >> 417 Fall, 1997
Description: Announcements l l l l Project #5 extended until Dec. 10 Reading: 7.6 HW#2 Due today TA Extra office hours In 3122 Tu: 2-3 W: ? CMSC 417 - F97 (lect 26) copyright 1997 Jeffrey K. Hollingsworth 1 WWW (cont.) l HyperText Markup Language based ...
Date Added: 2009-04-26 02:24:37

congo_demrep_rel98.pdf
Path: Maryland >> AREC >> 445 Fall, 2008
Description: ...
Date Added: 2009-04-26 02:24:54

congo_demrep_rel98.pdf
Path: Maryland >> COURSES >> 445 Fall, 2009
Description: ...
Date Added: 2009-04-26 02:24:54

Outline.pdf
Path: LSU >> CHE >> 2176 Fall, 2008
Description: Tentative outline of classes: The suggested readings from Chapra & Canale are split into two kinds. Those page numbers that are not in parentheses cover material similar to what I plan to cover in class and should be read carefully. The page numbers ...
Date Added: 2009-04-26 02:25:18

4_27.pdf
Path: LSU >> ME >> 2833 Fall, 2009
Description: ...
Date Added: 2009-04-26 02:25:23

660optimhand.pdf
Path: Maryland >> C >> 660 Fall, 2009
Description: AMSC/CMSC 660 Scientic Computing I Fall 2004 Unit 3: Optimization Dianne P. OLeary c 2002,2004 Optimization Our goal is to develop algorithms to solve the problem Problem P: Given a function f : S R, nd min f (x) xS with solution x . The point x i...
Date Added: 2009-04-26 02:25:54

graphing.pdf
Path: LSU >> CALCULUS >> 1550 Fall, 2009
Description: Graphing: What do f (x) and f (x) tell you about the graph of f (x)? First derivative test : Suppose that c is a critical number of a continuous function f . (a) If f changes from positive to negative at c, then f has a local maximum at c. (b) If f c...
Date Added: 2009-04-26 02:26:53

5221.txt
Path: Maryland >> CMSC >> 114 Spring, 2009
Description: Alias Q1 Q2 Q3 Q4 P1 P2 P3 P4 P5 P6 E1 E2 E3 Grade Opt 5221 46 42 44 35 95 85 90 100 94 96 84 66 114 B 1 ...
Date Added: 2009-04-26 02:29:03

2007Fall142aAssignment5.pdf
Path: CSU Channel Islands >> ICS >> 142 Fall, 2009
Description: ICS 142: Compilers and Interpreters Prof. Dr. Michael Franz & Dr. Andreas Gal, Fall Quarter 2007 Assignment 5 due at the beginning of class on December 6th A Compiler for the Complete Programming Language SimPL As the final assignment, you will ext...
Date Added: 2009-04-26 02:30:05

appdx.pdf
Path: Virginia Tech >> ETD >> 10252003 Fall, 2009
Description: Mahesh B. Mungara Appendix 77 Appendix A Linked List All-DU pairs tests for the add() method definition: 1. public void testobj_D1U1() { LL1= new LinkedList(); LL1.add(0, new Integer(7); assertTrue(LL1.contains(new Integer(7); } 2. public void te...
Date Added: 2009-04-26 02:30:32

salt_lake_nk1.pdf
Path: Maryland >> ENCH >> 630 Fall, 2008
Description: ...
Date Added: 2009-04-26 02:31:59

P01_SIGMA2_all_1000.pdf
Path: UCSD >> P >> 2500 Fall, 2009
Description: 2 (kg/m3) for P01 47N (1000:1) 101 106 m 0 35.5 35.6 35 35.7 35.8 35.9 36 36.1 36.2 36.3 36.4 36.5 36.6 36.7 1500 36.8 36.82 36.84 36.86 36.88 36.9 36.92 36.94 36.96 3000 37 3500 37.02 4000 36.98 500 1000 2000 2500 4500 5000 37.04 5500 37.04...
Date Added: 2009-04-26 02:32:07

hw6.pdf
Path: UCSD >> MATH >> 283 Spring, 2008
Description: Math 283, Spring 2009, Prof. Tesler Homework #6, Due Wednesday February 18, 2009 No problems from the book this week. Just the problems below, H-22 and H-23. Problem H-22. Assume that X has a normal distribution with standard deviation = 12, but we ...
Date Added: 2009-04-26 02:32:35

primerMatlab40.pdf
Path: Maryland >> ENEE >> 425 Fall, 2008
Description: Matlab Primer Third Edition Kermit Sigmon Department of Mathematics University of Florida Department of Mathematics University of Florida Gainesville, FL 32611 sigmon@math.ufl.edu Copyright c 1989, 1992, 1993 by Kermit Sigmon On the Third Edition T...
Date Added: 2009-04-26 02:37:44

Lecture9Notes020309.pdf
Path: UCSD >> BIMM >> 108 Spring, 2008
Description: February 3, 2009 DNA-Directed Enzymes - Topoisomerases o TopoII: makes and re-seals double-stranded breaks; linking number changes by 2 o TopoI: makes and re-seals single-stranded breaks; no ATP required; relaxes all supercoiling o DNA Supercoiling A...
Date Added: 2009-04-26 02:38:39

Homework11.pdf
Path: LSU >> PHYS >> 2203 Fall, 2007
Description: Phys 2203 Homework 11, due Friday November 30. (1) Problem 9.7 (2) Problem 9.9. Atomic masses can be found in Appendix 8. (3) Problem 9.13. Hint: Consider the escape velocity vesc = (2GM/R)1/2 (4) Problem 9.19 (5) Problem 9.20 (6) Problem 9.24 (7) Pr...
Date Added: 2009-04-26 02:39:34

REG_ch09.ppt
Path: Virginia Tech >> BIT >> 5474 Fall, 2008
Description: Spreadsheet Modeling & Decision Analysis: A Practical Introduction to Management Science, 3e by Cliff Ragsdale 1 Chapter 9 Regression Analysis Spreadsheet Modeling and Decision Analysis, 3e, by Cliff Ragsdale. 2001 South-Western/Thomson Learning....
Date Added: 2009-04-26 02:39:42

Announce.pdf
Path: UCSD >> CSE >> 240 Spring, 2001
Description: Principles of Computer Architecture CSE 240A Basic Information September 25, 2008 Instructor Alex Orailolu g Lecture Tuesdays and Thursdays 12:30 1:50 PM; Warren Lecture Hall 2111 Oce Hours Mondays 2:30 3:30 PM and Wednesdays 1:30 2:30 PM; EBU3B...
Date Added: 2009-04-26 02:40:21

mosadomi.pdf
Path: Texas >> COLA >> 079 Fall, 2009
Description: ...
Date Added: 2009-04-26 02:40:50

F2008Class39.pdf
Path: NMT >> PHYS >> 121 Fall, 2008
Description: Ideal Gas Law and derived laws R=8.3 J Kmol 1 3 2 J m v = kB T R=8.3 2 Kmol 2 Consider two specimens of ideal gas at the same temperature. Specimen #1 has the same total mass as specimen #2, but the molecules in specimen #1 have greater molar mas...
Date Added: 2009-04-26 02:41:43

stats_exam2.pdf
Path: Purdue >> EE >> 455 Fall, 2009
Description: Histogram EE455, Exam 2, Fall 2001 max min average sigma 89 41 68.5 12.5 7 6 Frequency 5 4 3 2 1 0 40 50 60 70 Score 80 90 100 Frequency ...
Date Added: 2009-04-26 02:42:39

ARTS 150 1 September 2008c
Path: Texas A&M >> ARTS >> 150 Spring, 2009
Description: FourteenthCentury Art in Europe ItaloByzantine Early Italian Renaissance Bonaventura Berlinghieri Panel from St. Francis Altarpiece (1235) Tempera on wood approx. 5\' x 3\' x 6\" San Francesco, Pescia Duccio di Buoninsegna Betrayal of Jesus, detail...
Date Added: 2009-04-26 02:43:55

lecture3103.pdf
Path: Purdue >> MA >> 265 Summer, 2001
Description: MA 265 Lectures 31 and 32 6.4 Diagonalization of Symmetric Matrices Symmetric matrices have some amazing properties: Theorem 1. All the roots of the characteristic polynomial of a symmetric matrix are real. Consequently, if all the eigenvalues of a...
Date Added: 2009-04-26 02:44:09

Generics.pdf
Path: Purdue >> CS >> 180 Fall, 2008
Description: Generics and Type Safety Introduction to Data Structures A data structure is a specific organization of data for efficiency or ease of coding. E.g. an array allows us to manage a large number of similar items. Many different types of data ...
Date Added: 2009-04-26 02:45:36

post5B.pdf
Path: Purdue >> ME >> 365 Fall, 2009
Description: ME 365 POSTLAB EXERCISE FOR LABORATORY 5B MEMORANDUM Spring 2009 To: From: Re: Date: ME 365 Students Lange Armstrong, Director, Dynamo Measurement Temperature Sensor February 16, 2009 Many thanks for your excellent work this past summer for Dyna...
Date Added: 2009-04-26 02:45:39

Exam2Solution.pdf
Path: Purdue >> ECE >> 637 Spring, 2008
Description: ...
Date Added: 2009-04-26 02:46:05

19.pdf
Path: Purdue >> PHYS >> 600 Fall, 2008
Description: ...
Date Added: 2009-04-26 02:51:37

umts.pdf
Path: UCLA >> CS >> 218 Fall, 2008
Description: 3rd Generation Systems Review of Cellular Wireless Networks UMTS Cellular Wireless Network Evolution First Generation: Analog AMPS: Advance Mobile Phone Systems Residential cordless phones Second Generation: Digital IS-54: North American Standard ...
Date Added: 2009-04-26 02:52:17

001_introduction.pdf
Path: UCLA >> LX >> 105 Fall, 2009
Description: 1. WHAT IS THIS CLASS ABOUT? When learning a new language, once you more or less had the pronunciation down, what did you spend the most time on? Morphology (Haspelmath, page 2): The study of systematic covariation in the form and meaning of words. S...
Date Added: 2009-04-26 02:52:31

HW4-AnswerKey.pdf
Path: Purdue >> STAT >> 311 Fall, 2008
Description: ...
Date Added: 2009-04-26 03:03:14

HW11soln.pdf
Path: Bucknell >> EE >> 491 Fall, 2009
Description: ...
Date Added: 2009-04-26 03:07:44

HW11soln.pdf
Path: Bucknell >> EE >> 11 Fall, 2009
Description: ...
Date Added: 2009-04-26 03:07:44

ee472hw3.pdf
Path: Bucknell >> EE >> 472 Spring, 2009
Description: ...
Date Added: 2009-04-26 03:07:47

9899.soc.team.stats.pdf
Path: Wisc Eau Claire >> SOC >> 9899 Fall, 2009
Description: University of Wisconsin-Eau Claire 1998 Womens Soccer Results Date 9/1/98 9/5/98 W/L L W Score 1-5 4-1 Shots 4-17 21-3 (As of 11/3/98) Opponent Site St. Thomas, MN St. Thomas, MN Elmhurst, IL Madison Goals (Assists) Thompson K. Blasczyk (Perringer, G...
Date Added: 2009-04-26 03:08:45

0102.gym.team.stats.pdf
Path: Wisc Eau Claire >> STATS >> 0102 Fall, 2009
Description: UW-Eau Claire Womens Gymnastics 2001-02 Season Results (as of 3/25/02) Date Dec. 11, 2001 Jan. 11, 2002 Jan. 19, 2002 Jan. 25, 2002 Feb. 1, 2002 Feb. 7, 2002 Feb. 15, 2002 Feb. 22, 2002 Mar. 1, 2002 Mar. 8, 2002 Mar. 22-23, 2002 Won/Lost Lost Lost 5/...
Date Added: 2009-04-26 03:08:50

VBG_Scorecard.pdf
Path: Hudson VCC >> CDAE >> 170 Fall, 2009
Description: VERMONT BUILT GREEN (VBG) PROGRAM Version 3.2a (4/17/2003) A PROJECT OF: BUILDING FOR SOCIAL RESPONSIBILITY AND VERMONT ENERGY INVESTMENT CORPORATION Vermont Built Green Program Description Thank you for your interest in the Vermont Built Green (...
Date Added: 2009-04-26 03:09:11

seq.txt
Path: NJIT >> SS >> 479 Fall, 2009
Description: >TRE|Q9PU83|Q9PU83 (215 AA) Vitamin D receptor (Fragment) [Crocodylus niloticus (Nile crocodile) (African crocodile)] ILTDEEVQRKREMIMKRKEEEALKESMKPKLSEEQQNVIDILLEAHRKTYDPTYSDFTQF RPPVRSSEEQRLTRSSSVLTQGFSSEDSSEPFGSSPDSVEHGMFSNLMLSEPEESASMSI NFSPLTMLPH...
Date Added: 2009-04-26 03:14:08

Lab4Deeds.pdf
Path: NJIT >> WAD >> 407 Fall, 2009
Description: ...
Date Added: 2009-04-26 03:14:22

jcode.txt
Path: NJIT >> VS >> 26 Fall, 2009
Description: _ /* * studentPageForEmp.java * * * To change this template, choose Tools | Template Manager * and open the template in the editor. */ package com.studentloan.web; import java.io.IOException; import javax.servlet.RequestDispatcher; import ...
Date Added: 2009-04-26 03:15:02

jcode.txt
Path: NJIT >> VS >> 602 Fall, 2009
Description: _ /* * studentPageForEmp.java * * * To change this template, choose Tools | Template Manager * and open the template in the editor. */ package com.studentloan.web; import java.io.IOException; import javax.servlet.RequestDispatcher; import ...
Date Added: 2009-04-26 03:15:02

Unit_N_Exam_solutions.pdf
Path: Embry-Riddle FL/AZ >> PS >> 215 Fall, 2009
Description: ...
Date Added: 2009-04-26 03:16:24

hw3_soln.pdf
Path: North-West Uni. >> ESAM >> 446 Fall, 2009
Description: Homework #3 ES APPM 446-1 Due Nov. 12 1. Assume a given numerical method has a leading error term in the form of error(k, h) = e(k, h) Ak p + Bhq where A, B are assumed constants, k, h are respectively time and space step sizes, and p, q are undeter...
Date Added: 2009-04-26 03:17:29

ActionTmSummaries.doc
Path: IUPUI >> SC >> 101807 Fall, 2009
Description: Goal 1: Excellence in Teaching and Learning A. Attract and support a better prepared, more diverse student population Honors College With the appearance of substantial additional merit/need scholarships at IUPUI and a GPPA program, the time is right ...
Date Added: 2009-04-26 03:18:19

Project07.pdf
Path: IUPUI >> M >> 163 Fall, 2009
Description: MATH 163, Spring 2000 Due Date: Name(s): Project 7. Ballistics Objective To illustrate an important application of dierentiation to ballistics. Narrative If a projectile is red vertically upward with an initial velocity of v0 ft/sec from a point s...
Date Added: 2009-04-26 03:18:27

200221_r01c_0120617.pdf
Path: Stanford >> PCG >> 1020 Fall, 2009
Description: Case 5:01-cv-20617 Document 27 Filed 02/01/2002 Page 1 of 68 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 LAW OFFICES OF DOUGLAS A. AMES DOUGLAS A. AMES (State Bar No.198237) 2134 Main Street, Suite 130 Huntington B...
Date Added: 2009-04-26 03:18:47

Lecture5a.pdf
Path: Acton School of Business >> MA >> 471 Fall, 2009
Description: MA471 Lecture 5 Collective MPI Communication Today: When all the processes want to send, receive or both Excellent website for MPI command syntax available at: http:/www-unix.mcs.anl.gov/mpi/www/ 2 9/10/2003 Names For the following exercise I ...
Date Added: 2009-04-26 03:19:02

1_30_06.ppt
Path: Wisconsin >> ME >> 361 Fall, 2008
Description: Thermodynamics A new frontier The role of the book and instructor How to find help Office hours Wendt library The role of the computer ...
Date Added: 2009-04-26 03:20:23

bme515drugdelivery.pdf
Path: Wisconsin >> ENGR >> 515 Fall, 2009
Description: Drug Delivery Currently dumb, someday (hopefully) intelligent David Beebe Dept. of Biomedical Engineering Outline Intro, terminology, etc. Methods Future Terminology Parenteral - other than GI tract (i.e. IV, subcut., intramuscular, transderma...
Date Added: 2009-04-26 03:20:56

econanalysislecturenotes-week2.pdf
Path: Wisconsin >> WEEK >> 314 Fall, 2009
Description: ME 314 Introduction to Competitive Manufacturing Week 2: Engineering Economic Analysis Keith Tschohl, Spring 2005 Introduction Engineering economic analysis is a decision-making process used to investigate and solve economic problems commonly faced...
Date Added: 2009-04-26 03:22:08

Vect_L1_008.pdf
Path: Georgia Tech >> CS >> 1371 Fall, 2008
Description: CS1371 - Computing for Engineers Test 1 Version A September 20th, 2006 1. Circle the correct final x and y value after the following code is executed? x = linspace(2,12,6) y = 5:3:18 x = x(x>6) y = y(mod(y,2)>0) A. B. C. D. E. F. x: x: x: x: x: x: ...
Date Added: 2009-04-26 03:24:17

ie565-finalexam-spring2002.doc
Path: Wisconsin >> ENGR >> 565 Fall, 2009
Description: IE565 Ergonomics in Service Final Exam May 16, 2002 For the picture, please provide the following information: 1. What are the good workstation characteristics? Be specific. 2. What are the bad workstation characteristics? Be specific. 3. Based on y...
Date Added: 2009-04-26 03:24:22

fa02-sw-e3.pdf
Path: Georgia Tech >> ECE >> 2030 Fall, 2008
Description: ECE 2030 10:00pm 4 problems, 4 pages Computer Engineering Exam Three Fall 2002 22 November 2002 Instructions: This is a closed book, closed note exam. Calculators are not permitted. If you have a question, raise your hand and I will come to you. P...
Date Added: 2009-04-26 03:24:48

exam2005s.pdf
Path: St. Francis IL >> PHYSICS >> 322 Fall, 2009
Description: Final Exam: Electricity and Magnetism 322 April 16, 2005 Closed book with one two-sided formula sheet and photocopy of front and back covers. Point values are given with each question. Total exam is worth 125 points but I will mark it out of 115 with...
Date Added: 2009-04-26 03:32:27

queryexec2.ppt
Path: Virgin Islands >> CSC >> 571 Fall, 2009
Description: Nested-Loop joins one-and-a-half pass method, since one relation will be read just once. Tuple-Based Nested-loop Join Algorithm: FOR each tuple s in S DO FOR each tuple r in R DO IF r and s join to make a tuple t THEN output t Improvement to Take A...
Date Added: 2009-04-26 03:34:27

midf07a.pdf
Path: W. Alabama >> ME >> 201 Fall, 2009
Description: Fall 2007 ME201 ADVANCED CALCULUS MIDTERM EXAMINATION October 23, 2007 3:30 am - 5:30 am Instructor: R. Culham Name: Student ID Number: Instructions 1. Answer all questions in the space provided. If additional space is required use the back side ...
Date Added: 2009-04-26 03:34:40

sec-Personnel.pdf
Path: Delaware >> IR >> 0203 Fall, 2009
Description: ...
Date Added: 2009-04-26 03:43:59

syl.pdf
Path: Cal Poly Pomona >> PHY >> 308 Fall, 2009
Description: Physics Department, California State Polytechnic University, Pomona Professor A. John Mallinckrodt Office: Bldg. 8, Room 223 Phone: 869-4054 FAX: 869-5090 email: ajm@csupomona.edu web: www.csupomona.edu/~ajm/ Physics 308 Fall 2004 Course Descriptio...
Date Added: 2009-04-26 03:44:09

HW3sol.pdf
Path: Purdue >> ME >> 576 Fall, 2009
Description: ME576 Homework#3 1.Bollinger9.8 (a) Motor+(Motor+StartClamp1Clamp2) Stop Clamp1Clamp2 (b) LOAD#0 =(Motor+Start) Stop Clamp1Clamp2 LoopSTOREMotor(Temp) OUTPUT0 INPUT1 ORMotor(Temp) STORETemp INPUT2 COMPLEMENT ANDTem...
Date Added: 2009-04-26 03:49:37

README.txt
Path: East Los Angeles College >> READING >> 372 Fall, 2009
Description: <!DOCTYPE html PUBLIC \"-/W3C/DTD XHTML 1.0 Strict/EN\" \"http:/www.w3.org/TR/xhtml1/DTD/xhtml1-strict.dtd\"> <html xmlns=\"http:/www.w3.org/1999/xhtml\" lang=\"en\" xml:lang=\"en\"> <head> <title>Changeset 372 for trunk/docs/src/documentation/README....
Date Added: 2009-04-26 03:52:48

lect08.pdf
Path: Allan Hancock College >> CSE >> 1301 Fall, 2009
Description: CSE1301 Sem 2, 2003 Topics CSE1301 Computer Programming Lecture 8 Booleans 2 Boolean Type int as Boolean Boolean expressions Boolean Operators Precedence Common mistakes 3 Boolean A special type with only two values: false and true. Boole...
Date Added: 2009-04-26 03:55:42

ftsalaries.pdf
Path: Allan Hancock College >> EA >> 0609 Fall, 2009
Description: ACADEMIC STAFF FULL TIME RATES 1/06/06 $ Level A Step 1 Step 2 Step 3 Step 4 Step 5 Step 6* Step 7 Step 8 *See sub-clause Level B Step 1 Step 2 Step 3 Step 4 Step 5 Step 6 Level C Step 1 Step 2 Step 3 Step 4 Step 5 Step 6 Level D Step 1 Step 2 Step 3...
Date Added: 2009-04-26 04:09:37

tutorial2.pdf
Path: Allan Hancock College >> ICS >> 237 Fall, 2009
Description: Tutorial Exercises for Week 2 MATH237 S2 2007 Mathematics IIC 1. Draw up truth tables and determine which of the following are tautologies, contradictions or neither. (a) (p q) (p q) (b) (p q) (p q) (c) (p (q r) (p q) (p r) (d) (p (q ...
Date Added: 2009-04-26 04:11:54

assn2_2008.pdf
Path: Allan Hancock College >> COMP >> 329 Fall, 2009
Description: COMP 329 KNOWLEDGE SYSTEMS ASSIGNMENT 2 Understanding Prolog Programming Due by 12midnight Friday October 31 (Week 11) Submission Guidelines This assignment will contribute 15% towards your nal grade. It consists of 3 questions (totalling 15 marks)...
Date Added: 2009-04-26 04:12:00

rtab2006341.txt
Path: Allan Hancock College >> RTAB >> 2006341 Fall, 2009
Description: 2006 THE LEGISLATIVE ASSEMBLY FOR THE AUSTRALIAN CAPITAL TERRITORY (As presented) ...
Date Added: 2009-04-26 04:12:47

Inclass_activity.doc
Path: Allan Hancock College >> CITP >> 001 Fall, 2009
Description: Terese McAleese In-class Activity Create a folder called DOCUMENT on your disk and save all the files for this activity into it Question 1 a) Find and open the document called PROJECT1.DOC. b) Underline the first title line and change it to 18 point...
Date Added: 2009-04-26 04:15:13

wk2q5.sh.txt
Path: Allan Hancock College >> CITP >> 0044 Fall, 2009
Description: #!/bin/bash # worksheet 2 question 5 # TG 1/3/04 # prompt user for a user name # display user full name and home directory from passwd file # or error message if user does not exist valid=false while [ \"$valid\" = \"false\" ] do echo -n \"Please ent...
Date Added: 2009-04-26 04:16:21

ftpfile.txt
Path: Allan Hancock College >> CITP >> 0021 Fall, 2009
Description: ftp -s:ftpfile.bat goto :done open 192.168.115.19 Scott Lay ls get lpdtest.txt bye :done ...
Date Added: 2009-04-26 04:17:09

GE3502_04_21.ppt
Path: Allan Hancock College >> GE >> 3502 Fall, 2009
Description: GE3502/GE5502 Geographic and Land Information Systems Lecture 21 Modelling in GIS LecturePlan Habitat Suitability models Land Suitability models eg. Sugar cane Intro to Part b of Assignment 2 HabitatModels Approachestohabitat mapping biophy...
Date Added: 2009-04-26 04:17:44

lecture3.ppt
Path: Allan Hancock College >> COMP >> 1900 Fall, 2009
Description: Website Construction 3 Michele Huston Web Manager THE AUSTRALIAN WAR MEMORIAL www.awm.gov.au Lecture 2 COMP1900 Links <A HREF=\"file.html\">Click here</A> <A HREF=\"http:/student.anu.edu.au\"> Student Computing</A> < A HREF=\"#target\">your target<...
Date Added: 2009-04-26 04:18:25

2790ex6.pdf
Path: East Los Angeles College >> MATH >> 2790 Fall, 2009
Description: MATH2790 - Modelling and Simulation Exercise 6 1. Below are two sequences each containing 50 numbers in the range 1 to 100. How well do you think these sequences satisfy the requirements for a random sequence, in terms of equal frequency and independ...
Date Added: 2009-04-26 04:20:00

06-2x2.pdf
Path: East Los Angeles College >> ACOM >> 1210 Fall, 2009
Description: School of something Computing FACULTY OF OTHER ENGINEERING quote ACOM1210: \"Know Your PC\" Lecture 6: Free Software \"TANSTAAFL.\" Tony Jenkins tony@comp.leeds.ac.uk RobertA.Heinlein objectives The objectives are: \"free\" To consider what \"fre...
Date Added: 2009-04-26 04:20:06

scheduling.pdf
Path: Allan Hancock College >> ENGN >> 3222 Fall, 2009
Description: ENGN3222 MANUFACTURING SYSTEMS WORKSHEET 4 SHOP SCHEDULING 1. Describe the conditions under which process-oriented facility organisation is appropriate. Consider the process plan below. A batch of 25 units of this part is due in 21 days. When shoul...
Date Added: 2009-04-26 04:20:51

Mac.txt
Path: Allan Hancock College >> ASP >> 3012 Fall, 2009
Description: Summer Vacation Research Scholarships in Physics and Astronomy - Macquarie University, Sydney 2109 The Department of Physics at Macquarie University has several summer vacation scholarships during Jan-Feb 2009 for 6-7 weeks. Sup...
Date Added: 2009-04-26 04:21:42

NVL.txt
Path: Allan Hancock College >> COMP >> 2400 Fall, 2009
Description: SQL> set pagesize 250 SQL> select nvl(soldto, \'No-one\'), movieid 2 from video; NVL(SOLDTO MOVIEID - - No-one 1 No-one 2 No-one 3 No-one 5 No-one 7 2001/00002 11 2001/0000...
Date Added: 2009-04-26 04:22:15

E1.pdf
Path: Allan Hancock College >> COMP >> 2300 Fall, 2009
Description: Course Review and Exam Discussion q review Q4(a) from 2006 exam (maybe a few others) q final examination: s details s topics q review of major underlying themes q outlook for computer systems q other issues: s 14:0014:15: CEDAM Surveys x please take ...
Date Added: 2009-04-26 04:22:22

0930-carney-ala.pdf
Path: Allan Hancock College >> ALA >> 1921 Fall, 2009
Description: Carney: American Labor Alliance [Sept. 30, 1921] 1 American Labor Alliance. by Jack Carney Unsigned news inVoice of Labor [Chicago], v. 10, no. 516 [actual no. 13] (Sept. 30, 1921), pg. 3. Attributed to editor Jack Carney. At the last meeting of t...
Date Added: 2009-04-26 04:22:37

messages.txt
Path: Allan Hancock College >> CSE >> 2391 Fall, 2009
Description: From marko.pavlyshyn@arts.monash.edu.au Wed May 11 21:42:11 2005 Path: tvsnacks.cc.monash.edu.au!not-for-mail From: Marko Pavlyshyn <marko.pavlyshyn@arts.monash.edu.au> Newsgroups: monash.test Subject: Trial Date: Tue, 22 Feb 2000 10:16:19 +1100 Orga...
Date Added: 2009-04-26 04:26:56

udb_p6.pdf
Path: Allan Hancock College >> HSC >> 3231 Fall, 2009
Description: Criteria to evaluate success: In order to set goals for my project it was essential for me to establish some features against which my success can be measured. Establishing a set of criteria against which to evaluate my success helped to provide a fo...
Date Added: 2009-04-26 04:27:33

CWwwRBT.pdf
Path: Allan Hancock College >> HSC >> 2708 Fall, 2009
Description: World of work: sample reading and responding task Part B Text 1 Using approximately 150 words in Korean write a personal profile referring to the fax. Sample answers ...
Date Added: 2009-04-26 04:27:43

Week6.doc
Path: Allan Hancock College >> EDU >> 1142 Fall, 2009
Description: Week 6: Gender INDEPENDENT ACTIVITIES Following reading the Gender chapter from the set text, choose one of the following activities. Be prepared to share some of your thoughts with the class during the tutorial. Activity 1 - (from the text) Think ab...
Date Added: 2009-04-26 04:29:45

Q2_1.pdf
Path: East Los Angeles College >> PART >> 0607 Fall, 2009
Description: 2. Target Market Analysis This section provides a market analysis and provides insights into the different types of customers using a recording studio, their needs, characteristics and possibilities of cross-selling and value-adding opportunities. Th...
Date Added: 2009-04-26 04:32:07

tut3texts.txt
Path: Allan Hancock College >> MATH >> 2068 Fall, 2009
Description: vt1:=\"UOLTEEQCTOCSCNELEHRNGRPREPTTAQWBROEMCEMFSXXDBRVVEMHYJMFQNGNCELZVLODXDAADCKLZVEBMXUNUNGVCZWJIEXOLVUGVWVRUQRXPOZNBRXZWKIEPTOYJCWLZVJFXBFWNXBFXOLRUHXREYYOECZQFUIHZAXNBKSGSMFFHDIEJBVEYPVSAEXEZTHZSIWRODMTAGTBVTVVKJCNXAEQMNIMIRCHHDRRSHKSCMJDOEPPEJQZW...
Date Added: 2009-04-26 04:32:46

tut5.pdf
Path: Allan Hancock College >> ISYS >> 3401 Fall, 2009
Description: ISYS3401 Analytical Methods for IS Professionals 2007 Tutorial session Five Thursday April 19, 2007 School of Information Technologies The University of Sydney Sampling Techniques OBJECTIVE Understand target population and sampling frame Underst...
Date Added: 2009-04-26 04:33:16

LECTURE6(1).pdf
Path: Allan Hancock College >> ELEC >> 5508 Fall, 2009
Description: Chapter 6 Capacity of Wireless Systems Chapter 3 pp. 86-96 2008-9-5 Wireless Engineering Traffic and Capacity 2008-9-5 Wireless Engineering Trunking and Grade of Service Cellular radio systems rely on trunking to accommodate a large number of...
Date Added: 2009-04-26 04:33:48

essay_guide.pdf
Path: Allan Hancock College >> HSTY >> 2647 Fall, 2009
Description: Department of History University of Sydney A Short Guide To The Writing and Presentation of Papers and Essays 5th edition 2000 CONTENTS 1. THE ROLE OF WRITTEN WORK IN HISTORY 2. PREPARING YOUR WRITTEN WORK 3. MAKING NOTES 4. WRITING AN ESSAY Comp...
Date Added: 2009-04-26 04:34:23

week13_examanswers.pdf
Path: Allan Hancock College >> CHEM >> 1101 Fall, 2009
Description: CHEM1101 2003-N-13 November 2003 Marks 6 In the refining of copper, impure copper electrodes are electrolysed in a manner such as described in the following figure. Indicate in the boxes on the figure, which electrode is the anode and which is th...
Date Added: 2009-04-26 04:36:19

Week7_McNurlin_07.pdf
Path: Allan Hancock College >> ECOM >> 20001 Fall, 2009
Description: Managing Information Resources Chapter 7 Information Systems Management In Practice 6E McNurlin & Sprague PowerPoints prepared by Michael Matthew Visiting Lecturer, GACC, Macquarie University Sydney Australia Introduction Managing information reso...
Date Added: 2009-04-26 04:37:56

cois12036_assn2_topics_T2.doc
Path: Allan Hancock College >> COIS >> 12036 Fall, 2009
Description: #\\#D#cois12036_assn2_topics_T2.doc#]#?3= #KE#t#~#IV#3#FEjk#nI#JhDc #r =q5\'Y#9,Q#1A/\'kf2zU#cc I W*#tx LL |#7HI;266I1>P?>B 5#ww,# L47o|\"DCj#m1k#OEm#k8KIAup ap1#\\-\'Iw/%#=!> /#z) Oi*#>/#3#N&#@zk~rDf yrnbii~n%#B~ #C,g0~ZAO r8#Jq?\'JJ#LFXp_u1- %DgH|\\ ...
Date Added: 2009-04-26 04:38:55

07n2324.pdf
Path: Allan Hancock College >> N >> 2301 Fall, 2009
Description: ISO/IEC JTC1/SC7 Software Engineering Secretariat: CANADA (SCC) ISO/IEC JTC1/SC7 N2324 2000-05-25 Doc. Type Title Source Project Status References Action ID Due Date Mailing Date Distribution Medium No. of Pages Note Report Report of the Study Gro...
Date Added: 2009-04-26 04:40:01

07n2324.pdf
Path: Allan Hancock College >> SC >> 2301 Fall, 2009
Description: ISO/IEC JTC1/SC7 Software Engineering Secretariat: CANADA (SCC) ISO/IEC JTC1/SC7 N2324 2000-05-25 Doc. Type Title Source Project Status References Action ID Due Date Mailing Date Distribution Medium No. of Pages Note Report Report of the Study Gro...
Date Added: 2009-04-26 04:40:01

Mammone-etal_CaO_1981.pdf
Path: UCLA >> ESS >> 252 Fall, 2009
Description: GEOPHYSICAL RESEARCHLETTERS, VOL. 8, NO. 2, PAGES 140-142, FEBRUARY 1981 EQUATIONS OF STATE OF CaO UNDER STATIC PRESSURE CONDITIONS J. F. Mammone,* H. K. Mao, and P.M. Bell Geophysical Laboratory, Carnegie Institution Abstract. Experimental s...
Date Added: 2009-04-26 04:40:36

npawcprp2006743.pdf
Path: Allan Hancock College >> NPAWCPRP >> 2006743 Fall, 2009
Description: Published in Gazette 7.12.2006 p 4271 South Australia National Parks and Wildlife (Lincoln Conservation Park-Mining Rights) Proclamation 2006 under section 43 of the National Parks and Wildlife Act 1972 Preamble 1 The Crown land described in Sched...
Date Added: 2009-04-26 04:41:06

rsb2006199.txt
Path: Allan Hancock College >> RSB >> 2006199 Fall, 2009
Description: PARLIAMENT OF VICTORIA Road Safety (Drugs) Act 2006 Act No. TABLE OF PROVISIONS Clause Page 1. ...
Date Added: 2009-04-26 04:42:03

Ass-2.pdf
Path: Allan Hancock College >> COMP >> 5416 Fall, 2009
Description: Student ID 200427261 305117459 306011565 306019558 306107422 306218534 306256886 307042553 307042634 307042642 307075788 307078655 307099598 307104451 307127842 307225402 307253767 307253899 307254003 307265846 307266168 Ass-2 (20%) 13 16 14 19 16 1...
Date Added: 2009-04-26 04:43:06

capvab2008437.txt
Path: Allan Hancock College >> CAPVAB >> 2008437 Fall, 2009
Description: [Page Break] Crimes (Domestic and Personal Violence) Amendment Bill 2008 No , 2008 A Bill for An Act to amend the Crimes (Domestic and Personal Violence) Act 2007 with respect to applications for, and the issuing of, orders under that A...
Date Added: 2009-04-26 04:43:44

abs-guide.pdf
Path: Allan Hancock College >> CSC >> 2408 Fall, 2009
Description: Advanced BashScripting Guide An indepth exploration of the art of shell scripting Mendel Cooper <thegrendel@theriver.com> 3.8 26 February 2006 Revision History Revision 3.6 28 Aug 2005 \'POKEBERRY\' release: Bugfix Update. Revision 3.7 23 Oct 2005 \'W...
Date Added: 2009-04-26 04:45:03

section_properties.pdf
Path: Allan Hancock College >> CIVL >> 2201 Fall, 2009
Description: Extracts from Design Capacity Tables for Structural Steel Hollow Sections Smorgon Steel Available from http:/www.smorgonsteel.com.au/tubemills/ Third Edition Hot Rolled and Structural Steel Products 8 HRSSP 3rd Ed. December 2003 HRSSP 3rd Ed. Decem...
Date Added: 2009-04-26 04:46:12

assignment5.pdf
Path: Laurentian >> MATH >> 122 Fall, 2009
Description: MATH 122 Assignment 5 due March 4 45 marks 1. (6 marks) Express w as a linear combination of v1 , v2 , v3 (if possible) where (a) w = (1, 2, 0) and v1 = (1, 4, -1), v2 = (0, 3, -1), v3 = (3, 1, 1). (b) w = (0, 8, -5, 8) and v1 = (1, 0, 2, 3), v2 = (0...
Date Added: 2009-04-26 04:46:39

Lecture_07_08.pdf
Path: Allan Hancock College >> ERTH >> 1501 Fall, 2009
Description: ERTH 1501 Igneous processes and rocks Lectures 7 & 8 Igneous processes and rocks Properties of igneous rocks Volcanism and volcanic rocks Volcanic hazards Origin of magma Plutonic rocks BASALTIC MAGMA SUMMARY Low in Si High in Fe and Mg Fluid so l...
Date Added: 2009-04-26 04:48:15

pointernotes.pdf
Path: Allan Hancock College >> COMP >> 125 Fall, 2009
Description: COMP125 Fundamentals of Computer Science Week 08: Pointers Ros Ballantyne COMP125 2008 Abstract This lecture is about pointers and their use for general programming. Pointers can be dicult to master and they are a very common source of execution er...
Date Added: 2009-04-26 04:48:47

assign1.pdf
Path: W. Alabama >> SD >> 652 Fall, 2009
Description: Systems Design 652 Assignment 1 Due 27 January 2009 [1]: The quick-return mechanism consists of a crank AB, slider block B, and slotted link CD. If the crank has a constant angular speed of 2 rad/s counter-clockwise, use classical vector kinematics ...
Date Added: 2009-04-26 04:50:06

choon_-_week_2.pdf
Path: Allan Hancock College >> MC >> 163 Fall, 2009
Description: RMIT University 1 http:/upload.wikimedia.org/wikipedia/commons/d/db/Quake_epicenters_1963-98.png Global earthquake epicentres, 1963-1998 http:/upload.wikimedia.org/wikipedia/commons/8/85/Global_plate_motion.jpg Global plate tectonic movement RMIT U...
Date Added: 2009-04-26 04:50:14

WaveMechanics.pdf
Path: Allan Hancock College >> PHYS >> 301 Fall, 2009
Description: Chapter 5 Wave Mechanics The version of quantum mechanics based on studying the properties of the wave function is known as wave mechanics, and is the version that rst found favour amongst early researchers in the quantum theory, in part because it ...
Date Added: 2009-04-26 04:50:18

brochure.pdf
Path: Allan Hancock College >> HUMANITIES >> 195203 Fall, 2009
Description: postgraduate faculty of HuMaNItIes Architecture Master of Philosophy (Architecture) curtIN KEY COURSE FACTS Degree: MArch(Curtin) Entry Requirements A Bachelor of Architecture degree with first or second class honours, or a Bachelor of Archite...
Date Added: 2009-04-26 04:53:45

Adelaidean.pdf
Path: Allan Hancock College >> BINARY >> 621 Fall, 2009
Description: FREE Publication Adelaidean NEWS FROM THE UNIVERSITY OF ADELAIDE Volume 14 Number 4 June 2005 inside this issue 3 Keeping our trees streets ahead The future is eye-tech 8 New $8m music facilities hit the right note 10 Revecca responds to chil...
Date Added: 2009-04-26 04:54:13

examinfo07.pdf
Path: Allan Hancock College >> MATH >> 3063 Summer, 2009
Description: THE UNIVERSITY OF SYDNEY MATH3003 Ordinary Differential Equations and Biomathematics(N) Semester 1 Exam Information Sheet 2007 The exam will have four questions. Each will be of equal value. The questions will each be marked out of 25. You should no...
Date Added: 2009-04-26 04:54:20

GCBus.pdf
Path: Allan Hancock College >> APRC >> 505 Fall, 2009
Description: FORM 7 FORM 7 - Single Stage Submission Program Rule Amendment The University of Queensland Program Development and Approval Process The information in this form is provided for internal communication purposes only and does not in any way constitut...
Date Added: 2009-04-26 04:55:15

energy_system_analysis.pdf
Path: Allan Hancock College >> CHEE >> 4024 Fall, 2009
Description: CHEE4024 Energy Systems in Sustainable Development Energy Generation/Consumption = Sustainable Development Energy Systems Analysis Dr Joe da Costa HUMAN ACTIVITIES EXISTING RESOURCES IMPACT IN EXISTING ENVIRONMENT The University of Queensland ...
Date Added: 2009-04-26 04:56:48

15-IO.4up.pdf
Path: Allan Hancock College >> COMP >> 1100 Fall, 2009
Description: Whats a Program? So far, we have concentrated on pure functions they take arguments, perform a computation, and return a result. Input and Output COMP1100 Introduction to Programming and Algorithms To use such functions we have used the program G...
Date Added: 2009-04-26 04:58:52

Labroster2007_updated.pdf
Path: Allan Hancock College >> ELEC >> 3100 Fall, 2009
Description: ELEC3100 Fundamental of Electromagnetic Field and waves Sem 2 2007 Lab roster Pracs are located in Hawken, communication Lab 50-s202 Numbers in the table indicates Groups of three students Wednesday 11:00-13:00 Prac 1 Simulation Ekka Holiday Group ...
Date Added: 2009-04-26 04:59:43

wbg_poster.pdf
Path: Allan Hancock College >> BP >> 250 Fall, 2009
Description: WELCOME BACK GOTHIC WELCOME BACK GOTHIC - A RMIT LOWER POOL DESIGN STUDIO WITH ANTONY MARTIN AND STUART HARRISON MONDAY 3.30-6.30 & THURSDAY 6.30-9.30 This studio will develop a contemporary architectural project based on both the architectural and ...
Date Added: 2009-04-26 05:00:29

lect_pt2_chap910.pdf
Path: Allan Hancock College >> ELEC >> 166 Fall, 2009
Description: CHAPTER 9 SIGNALS AND NOISE 9-1 Chapter 9 SIGNALS and NOISE \"Hearing the ethereal bark of this Ferrari on full-song is probably the closest I will ever get to achieving aural nirvana; it is visceral, utterly transcendent and divinely musical to my...
Date Added: 2009-04-26 05:00:59

Webster98.pdf
Path: Allan Hancock College >> TAS >> 110 Fall, 2009
Description: correspondence Callans canyons and Voronois cells Sir A recent Art and Science article by Martin Kemp1 describes sculptures that Jonathan Callan makes by sprinkling cement powder uniformly over a horizontal board in which small holes have been dril...
Date Added: 2009-04-26 05:01:07

subprog1-2up.pdf
Path: Allan Hancock College >> CSC >> 3403 Fall, 2009
Description: Subprogram concepts: Topics Functions Subprogram design issues Parameters Parameter passing Type checking of arguments Functions as parameters Polymorphic subprograms Generic subprograms Multiple compilation units User-dened operators Coro...
Date Added: 2009-04-26 05:02:07

2009_CIVL4414_Outline.pdf
Path: Allan Hancock College >> CIVL >> 4414 Fall, 2009
Description: E DE E M R E NS E AD M MU TA TO SI ! \" #$ $% & ( * + * ) , $ % , . / 0 2# 2/ 33 3, 1 1 4* + \' 5) 4( 4 ( ( 4 / 4( , * $ 6 ,. / 0 1 # # / 33 3, $ 14 ( 5) 4( 4 ( ( 4 7 , * 38 , . / 0 # %3/ 33 3, 1 1 47 5) 4( 4 ( ( 4 \' ( * + * ) , $ % , . / 0 2# ...
Date Added: 2009-04-26 05:02:09

solution_pb1.pdf
Path: UNC >> ECON >> 345 Fall, 2008
Description: Economics 145, Fall 2005 Prof. Sandra Campo Solutions Problem Set 1: I. Multiple choice questions 1. b, 2. b, 3. b, 4. d, 5. c,6 b. II. Social Surplus See attached graph. III. Supply function in a competitive market The rm maximizes prots by choosing...
Date Added: 2009-04-26 05:11:41

Assignment5.pdf
Path: CSU Northridge >> JTDB >> 1481 Fall, 2009
Description: Name: Jessica De Bruin November 10, 2008 (1) General Software Review. In this activity you will be reviewing software that you would find useful in your roll as a teacher. Note, this is a review of software, not websites. Websites can be used only i...
Date Added: 2009-04-26 05:11:50

Bruegmann.pdf
Path: Delaware >> ARTH >> 402011 Fall, 2009
Description: ...
Date Added: 2009-04-26 05:15:29

CHE_255_S09_syl.pdf
Path: CSU San Marcos >> CHE >> 255 Fall, 2009
Description: Chemistry 255; Spring 2009 Syllabus Instructor information: Dr. Paige Phillips Email: janice.phillips@usm.edu Office: TEC 404 Office phone: 601-266-4083 Office hours: Monday evening, 4-7 p.m., and other times by appointment Website: http:/www.usm.edu...
Date Added: 2009-04-26 05:17:14

Barnes2008.pdf
Path: East Los Angeles College >> MP >> 230 Fall, 2009
Description: Now available from Ashgate Publishing. Knowledge as Social Order Rethinking the Sociology of Barry Barnes Edited by Massimo Mazzotti, University of Exeter, UK `This is a deep, wide-ranging set of essays celebrating the seminal contribution to unders...
Date Added: 2009-04-26 05:17:20

C281sry_Pres2_Spectroscopy.pdf
Path: Sveriges lantbruksuniversitet >> C >> 281 Fall, 2009
Description: Objective for this presentation: Review IR and 1H-NMR spectroscopy Explain the basics of IR spectra interpretation Explain the basics of NMR spectra interpretation Provide a generalized approach to identification using IR and NMR spectroscopy Not...
Date Added: 2009-04-26 05:17:55

CL-Resume.pdf
Path: W. Carolina >> PP >> 401 Fall, 2009
Description: Resume Package Cover Letter and Resume Brian Gastle Western Carolina University What Do You Want To Do In A Cover Letter? Introduce yourself Brief statement of abilities Express interest in the job Show how YOU will be a benefit to THEM n.b. the app...
Date Added: 2009-04-26 05:18:47

Lec17x4.pdf
Path: UCSD >> CSE >> 120 Fall, 2000
Description: CSE 120: Principles of Operating Systems Lecture 17 Before We Begin Read Chapters 16-18 (on Distributed Systems topics) Programming Assignment #4 Due Sunday, March 15, 10:00pm Distributed Systems March 10, 2009 Prof. Joe Pasquale Department of Co...
Date Added: 2009-04-26 05:19:00

1992.pdf
Path: Princeton >> CL >> 1933 Fall, 2009
Description: ...
Date Added: 2009-04-26 05:21:50

termpaper.pdf
Path: UCF >> TTE >> 5204 Fall, 2008
Description: TTE 5204 Traffic Engineering A. E. Radwan Spring \'00 Term Paper This term paper deals with literature research concerning traffic engineering topics. More specifically, you are asked to critically review technical papers that deal with traffic engi...
Date Added: 2009-04-26 05:25:11

AtlantaMotel.pdf
Path: Berkeley >> PS >> 157 Fall, 2009
Description: Heart of Atlanta Motel, Inc. v. United States 379 U.S. 241(1964) Note: This case and Katzenbach v. McClung, which appears next in the book, were decided on the same day. Justice Blacks references to the second case, therefore, are to Katzenbach v. Mc...
Date Added: 2009-04-26 05:25:26

Ch9_HW.pdf
Path: UCF >> FIN >> 4514 Fall, 2008
Description: ...
Date Added: 2009-04-26 05:26:36

pas364s2.pdf
Path: East Los Angeles College >> PAS >> 364 Fall, 2009
Description: PAS364/PAS6012 Sampling Theory and Design of Experiments Solutions to Exercises 2 1. |X| = 1 1 1 1 1 a a2 a3 1 a a 2 a3 1 1 1 1 = 4a 8a3 + 4a5 = 4a(1 a2 )2 . Hence |X T X| = |X|2 = {4a(1 a2 )2 }2 . This is zero at a = 0 and a = 1, and so we expe...
Date Added: 2009-04-26 05:29:09

Lect42.pdf
Path: Wisc Stevens Point >> ASTR >> 311 Fall, 2009
Description: Astronomy 311 5/02/2008 1 2 Active Galaxies Lecture 42 Active Galaxies Emit much more energy than average galaxies (100,000 times in some cases) More seen at larger distances (past) Galaxies radiate light at different wavelengths than normal g...
Date Added: 2009-04-26 05:30:38

05-dynprog.pdf
Path: University of Illinois, Urbana Champaign >> CS >> 573 Spring, 2008
Description: Algorithms Lecture 5: Dynamic Programming Those who cannot remember the past are doomed to repeat it. George Santayana, The Life of Reason, Book I: Introduction and Reason in Common Sense (1905) The 1950s were not good years for mathematical resear...
Date Added: 2009-04-26 05:31:05

COMP522-PublicKey-06.pdf
Path: East Los Angeles College >> COMP >> 522 Fall, 2009
Description: Public-key, or asymmetric encryption Public-key encryption techniques. It is particular and most important kind of Public-Key Encryption Asymmetric encryption (or asymmetric key encryption): One key is used for encryption (usually publicly known, ...
Date Added: 2009-04-26 05:34:57

sdarticle.pdf
Path: East Los Angeles College >> TF >> 227 Fall, 2009
Description: ARTICLE IN PRESS Journal of Computational and Applied Mathematics ( ) www.elsevier.com/locate/cam The generalized DirichletNeumann map for linear elliptic PDEs and its numerical implementation A.G. Sifalakisa , A.S. Fokasb , S.R. Fultonc , Y.G....
Date Added: 2009-04-26 05:35:36

ex13.pdf
Path: East Los Angeles College >> EC >> 372 Fall, 2009
Description: U NIVERSITY OF E SSEX Session 200809 D EPARTMENT OF E CONOMICS R. E. Bailey EC372 Economics of Bond and Derivatives Markets Exercise 3: Futures Markets: II Speculation and Hedging 1. A company seeks to reduce the price risk associated with acquirin...
Date Added: 2009-04-26 05:36:16

1M1examples1.pdf
Path: East Los Angeles College >> MATH >> 19661 Fall, 2009
Description: 1M1 Mathematics Examples 1 1 1 ux x (x + 1) and g (x) = 2 1u where u is some xed number with 0 < u < 1. By simplifying the left hand sides of each equation show that f (x) = f (x) + x + 1 = f (x + 1) Qn.2 Simplify cos 2x + cos x + 1 cos x and g (x) ...
Date Added: 2009-04-26 05:36:22

of2ex2.pdf
Path: East Los Angeles College >> MATHFS >> 552 Fall, 2009
Description: OF2 Probability examples 2. 1. Two balls are drawn from an urn containing 5 white and 3 black balls. Find the probability that: (i) both balls are white; (ii) both balls are the same colour; (ii) at least one ball is white. 2. A bag contains six ball...
Date Added: 2009-04-26 05:36:23

Nagel.pdf
Path: East Los Angeles College >> BEEM >> 10908 Fall, 2009
Description: ...
Date Added: 2009-04-26 05:36:53

36_MICRO_LOCAL_SITE_GROWTH.pdf
Path: East Los Angeles College >> STUDIO >> 0506 Fall, 2009
Description: 05 01 EXISTING SITE Summer 2006 Low house values, neglected space and sites of conflict during the summer periods are common within the site. Summer 2008 05 PEACE WALL VESSEL GALLERY The renewed cross community activity leads to the construction of...
Date Added: 2009-04-26 05:39:35

selfstudy10.pdf
Path: Washington >> T >> 511 Fall, 2009
Description: SOLUTIONS TO SELF-STUDY PROBLEM FOR UNIT 10 Partnership Taxation, Winter 2009, Donaldson 10-1. (a) Jennifer would like to apply the rules of subchapter K: no gain upon contribution under 721(a), no gain upon distribution of the cash under 731(a)(1...
Date Added: 2009-04-26 05:43:09

nso_litigation_08.pdf
Path: Washington >> ESC >> 458 Fall, 2009
Description: Spotted Owls Kara Whittaker Washington Forest Law Center Overview Why is the NSO a threatened species? ESA Section 9 Why was litigation necessary? Take Case Case Settlement Importance o...
Date Added: 2009-04-26 05:44:12

chwk2.pdf
Path: Arizona >> CS >> 620 Fall, 2009
Description: { y }{ { { { z | } z { } | { z }{ { #z8cxj7ficWc\"W#zW#~fW{#{00w0wcw0 } { z } { {~ | |{ { } ~ { { | | { |{ { {#0|#}0aDxx\"G { ~ } | { | ~ {#|0Ig0wg|&{W0| }{ { } ...
Date Added: 2009-04-26 05:45:46

hw3.pdf
Path: Washington >> STAT >> 517 Winter, 2008
Description: STAT 517: Homework Assignment #3 DUE: Thursday, February 28, 2008 From Chiangs book: 5.3, 5.5, 5.9 From the Lecture Notes: 5.9.2, 5.9.3, 5.9.4, 5.9.5, 5.9.6, 5.9.7 ...
Date Added: 2009-04-26 05:46:09

HW1_TR.pdf
Path: Texas El Paso >> GEOL >> 1312 Fall, 2008
Description: GEOL 1312 Name _ HOMEWORK #1 Basic Geology Concepts Due Tuesday, February 10th IN CLASS Answers to the questions must be given in complete sentences (except where indicated), using correct grammar and spelling. Please be as brief and to-the-point...
Date Added: 2009-04-26 05:47:53

smoke_management3.pdf
Path: LSU >> NR >> 12567 Fall, 2009
Description: Louisiana Smoke Management Guidelines for Sugarcane Harvesting Training Summary Report - Summer 2000 Louisiana Smoke Management Guidelines for Sugarcane Harvesting Introduction Prescribed burning as a harvest management tool in sugarcane is a widel...
Date Added: 2009-04-26 05:47:56

cg-relclauses.pdf
Path: Maryland >> LING >> 419 Fall, 2008
Description: Semantics of Relative Clauses in Categorial Grammar First, recall the basic semantics for a sentence like Every girl met John: every (S/(S\\NP)/N pq.x[p(x) q(x)] girl N x.girl (x) > met (S\\NP)/NP xy.met (x)(y) John NP john > (1) S/(S\\NP) q.x[gir...
Date Added: 2009-04-26 05:48:37

lecture08--8feb07.pdf
Path: Colorado >> ASTR >> 1040 Fall, 2008
Description: ASTR 1040 Accel Astro: Stars & Galaxies Astro: Today + Revisit: neutrino puzzle - test of deep interior Probing inside of sun with sound: helioseismology Read S.4 Building blocks of universe - discuss in recitation on Friday Overview read Chap 1...
Date Added: 2009-04-26 05:48:38

lecture03.pdf
Path: Colorado >> ASTR >> 5550 Fall, 2008
Description: Lecture 3 Fri, 16 Jan 2009 Today: Further Axiomatic Development: Independent events and conditional probability Bayes theorem Practical examples of Bayesian analysis Further Axiomatic Development Independent Events Two events are dened to be inde...
Date Added: 2009-04-26 06:25:47

clinic2plan.pdf
Path: Penn State >> LAC >> 273 Fall, 2009
Description: SCIED 411 Peer Teaching 4 and Clinic 2 December 3rd, 2008 Presenters Lance Alex Smolin lac273@psu.edu aos5008@psu.edu Grade Level and Topic 6th-8th grade Ice Ages and their Effect An in-depth study of ice ages and their effect on life Standards PA...
Date Added: 2009-04-26 06:26:37

AvianFlu2006.pdf
Path: UCSD >> BGGN >> 238 Fall, 2009
Description: Vol 440|23 March 2006 BRIEF COMMUNICATIONS Influenza virus receptors in the human airway Avian and human flu viruses seem to target different regions of a patients respiratory tract. Although more than 100 people have been infected by H5N1 influenza...
Date Added: 2009-04-26 06:28:35

Koehler_tr_1960.pdf
Path: Caltech >> ETD >> 06162006 Fall, 2009
Description: ...
Date Added: 2009-04-26 06:30:36

final.pdf
Path: Cal Poly Pomona >> CS >> 200301 Fall, 2009
Description: Final Exam CS 460 Winter 2003 Craig A. Rich 1 Compute the discrete inverse of 70 in Z manually. Show your work. 151 2 Compute 113173 mod 43 manually. Show your work. 3 Prove that Z is closed under discrete multiplication and exponentiation; i.e.,...
Date Added: 2009-04-26 06:32:44

final.pdf
Path: Cal Poly Pomona >> CS >> 460 Fall, 2009
Description: Final Exam CS 460 Winter 2003 Craig A. Rich 1 Compute the discrete inverse of 70 in Z manually. Show your work. 151 2 Compute 113173 mod 43 manually. Show your work. 3 Prove that Z is closed under discrete multiplication and exponentiation; i.e.,...
Date Added: 2009-04-26 06:32:44

13_response_variation.pdf
Path: University of Montana >> BIOL >> 340 Fall, 2008
Description: Population response: evolution by natural selection What are the necessary conditions for evolution by natural selection? trait variation trait heritability differential reproduction by trait value Act 2: Whole genome perspective Galapagos grou...
Date Added: 2009-04-26 06:34:32

lect-memh_4up.pdf
Path: Pittsburgh >> CS >> 1541 Spring, 2008
Description: CPU clock rate CS/COE1541: Introduction to Computer Architecture Memory hierarchy Sangyeun Cho Dept. of Computer Science University of Pittsburgh Apple II MOS 6502 (1975) 1~2MHz pp Original IBM PC (1981) Intel 8080 4.77MHz Intel 486 50MHz DEC Alph...
Date Added: 2009-04-26 06:35:26

Mod15.pdf
Path: Pittsburgh >> ENGR >> 0112 Fall, 2008
Description: Networking Course Map 15 This module discusses JDK support for sockets and socket programming. Socket programming is used to communicate with other programs running on computers on the same network. The Java Programming Language Basics Getting Star...
Date Added: 2009-04-26 06:35:37

bizarre.pdf
Path: Duke >> CPS >> 100 Fall, 2009
Description: anonymous- How Bizarre (is Compsci-100) OMC- How Bizarre Well the pizza is on the left The Jolt Cola is on the right I\'m typing on the keyboard in the cold cold night Suddenly the program decides to come alive The red exes are no longer on that line ...
Date Added: 2009-04-26 06:36:32

syllabus.pdf
Path: Wisconsin >> M >> 221 Fall, 2008
Description: Math 221 Discussion Section 2 Syllabus Lecture: MTWR 8:55-10:10 Van Vleck B231 Discussion: MTWR 1:10-2:00 Van Vleck B119 Text: Thomas Calculus, 11th Ed. TA: Ben Ellison Oce: 316 Van Vleck Hall Oce Hours: By Appointment; TR 2:15-3:15 Oce Telephone: (...
Date Added: 2009-04-26 06:40:17

105lecture2.pdf
Path: UCSB >> ANTH >> 105 Fall, 2008
Description: Human Variation in the News Want longevity and a sharp mind? It\'s in the genes A variation in a particular gene involved in regulating cholesterol is known to be associated with longevity, and now it seems it also confers mental sharpness in old age...
Date Added: 2009-04-26 06:40:28

info.pdf
Path: UCSB >> ECE >> 124 Fall, 2009
Description: ECE124A VLSI Principles University of California, Santa Barbara Department of Electrical and Computer Engineering Fall 2008 Class Room: Labs: ESB 1003 (Cooper Lab) Monday 6:00 PM-8:50 PM Thursday 12:00 PM-2:50 PM Tue & Thu 3:30PM-4:45PM ENGR1 1140...
Date Added: 2009-04-26 06:41:15

lec05.pdf
Path: N.C. State >> CHE >> 596 Fall, 2009
Description: CHE 596M Multi-Scale Modeling of Matter Instructor: Keith E. Gubbins Lecture 5: Introduction to SemiClassical Statistical Mechanics CHE 596M Placed on Reserve in NCSU Library Text: A.R. Leach, \"Molecular Modeling: Principles and Applications\", 2nd ...
Date Added: 2009-04-26 06:41:58

project.pdf
Path: Mich Tech >> FW >> 5411 Fall, 2009
Description: FW5411 Applied Regression Analysis 23 February 2009 PROJECT: Paper Review Introduction Regression is a rich suite of analytical of tools. Often you\'ll pick up a textbook or read a published article and find regression used to answer a question you...
Date Added: 2009-04-26 06:43:25

Evaluation_IVVa_RLCAEval_S08b_T16_V1.1.pdf
Path: USC >> CSCI >> 577 Fall, 2009
Description: Carlos Rosario, crosario@usc.edu Team 16 E-Mentoring March 5, 2008 AAR RCLA Team 16 E-mentoring A. Management Overview Documentation and presentation of the package is growing and looks good. A concentrated effort towards testing and transition ne...
Date Added: 2009-04-26 06:44:19

lecture-09.pdf
Path: Alabama >> CS >> 325 Fall, 2008
Description: Lecture 9 Thursday, February 15 Today Command-line arguments in Java Input with Java, console and graphical Announcements Project is due Monday i ht t 9pm P j t 3 i d M d night at 9 Command line args in Java public class CmdArgs { public static voi...
Date Added: 2009-04-26 06:44:58

contract2.pdf
Path: UNC >> COMP >> 145 Fall, 2008
Description: Monitor and Map Vegetation Dynamics Contract II Submitted to: Professor Aaron Moody Cc: Professor Greg Welch Comp 145 February 13, 2001 Michael Smith Hani Alkhaldi Daniel Chen Victor Ibrahim Sarath Kolluru Preface: Following is the second version ...
Date Added: 2009-04-26 06:49:41

classification1.pdf
Path: UNC >> COMP >> 790 Fall, 2008
Description: Classification I COMP 790-90 Seminar BCB 713 Module Spring 2009 The UNIVERSITY of NORTH CAROLINA at CHAPEL HILL Classification vs. Prediction Classification: predicts categorical class labels (discrete or nominal) classifies data (constructs a mode...
Date Added: 2009-04-26 06:49:41

128FMS.pdf
Path: Texas A&M >> POST >> 126 Fall, 2009
Description: Agricultural Economics/Food Marketing Systems Option Catalog 128. 120 Credit Hours Required. FRESHMAN YEAR: FALL AGEC 105 (Intro. Ag. Economics) AGLS 101 (Mod. Ag. Systems Rhetoric) MATH 141 (Business Math I) ...
Date Added: 2009-04-26 06:49:47

Clark_Charles_Thesis.pdf
Path: Texas Tech >> ETD >> 03272008 Fall, 2009
Description: Distribution and Formation of Two Calcareous Soils on the Southern High Plains of Texas by Charles Wayne Clark, B.S. A Thesis In Soil Science Submitted to the Graduate Faculty of Texas Tech University in Partial Fulfillment of the Requirements for th...
Date Added: 2009-04-26 06:50:05

S08_Final_Study_Guide.pdf
Path: UCSB >> ED >> 165 Fall, 2008
Description: Spring 2008 ED 165: Final Review This is a study guide (meaning information that is not on this sheet could be asked on the test). Even though there is some information included on here that was from class, you should study your lecture notes as well...
Date Added: 2009-04-26 06:50:47

ENGL301D01.TXT
Path: Sveriges lantbruksuniversitet >> ENGL >> 20022 Fall, 2009
Description: Sheet1 PROFILE OF STUDENTS IN SFU COURSES COURSE: ENGL 301-4 D01 LOCATION: SFU TITLE: OLD ENGLISH II: ADVN SECTION TYPE: LEC SEMESTER: 2002-2 ENROL: 5 = PROGRAM OF STUDENT (Top 5 programs reported in each category) -Approved Intended Approved Certs, ...
Date Added: 2009-04-26 06:51:04

sturm.pdf
Path: UVA >> LAW >> 0607 Fall, 2009
Description: CONFLICT RESOLUTION AND SYSTEMIC CHANGE Susan Sturm Columbia Law School 435 W. 116th Street New York, N.Y. 10027 (917) 846-3502 ssturm@law.columbia.edu Howard Gadlin Center for Cooperative Resolution 9000 Rockville Pike Bethesda, MD 20892 (301) 594 ...
Date Added: 2009-04-26 06:51:11

Quiz16Answer.pdf
Path: LSU >> MATH >> 2057 Fall, 2003
Description: ...
Date Added: 2009-04-26 06:52:37

projsched.pdf
Path: Johns Hopkins >> AMS >> 252 Fall, 2009
Description: Project Scheduling Examples Example 1: Networks and Critical Paths The library at Kaufman Products has just received authorization to spend up to $40,000 on new journal subscriptions and book purchases. Accordingly, the librarian has developed the f...
Date Added: 2009-04-26 06:54:24

T0416.t2k.alpha-logo.pdf
Path: UC Santa Cruz >> T >> 0416 Fall, 2009
Description: T0416.t2k alpha 3 2 1 1 10 20 30 40 E 3 2 1 B B E A S E I S H S H B S B E A F A I H E H S B I S 51 60 70 80 90 E B 3 2 1 H S B E B H S B S B H B S B E 101 110 120 130 140 S 3 2 1 H B S E H B H B S H 151 160 170 ...
Date Added: 2009-04-26 06:54:27

columnkey.pdf
Path: Middlebury >> F >> 201 Fall, 2009
Description: ...
Date Added: 2009-04-26 06:55:08

RR95-03.pdf
Path: NYU >> ECON >> 9386 Fall, 2009
Description: ...
Date Added: 2009-04-26 06:55:38

Q15C4Q5master.txt
Path: Temple >> CIS >> 320 Fall, 2009
Description: CIS 320 Quiz 15 on Chapter 4-5 Last Name (print) _ First Name (print) _ 1. A firewall router using NAT receives a request from a local host (192.168.1.100) to connect to Temples web server (www.temp...
Date Added: 2009-04-26 06:58:03

mid1_solns_f06.pdf
Path: Ill. Chicago >> ECE >> 368 Fall, 2008
Description: 1 ECE 368, Fall 2006, Instructor: Prof. Shantanu Dutt Midterm Exam: Fri., Nov. 10, Time: 1:30-2:50 pm Exam Format: Open Book (only text book and one sheet of notes), Total Points: 100 Important Note: (1) Write your name on the top of this question s...
Date Added: 2009-04-26 07:00:07

mm1-5.pdf
Path: Ill. Chicago >> MATH >> 502 Fall, 2008
Description: Metamathematics David Marker Fall 2003 1 Languages and Structures In mathematical logic, we use first-order languages to describe mathematical structures. Intuitively, a structure is a set that we wish to study equipped with a collection of distin...
Date Added: 2009-04-26 07:00:14

M151_Exam3B_S06.pdf
Path: Texas A&M >> MATH >> 151 Fall, 2008
Description: MATH 151, SPRING 2006 COMMON EXAM III - VERSION B LAST NAME, First name (print): INSTRUCTOR: SECTION NUMBER: UIN: SEAT NUMBER: DIRECTIONS: 1. The use of a calculator, laptop or computer is prohibited. 2. In Part 1 (Problems 1-12), mark the correct c...
Date Added: 2009-04-26 07:01:07

lecture12.ppt
Path: Texas A&M >> P >> 218 Fall, 2009
Description: Nobel Prize in Physics 2008 Yoichiro Nambu \"for the discovery of the mechanism of spontaneous broken symmetry in subatomic physics\" Makoto Kobayashi Toshihide Maskawa \"for the discovery of the origin of the broken symmetry which predicts the existe...
Date Added: 2009-04-26 07:01:29

ex-2s.pdf
Path: Wisconsin >> M >> 112 Fall, 2008
Description: ...
Date Added: 2009-04-26 07:03:17

in_class_9.pdf
Path: N.C. State >> E >> 115 Fall, 2001
Description: InClass9 Fall2008 AdvancedXHTML Objectives SetupourUnityaccountsforXHTMLhosting Getabasicconceptontheuseoftags ApplytheuseoftagsinthecreationofXHTMLdocuments Usemoreadvancedtagstobringinvolvedcontenttotheuser Premise TheInternet,nothingismoreconn...
Date Added: 2009-04-26 07:04:39

MATH407MidtermSolution.pdf
Path: Washington >> MATH >> 407 Fall, 2008
Description: MATH 407 - (Midterm) - 1 hr. Name: Solve the following problems. Please show all work, i.e., dont say I used a calculator to show the following. Write your solutions on the additional paper provided. The following problems will be equally weighted...
Date Added: 2009-04-26 07:05:18

IA64_timings_rearranged_032.txt
Path: UCSD >> PHYS >> 244 Spring, 2008
Description: <!DOCTYPE html PUBLIC \"-/W3C/DTD XHTML 1.0 Strict/EN\" \"http:/www.w3.org/TR/xhtml1/DTD/xhtml1-strict.dtd\"> <html xmlns=\"http:/www.w3.org/1999/xhtml\"> <head> <title> /spring2008/students/atripathi/HW4/hw4reslts/IA64Results/32/3/...
Date Added: 2009-04-26 07:05:59

UFO-2p.pdf
Path: Georgia Tech >> PHYS >> 4267 Fall, 2008
Description: 522 CHAPTER 26. UNIVERSALITY IN TRANSITIONS TO CHAOS (a) (b) Chapter 26 Figure 26.1: Universality in transitions to chaos The developments that we shall describe next are one of those pleasing demonstrations of the unity of physics. The key dis...
Date Added: 2009-04-26 07:11:05

115Bmidterm07ans.pdf
Path: Princeton >> PH >> 115 Fall, 2009
Description: Part I. Essay Be succinct, include the physical principles that are relevant and appropriate quantitative details. Dont spend more than 15 minutes on Part I it accounts for only 24% of the points. 1. (12 points) You have all seen action movies in ...
Date Added: 2009-04-26 07:13:33

logical_db_design.ppt
Path: Baylor >> MIS >> 4340 Fall, 2008
Description: Chapter 5 G. Green 1 Agenda Evolution of Data Models (see Chapter 6 pgs 288-289) Relational Database Model Transforming ERDs into Relations Referential Integrity Normalization G. Green 2 The Evolution of Data Models Hierarchical Network Relatio...
Date Added: 2009-04-26 07:14:14

964.TXT
Path: East Los Angeles College >> LJ >> 562 Fall, 2009
Description: -0.247237 0.023584 -0.962109 -0.960183 0.026695 0.633867 -0.521376 -1.129637 -0.518951 0.467183 0.463712 -0.247425 0.040180 0.675815 0.037872 -0.992468 -0.992142 0.961784 0.957383 -0.708933 -1.738552 -0.706273 0.786450 -0.244272 1.419783 1.415281 0.7...
Date Added: 2009-04-26 07:15:00

ch06_intrusion.pdf
Path: University of Hawaii - Hilo >> EE >> 406 Fall, 2009
Description: Ch.6 Intruders and Intrusion Detection Intrusion: Unwanted accesses SERIOUS issues: unwanted (maybe hostile) trespass from benign to serious 1-out-of-4 home PCs are bots! Types of intrusions user trespass: unauthorized logon, privilege abuse ...
Date Added: 2009-04-26 07:15:30

1stDayChecklist.pdf
Path: Ohio State >> ESL >> 105 Fall, 2009
Description: English 105 FIRST DAY CHECKLIST The following is a list of activities crucial for the first day of class. Please keep them in mind when planning your first class. l. Identify class a. write department and class number on board b. check to see that st...
Date Added: 2009-04-26 07:16:55

ssppt.ppt
Path: St. John Fisher >> KEEP >> 08738 Fall, 2009
Description: Violence in Sports Its All Fun and Games Until Somebody Gets Hurt Jos huaBovet| RoccoCar z o |T er es aCollins | yanGallagher | Br Mar is s aVicker s What is Violence? Violence Intimidation Aggression (2) Where It All Began Ancient Rom...
Date Added: 2009-04-26 07:18:15

Calvano-nature03985-s3.pdf
Path: Vanderbilt >> MIM >> 351 Fall, 2009
Description: Supplementary Figure 1 Gene-gene interactions surrounding RELA captured in the observed human interactome. The immediate neighborhood of the nuclear factor kappa beta gene, RELA, includes 150 genes and 619 direct interactions, derived from 847 publis...
Date Added: 2009-04-26 07:18:35

Overtime_Lawsuits.pdf
Path: Bowling Green >> RMI >> 3500 Fall, 2009
Description: ...
Date Added: 2009-04-26 07:18:50

CS164_Notes_Verification.pdf
Path: UC Riverside >> CS >> 164 Fall, 2008
Description: CS164 Notes on Verification of Link-Level Protocols by D. Knuth, published in BIT vol. 21 (1981), pp. 31-36. 1. Background Recall that Alices data-link controller needs to send a never-ending sequence frames M [0], M [1], M [2], M [3] to Bobs data-...
Date Added: 2009-04-26 07:19:34

Lec13_verification.pdf
Path: Cornell >> MAE >> 6740 Fall, 2009
Description: M&AE 6740: Hybrid Systems Verification (4) Hadas Kress-Gazit hadaskg@cornell.edu 1 Requirements: Temporal logics Model checking Deductive verification Verification through simulation Safety verification (reachability) Reachability Unsafe ...
Date Added: 2009-04-26 07:21:29

ccaa200181o2001300.txt
Path: Allan Hancock College >> CCAA >> 200181 Fall, 2009
Description: The legislation that is being viewed is valid for Sessional. Criminal Code Amendment (Evidence) Act 2001 (No. 81 of 2001) - CONTENTS Criminal Code Amendment (Evidence) Act 2001 ...
Date Added: 2009-04-26 07:21:58

lab_9.doc
Path: Lehigh >> EPS >> 481 Fall, 2009
Description: LAB 9 ORGANIZATION OF FLUVIAL LAB DATA 135 ...
Date Added: 2009-04-26 07:22:39

Q5.pdf
Path: CSU Channel Islands >> CHEMISTRY >> 131 Winter, 2009
Description: Quiz 5 1. Consider the set (-1, 1) and the operation of multiplication. Write out the multiplication table. If it is a group, what is the order of the group, and what is the identity? If it isnt a group, explain why. 2. What 2d symmetry operations l...
Date Added: 2009-04-26 07:23:06

msamp.pdf
Path: Stanford >> EE >> 261 Fall, 2009
Description: EE 261 Fourier Transform and Applications Sample Midterm Examination Problems 1. Fourier series. a. Use the convolution theorem to nd the Fourier series of cos3 x. b. Write cos3 x as a sum of cosines. February 6, 2009 Handout #9 2. Periodic autocor...
Date Added: 2009-04-26 07:23:19

Mss90-06ByrnesInterim.pdf
Path: Clemson >> MSS >> 090 Fall, 2009
Description: Series 6: Interim Series, 1946-January 1951; bulk 1947-1950 12.25 cubic feet consisting of 322 folders, 16 photographs, and 13 oversize items. This series consists of an appointment book, bills, biographical sketches, booklets, brochures, cards, clip...
Date Added: 2009-04-26 07:24:08

Lecture17.pdf
Path: UNC >> COMP >> 790 Fall, 2008
Description: Lecture 17: Approximate Pattern Matching Study Chapter 9.6 9.8 10/28/2008 Comp 590/Comp 790-90 Fall 2008 1 Approximate vs. Exact Pattern Matching Last time we discussed exact pattern matching algorithms Usually, because of mutations, it makes...
Date Added: 2009-04-26 07:25:40

419012+Pk+Maint+Supr.doc
Path: UNC >> READ >> 4918168 Fall, 2009
Description: PARK MAINTENANCE SUPERVISOR Department: Central Serv Position Number: 419012 FLSA Status: Nonexempt GENERAL DEFINITION OF WORK: Performs intermediate supervisory and semiskilled to skilled maintenance work in county parks; performs related work as r...
Date Added: 2009-04-26 07:26:06

structural1.pdf
Path: Drexel >> MCS >> 575 Fall, 2009
Description: Theory of Information Hiding The Theory of Modularity Information Hiding Software Design (...
Date Added: 2009-04-26 07:26:07

Spec+for+Listserve.doc
Path: UNC >> READ >> 579427 Fall, 2009
Description: 1DFNPM01[T] +- ZOPFEO02[T] +- ZPVIST01[T] +- ZPVIST02[T] +- 1DFNEO0A[T] Enter order set up tcl had to be diff from nursing. | +- C0734TCL[T] | | +- C0734MSG[S] | +- TERMID [T] | +- GENORD01[T] | +- 1GETDOC1[S] . . . | +- 1DFNEO0B[T] Enter order driv...
Date Added: 2009-04-26 07:26:14

Lec08-mem.97.ppt
Path: UPenn >> CIS >> 501 Fall, 2008
Description: Lecture 8: Memory Hierarchy (2) Michael B. Greenwald Computer Architecture CIS 501 Fall 1999 MBG 1 CIS501, Fall 99 Administration SEAS Career Awareness Day: 10am-3pm Towne Links from Web Page: Problems? Tell us. CIS501, Fall 99 MBG 2 Review C...
Date Added: 2009-04-26 07:27:07

P480-99b-9.pdf
Path: University of Illinois, Urbana Champaign >> PHYS >> 480 Fall, 2009
Description: Problem Set 9 Physics 480 / Fall 1999 Professor Klaus Schulten Problem 1: An important relationship Prove that for 3 3-matrices U and A, where A is also hermitean, holds the property that U = exp(iA) and det U = 1 implies trace(A) = 0. Follow the f...
Date Added: 2009-04-26 07:27:54

Atmos348Lecture12.pdf
Path: University of Illinois, Urbana Champaign >> ATMOS >> 348 Fall, 2009
Description: ATMOS 348 Atmospheric Chemistry Lecture 12: The Troposphere Don Wuebbles Department of Atmospheric Sciences University of Illinois, Urbana-Champaign February 2004 Tropospheric Chemistry What makes it different from stratospheric chemistry? Troposph...
Date Added: 2009-04-26 07:28:02

Lec05-datapath.ppt
Path: Georgia Tech >> CS >> 2200 Fall, 2008
Description: Lecture 5: Processors: Datapath Prof. Kenneth M. Mackenzie Computer Systems and Networks CS2200, Spring 2003 Includes slides from Bill Leahy Mackenzie Spring03 1 Review: Digital Logic Combinational logic: gates, ROMs tri-state buffer: 0/1 or Z (...
Date Added: 2009-04-26 07:28:16

cs498tcp_document.pdf
Path: University of Illinois, Urbana Champaign >> CS >> 498 Fall, 2008
Description: CS 498: Network Systems Laboratory Supplementary Document To Lab Project 6 TCP Implementation in Linux Kernel Guanghui He and Jennifer C. Hou Department of Computer Science University of Illinois at Urbana Champaign ghe, jhou@cs.uiuc.edu I: Importan...
Date Added: 2009-04-26 07:29:30

hw13sols.pdf
Path: University of Illinois, Urbana Champaign >> CS >> 273 Spring, 2008
Description: CS 273: Intro to Theory of Computation, Spring 2008 Problem Set 13 Due Tuesday, April 22nd, 10am This homework contains five problems, one of which is bonus. Please submit each on a separate sheet of paper. Turn in your homework at Elaine Wilson\'s of...
Date Added: 2009-04-26 07:29:41

cattlebreeds.doc
Path: Iowa State >> MR >> 1109 Fall, 2009
Description: CattleNetwork.com, KS 11-05-07 Cattle Breeds: Cattlemen\'s Boot Camp Set For December 18-19 At Iowa State University The American Angus Association, Angus Foundation and Iowa State University will conduct a Cattlemen\'s Boot Camp, December 18-19 at Kil...
Date Added: 2009-04-26 07:30:39

cattlebreeds.doc
Path: Iowa State >> PUBLIC >> 1109 Fall, 2009
Description: CattleNetwork.com, KS 11-05-07 Cattle Breeds: Cattlemen\'s Boot Camp Set For December 18-19 At Iowa State University The American Angus Association, Angus Foundation and Iowa State University will conduct a Cattlemen\'s Boot Camp, December 18-19 at Kil...
Date Added: 2009-04-26 07:30:39

EE434_Lect06_Fall2005.pdf
Path: Iowa State >> EE >> 434 Fall, 2009
Description: EE 434 Lecture 6 Logic Circuits Process Technology Quiz 4 A proposed three-input Boolean Gate is shown a. Determine the Boolean output Y b. Is the static power dissipation of this gate zero? (use the switch-level model of the MOSFET) VDD A C B Y ...
Date Added: 2009-04-26 07:31:34

ch232s09-ex1.pdf
Path: Alabama >> CHEM >> 232 Fall, 2009
Description: Chemistry 232, Spring 2009 Dr. Shaughnessy Exam #1 February 3rd, 2009 Name: (print) CWID: Honor Pledge: I promise or affirm that I will not at any time be involved with cheating, plagiarism, fabrication, or misrepresentation while enrolled as a s...
Date Added: 2009-04-26 07:32:49

2001annr.pdf
Path: Alverno >> CIT >> 372 Fall, 2009
Description: OUR NEXT GENERATION, INC. 2001 ANNUAL REPORT February, 2002 Executive Summary As we approach our tenth year anniversary, we find our programs and operations stronger and more successful in creating brighter futures for the children and the families ...
Date Added: 2009-04-26 07:33:30

YalakiDissertation.pdf
Path: Fayetteville State University >> ETD >> 05192004 Fall, 2009
Description: THE FLORIDA STATE UNIVERSITY COLLEGE OF EDUCATION SCIENCE TEACHERS WORLDVIEWS: A WAY TO UNDERSTAND BELIEFS AND PRACTICES BY YALCIN YALAKI A Dissertation submitted to the Department of Middle and Secondary Education in partial fulfillment of the req...
Date Added: 2009-04-26 07:33:45

changing_the_way_we_work.pdf
Path: Pittsburgh >> EXP >> 1394 Fall, 2009
Description: Chapter 2 Changing the Way We Work T 00 o o tN re 3 C re echnology implies change. When a caveman first realized that a flint flake made a good knife, he increased his chances of survival. Typewriters changed the way we wrote, calculators cha...
Date Added: 2009-04-26 07:35:24

MoscibrodaWattenhofer.pdf
Path: Iowa State >> CS >> 611 Fall, 2009
Description: Maximal Independent Sets in Radio Networks Thomas Moscibroda Computer Engineering and Networks Laboratory, ETH Zurich 8092 Zurich, Switzerland Roger Wattenhofer Computer Engineering and Networks Laboratory, ETH Zurich 8092 Zurich, Switzerland mosci...
Date Added: 2009-04-26 07:37:19

Lecture41.ppt
Path: BYU - ID >> CHEM >> 106 Fall, 2009
Description: Lecture 41 Sections 22.1 and 22.2 Objectives 2, 5, and 6 Alkanes (saturated) Single bonds, sp3 hybridization, 109.5 degree angles Methane, ethane, propane, butane, pentane, etc. Alkenes (unsaturated) At least one double bond, sp2 h...
Date Added: 2009-04-26 07:39:27

MATHFS54108t2.pdf
Path: East Los Angeles College >> MATHFS >> 541 Fall, 2009
Description: 0C1/1C1 MATHEMATICS COURSEWORK 2 The deadline for this homework is Friday 5th December 2008. For 0C1 students this homework is to be handed in to the Foundation Oce. For 1C1 students it should be handed to me or left in the envelope on my door (room ...
Date Added: 2009-04-26 07:39:31

Germ0902Web.pdf
Path: Iowa State >> NR >> 94576 Fall, 2009
Description: February 2009. Flowers are lovely; love is flower-like. Samuel Taylor Coleridge February 2009. Flowers are lovely; love is flower-like Samuel Taylor Coleridge Coordinator\'s Comments By Bev Lillie As the winter progresses everyone is anxiously awaiti...
Date Added: 2009-04-26 07:40:03

pfa-3-1.pdf
Path: Cornell >> GB >> 291 Fall, 2009
Description: INTERNATIONAL LABOUR OFFICE GB.291/PFA/3/1 291st Session Geneva, November 2004 Governing Body Programme, Financial and Administrative Committee PFA THIRD ITEM ON THE AGENDA Information Technology Systems Fund 1. At its 289th (March 2004) Session...
Date Added: 2009-04-26 07:42:07

lecture_1-26-09.pdf
Path: UCSB >> ENGR >> 185 Winter, 2009
Description: Intellectual Property Rights Lecture: January 26, 2009 UCSB Engineering 185F/285F UCSB Website January 2009 Karen Smith Bogart Intellectual Property Any innovation, commercial or artistic, or any unique name, symbol, logo or design Patent: Propert...
Date Added: 2009-04-26 07:43:22

pipe_project_1.pdf
Path: University of Illinois, Urbana Champaign >> CEE >> 490 Fall, 2009
Description: University of Illinois Department of Civil Engineering CE -391/CSE-315: Computer Methods in Civil Engineering Term Project 1 (Due Monday, March 29, 2004) Introduction Complete development of a program to solve steadystate, pressurized pipe flow pr...
Date Added: 2009-04-26 07:45:02

FallOER2003.pdf
Path: New Mexico >> OER >> 033 Fall, 2009
Description: OFFICIAL ENROLLMENT REPORT Fall 2003 ENROLLMENT STATISTICS ARE AS OF THE CENSUS DATE SEPTEMBER 12, 2003 OFFICE OF THE REGISTRAR FALL 2003 OFFICIAL ENROLLMENT REPORT TABLE OF CONTENTS MAIN CAMPUS Headcount by Enrollment Status Headcount by Level S...
Date Added: 2009-04-26 07:47:01

287History2007.pdf
Path: Idaho >> CSS >> 287 Fall, 2008
Description: Historical Basis for Parks & Protected Areas Runs Deep Historical Development of Resource Conservation in USA CSS 287 Professor Ed Krumpe Parklands-one of the oldest forms of multiple use. The concept of parkland protection predates Yellowstone in we...
Date Added: 2009-04-26 07:47:08

31295013305817.pdf
Path: Texas Tech >> ETD >> 09262008 Fall, 2009
Description: EFFECTS OF COUPLES\' PERCEPTIONS OF GENOGRAM CONSTRUCTION ON THERAPEUTIC ALLIANCE AND SESSION IMPACT: A GROWTH CURVE ANALYSIS by SCOTT COUPLAND, B.S., M.S., M.A. A DISSERTATION IN MARRIAGE AND FAMILY THERAPY Submitted to the Graduate Faculty of Texas...
Date Added: 2009-04-26 07:48:41

studyguide_final_sol.pdf
Path: Arizona >> NATS >> 101 Fall, 2006
Description: NATS 101 Introduction to Weather and Climate, Section 54, Fall 2005 Study Guide Questions for Final Exam at 11 AM - 1 PM on Tuesday, 13 December in ILC 140 Suggestions: Be sure to read all questions carefully and answer all parts of the questions. An...
Date Added: 2009-04-26 07:52:07

endog.pdf
Path: NYU >> PD >> 453 Fall, 2009
Description: Does the Network Matter? Pritha Dev Department of Economics New York University April 9, 2008 Abstract Network formation theory is based on the assumption that the benets of belonging a network depend on the number of people a person is linked to wh...
Date Added: 2009-04-26 07:53:28

CISC106-lecture06.ppt
Path: Delaware >> CIS >> 106 Fall, 2009
Description: General Computer Science for Engineers CISC 106 Lecture 06 Roger Craig Computer and Information Sciences 2/23/2009 Lecture Overview How to log into Strauss Importance of play and practice Arrays What is Strauss? Strauss is a server Accessed by clie...
Date Added: 2009-04-26 07:54:03

G070501-00.pdf
Path: Caltech >> G >> 070501 Fall, 2009
Description: Summary of Detector Characterization Sessions Keith Riles (University of Michigan) LSC-Virgo Meeting MIT July 23-26, 2007 1 Detector Characterization Summary LIGO-G070082-00-Z K. Riles - University of Michigan LIGO-G070501-00-Z DC Parallel Sessi...
Date Added: 2009-04-26 07:54:04

reading6.pdf
Path: San Diego State >> ASTRO >> 660 Fall, 2009
Description: Week #6 Handout, 2009.03.02 Astronomy 660, Professor Douglas Leonard Reading Guide We continue our investigation of relativistic cosmology by considering in detail the effects of a positive cosmological constant on our basic equations of cosmology. 1...
Date Added: 2009-04-26 07:56:16

ws302d01.txt
Path: Sveriges lantbruksuniversitet >> ARTS >> 19981 Fall, 2009
Description: PROFILE OF STUDENTS IN SFU COURSES COURSE: WS 302-3 D01 LOCATION: SFU TITLE: ST-WOMEN AND DRUGS SECTION TYPE: LEC SEMESTER: 1998-1 ENROL: 15...
Date Added: 2009-04-26 07:58:17

200856_f01k_0801962.pdf
Path: Stanford >> WFC >> 1039 Fall, 2009
Description: US District Court Civil Docket as of 2/10/2009 Retrieved from the court on Tuesday, February 17, 2009 U.S. District Court California Northern District (San Francisco) CIVIL DOCKET FOR CASE #: 3:08-cv-01962-JSW Van Dyke v. Wells Fargo & Co. et al Apr...
Date Added: 2009-04-26 08:00:46

20010822_o01c_013219.pdf
Path: Stanford >> TMTA >> 1018 Fall, 2009
Description: 1 Joseph J. Tabacco, Jr. (75484) Jennifer S. Abrams (178203) 2 BERMAN DEVALERIO PEASE TABACCO BURT & PUCILLO 3 425 California Street, Suite 2025 San Francisco, CA 94104 4 Telephone: (415) 433-3200 Facsimile: (415) 433-6382 5 [Additional counsel on si...
Date Added: 2009-04-26 08:01:50

20040128_r01k_032102.pdf
Path: Stanford >> FLEX >> 1024 Fall, 2009
Description: US District Court Civil Docket as of 01/28/2004 US District Court for the Northern District of California 3:03cv2102 Mazansky et al v. Flextronics International Ltd et al Date Filed: 05/05/2003 Assigned To: Honorable Phyllis J Hamilton Referred To: ...
Date Added: 2009-04-26 08:02:55

TUE09.pdf
Path: Stanford >> C >> 000821 Fall, 2009
Description: XX International Linac Conference, Monterey, California TOWARDS RELIABLE ACCELERATION OF HIGH-ENERGY AND HIGH-INTENSITY ELECTRON BEAMS K. Furukawa and Linac Commissioning Groupy High Energy Accelerator Research Organization (KEK) Oho 1-1, Tsukuba, I...
Date Added: 2009-04-26 08:03:02

guide_citation.pdf
Path: Cornell >> ENGRC >> 335 Spring, 2008
Description: Guide to citing sources Writers use citation styles as a kind of code, enabling them to cite sources briefly in the text of their documents. That brief in-text citation is keyed to a bibliography, works cited list, or references list at the end of th...
Date Added: 2009-04-26 08:03:22

static_basics.txt
Path: Cornell >> CS >> 100 Fall, 2008
Description: / static0 DIS / Demos of class variables and class methods class Stuff { public static int k; public static void message() { System.out.println(\"I am not a number! I am a free man!\"); } } public class static_basics { public static ...
Date Added: 2009-04-26 08:07:25

200776_o01c_Lai.pdf
Path: Stanford >> BMY >> 1037 Fall, 2009
Description: UNITED STATES DISTRICT COURT SOUTHERN DISTRICT OF NEW YORK JEAN LAI, Individually and On Behalf of All Others Similarly Situated, CIVIL ACTION NO. Plaintiff, vs. CLASS ACTION COMPLAINT BRISTOL-MYERS SQUIBB COMPANY, PETER R. DOLAN and ANDREW R. J. B...
Date Added: 2009-04-26 08:07:33

200129_o01k_9816339.pdf
Path: Stanford >> ALSC >> 1010 Fall, 2009
Description: U.S. Court of Appeals Docket as of 02/09/2001 Retrieved from the court on 04/06/2006 General Docket US Court of Appeals for the Ninth Circuit Court of Appeals Docket #: 98-16339 Filed: 7/23/98 Nsuit: 3385 Property damage prod liab(Fed) Hockey, et al...
Date Added: 2009-04-26 08:09:53

200681_r01n_042182.pdf
Path: Stanford >> UHAL >> 1026 Fall, 2009
Description: UNITED STATES DISTRICT COURT DISTRICT OF ARIZONA In re AMERCO SECURITIES LITIGATION This Document Relates To: ALL ACTIONS. ) ) ) ) ) ) No. CIV-04-2182-PHX-RJB CLASS ACTION NOTICE OF PENDENCY AND PROPOSED SETTLEMENT OF CLASS ACTION IF YOU PURCHASED O...
Date Added: 2009-04-26 08:10:28

NHP-Chapter24.pdf
Path: Montana >> MTA >> 304 Fall, 2008
Description: ...
Date Added: 2009-04-26 08:12:20

topic7-nested.pdf
Path: Texas A&M >> AGECON >> 685 Fall, 2009
Description: Introduction to Computable General Equilibrium Model (CGE) Dhazn Gillig M University 1 Course Outline Overview of CGE An Introduction to the Structure of CGE An Introduction to GAMS Cast...
Date Added: 2009-04-26 08:17:55

geonics_app_trans_em_tech.pdf
Path: Washington University in St. Louis >> PDFS >> 454 Fall, 2009
Description: ...
Date Added: 2009-04-26 08:18:15

geonics_app_trans_em_tech.pdf
Path: Washington University in St. Louis >> EPSC >> 454 Fall, 2009
Description: ...
Date Added: 2009-04-26 08:18:15

Phil.pdf
Path: Wisconsin >> NOVEMBER >> 22000 Fall, 2009
Description: Optical Pellicles Optical Mask Modeling Update Mechanical Analysis of Fused Silica Pellicles M. Schlax, P. Reu, A. Mikkelson and L. Siewert Computational Mechanics Center Department of Mechanical Engineering University of Wisconsin - Madison Acknow...
Date Added: 2009-04-26 08:18:34

ERG_R_PR_10-30-2008.pdf
Path: Wisconsin >> BME >> 300 Fall, 2008
Description: ERG Recorder Team Members: Dan Jonovic Team Leader Andrew Dias BWIG Nick Balge BSAC Whitney Johnson Communications Professor Mitch Tyler Dr. Bikash Pattnaik Week 9: 10/24/08 10/30/08 Advisor: Client: Next meeting: 10/31/08, 12:05pm Problem Sta...
Date Added: 2009-04-26 08:18:36

COM-KSpace.ppt
Path: UMKC >> CS >> 551 Fall, 2009
Description: A COM implementation of the KSpace A `Knowledge Space prototype\' by Santhosh (vpanchap@hotmail.com) CST UMKC Presentation Layout The DAL system and the KSpace KSpace: COM and XML KSpace: Implementation details Start End The DAL System Introd...
Date Added: 2009-04-26 08:19:54

lecture5.pdf
Path: Arizona >> LING >> 388 Fall, 2008
Description: LING 388: Language and Computers Sandiway Fong Lecture 5: 9/8 Administrivia Reminder LING 388 Homework #1 due today Email submissions by midnight to sandiway@email.arizona.edu Need help? Office hour after this class Today\'s Topic Regular E...
Date Added: 2009-04-26 08:21:34

08-mosaics.pdf
Path: Wisconsin >> CS >> 638 Fall, 2008
Description: Making Mosaics Combining Images Goal: Create (large) images by putting many photographs together What Why When How Slide sources from A. Efros, S. Seitz, V. Vaish, M. Brown, D. Lowe, S. Lazebnik, P. Perez, R. Szeliski What: Photo Collages Wh...
Date Added: 2009-04-26 08:22:53

ch17.ppt
Path: Oregon State >> BA >> 440 Fall, 2008
Description: Financing Process 11/03/05 Financing Internal Financing funds raised from cash flows of existing assets External Financing funds raised from outside the company (VC, debt, equity, etc.) Internal vs. External Financing Firms may prefer intern...
Date Added: 2009-04-26 08:23:24

quiz05.pdf
Path: Maryville MO >> MTH >> 110 Fall, 2009
Description: Name: (1 pt) Date: Math 110 Quiz 5 Instructions: You must show all of your work. 1. Rewrite the following with out any exponents. (a) 42 (2 pts) (b) (2)5 (2 pts) 2. Simplify the expression, write your answer using positive exponents only. (a) (...
Date Added: 2009-04-26 08:24:12

Lecture13.pdf
Path: Toledo >> PHY >> 357 Fall, 2009
Description: ...
Date Added: 2009-04-26 08:24:29

101707.pdf
Path: Charleston Law >> CS >> 111 Fall, 2009
Description: Objectives Program Organization Introduction to Objects Working with text files Program Organization Larger programs require functions to maintain readability Use main() and other functions to break up your program into smaller, more manageable...
Date Added: 2009-04-26 08:24:42

problem_set_Answers_Homework_4.pdf
Path: Washington >> CHEM >> 142 Fall, 2008
Description: ...
Date Added: 2009-04-26 08:25:59

syl528.pdf
Path: Washington >> EE >> 528 Fall, 2009
Description: EE/MSE 528: Physics and Modeling of VLSI Fabrication Syllabus, Spring 2007 (Dunham) http:/dunham.ee.washington.edu/ee528 Review of IC Fabrication Processes (2 lectures; Chapters 1, 2, and 4) Basic Process Steps CMOS fabrication Self-aligned proce...
Date Added: 2009-04-26 08:27:00

42.1snook.pdf
Path: Johns Hopkins >> V >> 042 Fall, 2009
Description: 76 SEMINAR Reviews Beate Henn-Memmesheimer und David G. John, Hrsg. Cultural Link: Kanada Deutschland. Festschrift zum dreiigjhrigen Bestehen eines akademischen Austauschs. Mannheimer Studien zur Literatur- und Kulturwissenschaft 31. St. Ingbert: ...
Date Added: 2009-04-26 08:28:02

bp.ps
Path: Maryland >> CS >> 752 Spring, 2006
Description: %!PS-Adobe-2.0 %Creator: dvips(k) 5.92b Copyright 2002 Radical Eye Software %Title: bp.dvi %Pages: 11 %PageOrder: Ascend %BoundingBox: 0 0 612 792 %DocumentFonts: CMBX12 CMR12 CMMI12 CMSY10 CMMI8 CMTI12 CMR8 MSBM10 %+ CMEX10 CMSY8 CMMI6 CMSY6 %EndCom...
Date Added: 2009-04-26 08:28:29

3_4_13_BGS.pdf
Path: Western Kentucky University >> CHAPTER >> 3 Fall, 2009
Description: Bach Gen Studies The bachelor of general studies degree provides an alternative four-year program for nontraditional students who do not need or desire the academic specialization involved in traditional major or major/minor programs. This degree pr...
Date Added: 2009-04-26 08:30:07

horsecampletter1.doc
Path: LSU >> NR >> 55653 Fall, 2009
Description: February 6, 2009 Dear Horse Project Member and Parents, The LSU AgCenter Equine Educational Committee is offering North LA 4-H Horse Camp 2009. We will only be offering one camp this year. The North Louisiana 4-H Horse Camp will be held at the Ike Ha...
Date Added: 2009-04-26 08:30:35

370L6.pdf
Path: Michigan >> EECS >> 370 Fall, 2008
Description: 6. Instruction Set Architecture Translation software: linker, loader, etc. EECS 370 Introduction to Computer Organization Winter 2009 Prof. Todd Austin & Prof. Marios Papaefthymiou EECS Department University of Michigan, Ann Arbor, USA T. Austi...
Date Added: 2009-04-26 08:31:30

GEOG 204 11. Soils.pdf
Path: UMBC >> G >> 204 Fall, 2009
Description: 11. Soils A. Definition Soil = \"The naturally occurring, unconsolidated mineral or organic material at least 10 cm thick that occurs at the earth\'s surface and is capable of supporting plant growth.\" (CSSC manual) http:/sis.agr.gc.ca/cansis/ B. ...
Date Added: 2009-04-26 08:33:50

Lecture 08 - CHEM361.pdf
Path: St. Francis IL >> CHEM >> 361 Fall, 2009
Description: Electromagnetic spectrum FUND-14 How do molecules express their excitement? Formaldehyde Two non-bonding electron pairs on the oxygen bond on C=O Three bonds from carbon FUND-15 Molecular orbital diagram This diagram represents the groun...
Date Added: 2009-04-26 08:34:12

cmpt354a3solution.doc
Path: Sveriges lantbruksuniversitet >> CMPT >> 354 Fall, 2009
Description: 1) account number and balance of chequing (type \'CHQ\') accounts, order by account number select accnumber, balance from account where type = \'chq\' order by accnumber accnumber -2 3 5 6 7 11 13 14 15 17 20 21 23 24 28 29 30 31 33 34 38 39 41 42 45 46 ...
Date Added: 2009-04-26 08:35:46

Final-fall05.pdf
Path: Toledo >> CSC >> 207 Fall, 2009
Description: ...
Date Added: 2009-04-26 08:38:04

easy-pi.ps
Path: Toledo >> MATH >> 007 Fall, 2009
Description: %!PS-Adobe-2.0 %Creator: dvipsk 5.58f Copyright 1986, 1994 Radical Eye Software %Title: easy-pi2000.dvi %Pages: 4 %PageOrder: Ascend %BoundingBox: 0 0 612 792 %DocumentFonts: Times-Roman Symbol Times-Italic Times-Bold %DocumentPaperSizes: Letter %End...
Date Added: 2009-04-26 08:38:14

notes03.pdf
Path: Toledo >> PHY >> 138 Fall, 2009
Description: ...
Date Added: 2009-04-26 08:39:18

horab.pdf
Path: Toledo >> G >> 1988 Fall, 2009
Description: ...
Date Added: 2009-04-26 08:39:30

c456_syl.pdf
Path: Washington >> C >> 456 Fall, 2009
Description: Chemistry 456, Winter 2008 Thermodynamics University of Washington Instruction Hours: M, W, F 10:30 - 11:20 a.m. Bagley 260 Tutorial Hours: Thursday 10:30 - 11:20 a.m. Bagley 260 Tuesday 2:30 - 3:20 p.m. Bagley 261 Course Web Site: http:/courses.wash...
Date Added: 2009-04-26 08:39:41

final.pdf
Path: Washington >> MATH >> 402 Fall, 2008
Description: Name: Mathematics 402A Final December 15, 2004 Instructions: This is a closed book exam, no calculators allowed. You may use one sheet of notes (8.5 x 11, and either hand-written two-sided, or typed and single-sided). Justify all of your answers. Yo...
Date Added: 2009-04-26 08:40:55

astr5550_2009_hw3.pdf
Path: Colorado >> ASTR >> 5550 Fall, 2008
Description: ASTR 5550 - Spring 2009 1 Homework 3 Due Weds, 4 Feb, at the beginning of class. Reading Assignment: Finish reading Wall & Jenkins, Chapter 3 if you have not already done so. Optional supplemental reading: Press et al., Numerical Recipes, 3rd Ed., ...
Date Added: 2009-04-26 08:45:20

AAREADME.TXT
Path: UCLA >> CACHE >> 0004 Fall, 2009
Description: Sheet1 PDS_VERSION_ID = PDS3 RECORD_TYPE = STREAM OBJECT = TEXT PUBLICATION_DATE = 1995-07-01 NOTE = \"AAREADME.TXT describes this volume.\" END_OBJECT = TEXT END Volume GOMW_0004 Galileo Orbiter MWG Browse Data Collection Gaspra Flyby Planetary Plasma...
Date Added: 2009-04-26 08:46:48

datafile6.txt
Path: Binghamton >> CS >> 333 Fall, 2009
Description: 100 1 55 73 10 ...
Date Added: 2009-04-26 08:47:20

New_Resume.pdf
Path: Penn State >> FMN >> 108 Fall, 2009
Description: FRANCIS MAINA NGUGI 207 Berkley Drive Harrisburg, PA 17112 Telephone: (717) 657-3377 mailto:fngugi@yahoo.com Objective Complete an MBA in Accounting & Finance and be a Controller in five years time. Work Experience Bisys Insurance Services, A/R Anal...
Date Added: 2009-04-26 08:48:04

2009summercampapplication1.pdf
Path: LSU >> E >> 700774 Fall, 2009
Description: Concordia Parish Office 405 Carter Street Vidalia LA 71373 Ph.: 318-336-7084 Fax: 318-336-5832 WE MUST HAVE THE FORM BELOW COMPLETED PLEASE COMPLETE AND RETURN TO: Concordia 4-H OFFICE 405 CARTER STREET, VIDALIA, LA 71373 Concordia Parish 2009 - 4-...
Date Added: 2009-04-26 08:49:18

IO2004.pdf
Path: NYU >> POLITICS >> 5395 Fall, 2009
Description: Open-Door or Closed-Door? Transparency in Domestic and International Bargaining David Stasavage Abstract In recent years there have been numerous calls for making the operations of international organizations more transparent+ One element in these d...
Date Added: 2009-04-26 08:49:40

IO2004.pdf
Path: NYU >> AS >> 5395 Fall, 2009
Description: Open-Door or Closed-Door? Transparency in Domestic and International Bargaining David Stasavage Abstract In recent years there have been numerous calls for making the operations of international organizations more transparent+ One element in these d...
Date Added: 2009-04-26 08:49:40

Get Started With Course Hero Today!

Get study guides, join study groups, and more!
Sign up in seconds with your Facebook account!
Course Hero is a Facebook Application Partner.
Click below to sign-up for FREE.
 

Our Social Learning Network was built to provide students and key learning partners like professors a platform to share, meet and collaborate while accelerating their comprehension of course-related theories and concepts. We are committed to providing you immediate access to a growing wealth of study materials and an unparalleled academic network of students, professors and other key partners.

Why do you care? Because you want the best grade possible and at times need a 24/7 resource that’s responsive to your needs.

What People Are Saying About Course Hero

“I was going to fail my Evidence exam, but then I found a great outline on Course Hero!”
- Kim Cowan, Cornell University



“I worked for tens of hours on my chemistry lab reports this semester, and now I can publish my hard work to thousands of people who care to read about what I found.”
- David Grauer, Princeton University




“Many times, students learn best from other students, their peers, rather than from a teacher.  Course Hero provides such a forum for students to teach students.”
- Somerset Perry, Georgetown University


“Course Hero is a great new research tool for college students.  Students can find lots of pertinent information to their studies that they previously could not find or have access to.  It’s for sure an educational innovation and potentially an educational revolution.”
- Andy Suiter, UCLA and UC Davis



“As a freshman, Course Hero will help me to decide what I am actually interested in studying in college.”
- Caity Feindt, Ithaca College



“I have found lecture notes on corporate finance created by students from multiple schools, which has really helped me learn more about the subject.”
- John Stacey III, UCSB



“I study less and learn more with Course Hero.”
- John Sweazey, CU-Boulder



 

Explore the benefits of joining Course Hero's social learning network.

Get millions of study materials now!

Need lecture notes for a missed class or want insightful explanation of the theories and concepts you learn in class? Look no further, Course Hero’s Study Materials empowers you to find a broad and deep set of materials that can help you right now!

Click below to sign-up for FREE.
 

Get over 200,000 textbook solutions now!

Having difficulty with your homework and need documents that are relevant for your Textbook? Don't be frustrated. Course Hero's Textbook Help presents you study materials from many college courses.

Click below to sign-up for FREE.
 

Meet over 300,000 students and your fellow classmates now!

Want to meet your current classmates or those that took the class last year? Don’t worry or have anxiety. Course Hero’s Study Groups gives you the seamless opportunity to develop both anonymous or direct relationships with those classmates whom you want to meet and get help from right now!

Click below to sign-up for FREE.
 

Course Hero is not sponsored or endorsed by any college or university.