Course Solutions And Notes - 3b9ace17 3c
| 48770a79.pdf Path: Wisconsin >> WILL >> 0079 Fall, 2009 Description: ... Date Added: 2009-06-24 09:25:09 |
| 48770abf.pdf Path: Wisconsin >> WILL >> 0079 Fall, 2009 Description: ... Date Added: 2009-06-24 09:25:18 |
| 48770bb4.pdf Path: Wisconsin >> WILL >> 0079 Fall, 2009 Description: ... Date Added: 2009-06-24 09:26:09 |
| 487736a4.pdf Path: Wisconsin >> WILL >> 0091 Fall, 2009 Description: ... Date Added: 2009-06-24 09:26:36 |
| 487736ec.pdf Path: Wisconsin >> WILL >> 0091 Fall, 2009 Description: ... Date Added: 2009-06-24 09:26:50 |
| 487737ae.pdf Path: Wisconsin >> WILL >> 0091 Fall, 2009 Description: ... Date Added: 2009-06-24 09:26:56 |
| 4877370f.pdf Path: Wisconsin >> WILL >> 0091 Fall, 2009 Description: ... Date Added: 2009-06-24 09:27:49 |
| 31a5.pdf Path: Wisconsin >> WILL >> 0065 Fall, 2009 Description: ... Date Added: 2009-06-24 09:28:24 |
| 312e.pdf Path: Wisconsin >> WILL >> 0065 Fall, 2009 Description: ... Date Added: 2009-06-24 09:29:09 |
| 3046.pdf Path: Wisconsin >> WILL >> 0065 Fall, 2009 Description: ... Date Added: 2009-06-24 09:29:31 |
| 4877227f.pdf Path: Wisconsin >> WILL >> 0085 Fall, 2009 Description: ... Date Added: 2009-06-24 09:30:54 |
| 487784fb.pdf Path: Wisconsin >> WILL >> 0114 Fall, 2009 Description: ... Date Added: 2009-06-24 09:31:27 |
| 4877866a.pdf Path: Wisconsin >> WILL >> 0114 Fall, 2009 Description: ... Date Added: 2009-06-24 09:32:33 |
| 48778452.pdf Path: Wisconsin >> WILL >> 0114 Fall, 2009 Description: ... Date Added: 2009-06-24 09:32:41 |
| 48778456.pdf Path: Wisconsin >> WILL >> 0114 Fall, 2009 Description: ... Date Added: 2009-06-24 09:32:42 |
| 487701af.pdf Path: Wisconsin >> WILL >> 0076 Fall, 2009 Description: ... Date Added: 2009-06-24 09:35:20 |
| 4877003f.pdf Path: Wisconsin >> WILL >> 0076 Fall, 2009 Description: ... Date Added: 2009-06-24 09:35:38 |
| 48776cf7.pdf Path: Wisconsin >> WILL >> 0107 Fall, 2009 Description: ... Date Added: 2009-06-24 09:35:54 |
| 48776d9e.pdf Path: Wisconsin >> WILL >> 0107 Fall, 2009 Description: ... Date Added: 2009-06-24 09:36:10 |
| 3b9b38a7.pdf Path: Wisconsin >> WILL >> 0037 Fall, 2009 Description: ... Date Added: 2009-06-24 09:39:22 |
| 14b1.pdf Path: Wisconsin >> WILL >> 0056 Fall, 2009 Description: ... Date Added: 2009-06-24 09:41:18 |
| 135e.pdf Path: Wisconsin >> WILL >> 0056 Fall, 2009 Description: ... Date Added: 2009-06-24 09:41:55 |
| 3b9b10bf.pdf Path: Wisconsin >> WILL >> 0027 Fall, 2009 Description: ... Date Added: 2009-06-24 09:43:10 |
| examsol.pdf Path: Pittsburgh >> KS >> 112354 Fall, 2008 Description: UNIVERSITY OF PITTSBURGH JOSEPH M. KATZ GRADUATE SCHOOL OF BUSINESS INTRODUCTION TO DERIVATIVES Solutions to SAMPLE FINAL EXAMINATION QUESTION 1 (20 points): Consider a futures contract on the 90-day Treasury Bill. The contract has 120 days to expira... Date Added: 2009-06-24 09:43:38 |
| 48771d22.pdf Path: Wisconsin >> WILL >> 0084 Fall, 2009 Description: ... Date Added: 2009-06-24 09:44:44 |
| 48771d71.pdf Path: Wisconsin >> WILL >> 0084 Fall, 2009 Description: ... Date Added: 2009-06-24 09:44:53 |
| 48771de9.pdf Path: Wisconsin >> WILL >> 0084 Fall, 2009 Description: ... Date Added: 2009-06-24 09:45:12 |
| 48771e76.pdf Path: Wisconsin >> WILL >> 0084 Fall, 2009 Description: ... Date Added: 2009-06-24 09:45:43 |
| 48778fff.pdf Path: Wisconsin >> WILL >> 0117 Fall, 2009 Description: ... Date Added: 2009-06-24 09:46:41 |
| 3b9b5e54.pdf Path: Wisconsin >> WILL >> 0048 Fall, 2009 Description: ... Date Added: 2009-06-24 09:47:27 |
| 2dab.pdf Path: Wisconsin >> WILL >> 0064 Fall, 2009 Description: ... Date Added: 2009-06-24 09:48:33 |
| 2f2c.pdf Path: Wisconsin >> WILL >> 0064 Fall, 2009 Description: ... Date Added: 2009-06-24 09:49:46 |
| 48773aee.pdf Path: Wisconsin >> WILL >> 0092 Fall, 2009 Description: ... Date Added: 2009-06-24 09:50:43 |
| 48773afc.pdf Path: Wisconsin >> WILL >> 0092 Fall, 2009 Description: ... Date Added: 2009-06-24 09:50:45 |
| 3b9b5a70.pdf Path: Wisconsin >> WILL >> 0047 Fall, 2009 Description: ... Date Added: 2009-06-24 09:51:44 |
| 3b9b5acb.pdf Path: Wisconsin >> WILL >> 0047 Fall, 2009 Description: ... Date Added: 2009-06-24 09:51:55 |
| 3b9b5c10.pdf Path: Wisconsin >> WILL >> 0047 Fall, 2009 Description: ... Date Added: 2009-06-24 09:52:52 |
| 48779b37.pdf Path: Wisconsin >> WILL >> 0120 Fall, 2009 Description: ... Date Added: 2009-06-24 09:54:01 |
| 487703bd.pdf Path: Wisconsin >> WILL >> 0077 Fall, 2009 Description: ... Date Added: 2009-06-24 09:54:48 |
| 4877028e.pdf Path: Wisconsin >> WILL >> 0077 Fall, 2009 Description: ... Date Added: 2009-06-24 09:55:36 |
| 4877041f.pdf Path: Wisconsin >> WILL >> 0077 Fall, 2009 Description: ... Date Added: 2009-06-24 09:55:51 |
| 487762f3.pdf Path: Wisconsin >> WILL >> 0104 Fall, 2009 Description: ... Date Added: 2009-06-24 09:56:16 |
| 3b9aedb4.pdf Path: Wisconsin >> WILL >> 0007 Fall, 2009 Description: ... Date Added: 2009-06-24 09:57:16 |
| 3b9b0d9b.pdf Path: Wisconsin >> WILL >> 0026 Fall, 2009 Description: ... Date Added: 2009-06-24 09:58:32 |
| 16d7.pdf Path: Wisconsin >> WILL >> 0057 Fall, 2009 Description: ... Date Added: 2009-06-24 10:00:34 |
| 17a6.pdf Path: Wisconsin >> WILL >> 0057 Fall, 2009 Description: ... Date Added: 2009-06-24 10:00:42 |
| 48777aee.pdf Path: Wisconsin >> WILL >> 0111 Fall, 2009 Description: ... Date Added: 2009-06-24 10:01:33 |
| 48777c22.pdf Path: Wisconsin >> WILL >> 0111 Fall, 2009 Description: ... Date Added: 2009-06-24 10:02:41 |
| 48777cbe.pdf Path: Wisconsin >> WILL >> 0111 Fall, 2009 Description: ... Date Added: 2009-06-24 10:03:01 |
| 3b9ade90.pdf Path: Wisconsin >> WILL >> 0017 Fall, 2009 Description: ... Date Added: 2009-06-24 10:06:46 |
| 3b9ade94.pdf Path: Wisconsin >> WILL >> 0017 Fall, 2009 Description: ... Date Added: 2009-06-24 10:06:47 |
| 3b9b2cad.pdf Path: Wisconsin >> WILL >> 0034 Fall, 2009 Description: ... Date Added: 2009-06-24 10:08:49 |
| 48773d8c.pdf Path: Wisconsin >> WILL >> 0093 Fall, 2009 Description: ... Date Added: 2009-06-24 10:09:45 |
| 48773d7f.pdf Path: Wisconsin >> WILL >> 0093 Fall, 2009 Description: ... Date Added: 2009-06-24 10:09:45 |
| 48773dbe.pdf Path: Wisconsin >> WILL >> 0093 Fall, 2009 Description: ... Date Added: 2009-06-24 10:10:04 |
| 48773dc7.pdf Path: Wisconsin >> WILL >> 0093 Fall, 2009 Description: ... Date Added: 2009-06-24 10:10:06 |
| 48773e0b.pdf Path: Wisconsin >> WILL >> 0093 Fall, 2009 Description: ... Date Added: 2009-06-24 10:10:17 |
| 3b9ae1d0.pdf Path: Wisconsin >> WILL >> 0018 Fall, 2009 Description: ... Date Added: 2009-06-24 10:12:14 |
| 3b9ae3b6.pdf Path: Wisconsin >> WILL >> 0018 Fall, 2009 Description: ... Date Added: 2009-06-24 10:12:48 |
| 3b9b55fa.pdf Path: Wisconsin >> WILL >> 0046 Fall, 2009 Description: ... Date Added: 2009-06-24 10:13:53 |
| 3b9b58b8.pdf Path: Wisconsin >> WILL >> 0046 Fall, 2009 Description: ... Date Added: 2009-06-24 10:14:22 |
| 3b9b567a.pdf Path: Wisconsin >> WILL >> 0046 Fall, 2009 Description: ... Date Added: 2009-06-24 10:14:40 |
| 3b9b65d4.pdf Path: Wisconsin >> WILL >> 0050 Fall, 2009 Description: ... Date Added: 2009-06-24 10:15:31 |
| 3b9b68ec.pdf Path: Wisconsin >> WILL >> 0050 Fall, 2009 Description: ... Date Added: 2009-06-24 10:16:31 |
| 48779e8d.pdf Path: Wisconsin >> WILL >> 0121 Fall, 2009 Description: ... Date Added: 2009-06-24 10:18:43 |
| 4876f9ab.pdf Path: Wisconsin >> WILL >> 0074 Fall, 2009 Description: ... Date Added: 2009-06-24 10:19:29 |
| 4876f98c.pdf Path: Wisconsin >> WILL >> 0074 Fall, 2009 Description: ... Date Added: 2009-06-24 10:20:18 |
| 1a2a.pdf Path: Wisconsin >> WILL >> 0058 Fall, 2009 Description: ... Date Added: 2009-06-24 10:20:28 |
| 1bbf.pdf Path: Wisconsin >> WILL >> 0058 Fall, 2009 Description: ... Date Added: 2009-06-24 10:21:51 |
| 3b9ae91b.pdf Path: Wisconsin >> WILL >> 0006 Fall, 2009 Description: ... Date Added: 2009-06-24 10:22:31 |
| 3b9aee59.pdf Path: Wisconsin >> WILL >> 0021 Fall, 2009 Description: ... Date Added: 2009-06-24 10:24:21 |
| 3b9aee69.pdf Path: Wisconsin >> WILL >> 0021 Fall, 2009 Description: ... Date Added: 2009-06-24 10:24:22 |
| 33aa.pdf Path: Wisconsin >> WILL >> 0066 Fall, 2009 Description: ... Date Added: 2009-06-24 10:25:08 |
| 487718de.pdf Path: Wisconsin >> WILL >> 0082 Fall, 2009 Description: ... Date Added: 2009-06-24 10:27:21 |
| 487719e6.pdf Path: Wisconsin >> WILL >> 0082 Fall, 2009 Description: ... Date Added: 2009-06-24 10:27:28 |
| 487740ac.pdf Path: Wisconsin >> WILL >> 0094 Fall, 2009 Description: ... Date Added: 2009-06-24 10:28:12 |
| 3b9afba8.pdf Path: Wisconsin >> WILL >> 0010 Fall, 2009 Description: ... Date Added: 2009-06-24 10:29:53 |
| 3b9b2f5a.pdf Path: Wisconsin >> WILL >> 0035 Fall, 2009 Description: ... Date Added: 2009-06-24 10:31:03 |
| 4876fb39.pdf Path: Wisconsin >> WILL >> 0075 Fall, 2009 Description: ... Date Added: 2009-06-24 10:34:44 |
| 4876fbda.pdf Path: Wisconsin >> WILL >> 0075 Fall, 2009 Description: ... Date Added: 2009-06-24 10:35:12 |
| 4876fc13.pdf Path: Wisconsin >> WILL >> 0075 Fall, 2009 Description: ... Date Added: 2009-06-24 10:35:35 |
| 48775b45_x1a.pdf Path: Wisconsin >> WILL >> 0102 Fall, 2009 Description: ... Date Added: 2009-06-24 10:36:27 |
| 48775b89_x1a.pdf Path: Wisconsin >> WILL >> 0102 Fall, 2009 Description: ... Date Added: 2009-06-24 10:36:47 |
| 3b9ae6a9.pdf Path: Wisconsin >> WILL >> 0019 Fall, 2009 Description: ... Date Added: 2009-06-24 10:37:58 |
| 3b9ae50a.pdf Path: Wisconsin >> WILL >> 0019 Fall, 2009 Description: ... Date Added: 2009-06-24 10:38:20 |
| 3b9ae79f.pdf Path: Wisconsin >> WILL >> 0019 Fall, 2009 Description: ... Date Added: 2009-06-24 10:38:54 |
| 3b9b6a7b.pdf Path: Wisconsin >> WILL >> 0051 Fall, 2009 Description: ... Date Added: 2009-06-24 10:40:56 |
| 1c6a.pdf Path: Wisconsin >> WILL >> 0059 Fall, 2009 Description: ... Date Added: 2009-06-24 10:44:27 |
| 1cdb.pdf Path: Wisconsin >> WILL >> 0059 Fall, 2009 Description: ... Date Added: 2009-06-24 10:45:03 |
| 3b9adbaf.pdf Path: Wisconsin >> WILL >> 0005 Fall, 2009 Description: ... Date Added: 2009-06-24 10:46:55 |
| 3b9ae9c4.pdf Path: Wisconsin >> WILL >> 0020 Fall, 2009 Description: ... Date Added: 2009-06-24 10:48:05 |
| 3b9b25cd.pdf Path: Wisconsin >> WILL >> 0032 Fall, 2009 Description: ... Date Added: 2009-06-24 10:49:12 |
| 3b9b52f5.pdf Path: Wisconsin >> WILL >> 0045 Fall, 2009 Description: ... Date Added: 2009-06-24 10:50:57 |
| 3b9b53b2.pdf Path: Wisconsin >> WILL >> 0045 Fall, 2009 Description: ... Date Added: 2009-06-24 10:51:02 |
| syl410f04.pdf Path: NMT >> MATH >> 410 Fall, 2009 Description: Math 410 Numerical Methods for Scientists and Engineers Syllabus Course webpage: http:/www.nmt.edu/aitbayev/math410/ Term: Fall 2004 Description: Floating point arithmetic, solution of linear and nonlinear systems of equations, interpolation, numeri... Date Added: 2009-06-24 10:52:02 |
| 487797f5.pdf Path: Wisconsin >> WILL >> 0119 Fall, 2009 Description: ... Date Added: 2009-06-24 10:52:51 |
| 487745ec.pdf Path: Wisconsin >> WILL >> 0095 Fall, 2009 Description: ... Date Added: 2009-06-24 10:53:31 |
| 3b9aff23.pdf Path: Wisconsin >> WILL >> 0011 Fall, 2009 Description: ... Date Added: 2009-06-24 10:55:22 |
| 3b9b008a.pdf Path: Wisconsin >> WILL >> 0011 Fall, 2009 Description: ... Date Added: 2009-06-24 10:55:57 |
| 3b9b15fe.pdf Path: Wisconsin >> WILL >> 0028 Fall, 2009 Description: ... Date Added: 2009-06-24 10:58:49 |
| 3b9b15fb.pdf Path: Wisconsin >> WILL >> 0028 Fall, 2009 Description: ... Date Added: 2009-06-24 10:58:49 |
| 48772ff0.pdf Path: Wisconsin >> WILL >> 0089 Fall, 2009 Description: ... Date Added: 2009-06-24 11:00:55 |
| 48775e92_x1a.pdf Path: Wisconsin >> WILL >> 0103 Fall, 2009 Description: ... Date Added: 2009-06-24 11:03:15 |
| 3c8.pdf Path: Wisconsin >> WILL >> 0052 Fall, 2009 Description: ... Date Added: 2009-06-24 11:06:42 |
| 3cd.pdf Path: Wisconsin >> WILL >> 0052 Fall, 2009 Description: ... Date Added: 2009-06-24 11:06:43 |
| 487781df.pdf Path: Wisconsin >> WILL >> 0113 Fall, 2009 Description: ... Date Added: 2009-06-24 11:09:42 |
| Q01-Sol.pdf Path: St. Cloud >> CSCI >> 220 Fall, 2008 Description: CSCI 220: Computer Architecture I (Spring 2009) Instructor: Pranava K. Jha Solution to Quiz 1 1. Fill up the blanks. milli 1 = 10 -3 1000 one-thousandth one-millionth one-billionth one-trillionth one thousand one million one billion one trillion ... Date Added: 2009-06-24 11:09:55 |
| 4877830b.pdf Path: Wisconsin >> WILL >> 0113 Fall, 2009 Description: ... Date Added: 2009-06-24 11:11:08 |
| 3b9b2a1d.pdf Path: Wisconsin >> WILL >> 0033 Fall, 2009 Description: ... Date Added: 2009-06-24 11:11:34 |
| 3b9b2acb.pdf Path: Wisconsin >> WILL >> 0033 Fall, 2009 Description: ... Date Added: 2009-06-24 11:12:24 |
| 3b9b2b62.pdf Path: Wisconsin >> WILL >> 0033 Fall, 2009 Description: ... Date Added: 2009-06-24 11:13:00 |
| 3b9b4f72.pdf Path: Wisconsin >> WILL >> 0044 Fall, 2009 Description: ... Date Added: 2009-06-24 11:13:51 |
| 3b9b51b4.pdf Path: Wisconsin >> WILL >> 0044 Fall, 2009 Description: ... Date Added: 2009-06-24 11:14:39 |
| 3b9b03d6.pdf Path: Wisconsin >> WILL >> 0012 Fall, 2009 Description: ... Date Added: 2009-06-24 11:16:01 |
| 3b9b0394.pdf Path: Wisconsin >> WILL >> 0012 Fall, 2009 Description: ... Date Added: 2009-06-24 11:16:20 |
| 487779c6.pdf Path: Wisconsin >> WILL >> 0110 Fall, 2009 Description: ... Date Added: 2009-06-24 11:18:10 |
| 3b9ad6cc.pdf Path: Wisconsin >> WILL >> 0004 Fall, 2009 Description: ... Date Added: 2009-06-24 11:18:39 |
| 3b9ad60a.pdf Path: Wisconsin >> WILL >> 0004 Fall, 2009 Description: ... Date Added: 2009-06-24 11:19:07 |
| 3b9ad60c.pdf Path: Wisconsin >> WILL >> 0004 Fall, 2009 Description: ... Date Added: 2009-06-24 11:19:08 |
| 3b9af84a.pdf Path: Wisconsin >> WILL >> 0023 Fall, 2009 Description: ... Date Added: 2009-06-24 11:20:52 |
| 3b9af91a.pdf Path: Wisconsin >> WILL >> 0023 Fall, 2009 Description: ... Date Added: 2009-06-24 11:20:56 |
| 48774a12.pdf Path: Wisconsin >> WILL >> 0096 Fall, 2009 Description: ... Date Added: 2009-06-24 11:21:45 |
| 48774a37.pdf Path: Wisconsin >> WILL >> 0096 Fall, 2009 Description: ... Date Added: 2009-06-24 11:21:50 |
| 48774ae4.pdf Path: Wisconsin >> WILL >> 0096 Fall, 2009 Description: ... Date Added: 2009-06-24 11:22:15 |
| 487749f3.pdf Path: Wisconsin >> WILL >> 0096 Fall, 2009 Description: ... Date Added: 2009-06-24 11:22:56 |
| 4877485c.pdf Path: Wisconsin >> WILL >> 0096 Fall, 2009 Description: ... Date Added: 2009-06-24 11:23:01 |
| 55f.pdf Path: Wisconsin >> WILL >> 0053 Fall, 2009 Description: ... Date Added: 2009-06-24 11:26:21 |
| 3b9b4bc0.pdf Path: Wisconsin >> WILL >> 0043 Fall, 2009 Description: ... Date Added: 2009-06-24 11:30:18 |
| 3b9b4bee.pdf Path: Wisconsin >> WILL >> 0043 Fall, 2009 Description: ... Date Added: 2009-06-24 11:30:28 |
| 3b9b4cb9.pdf Path: Wisconsin >> WILL >> 0043 Fall, 2009 Description: ... Date Added: 2009-06-24 11:31:11 |
| 3b9b4d00.pdf Path: Wisconsin >> WILL >> 0043 Fall, 2009 Description: ... Date Added: 2009-06-24 11:31:24 |
| 3b9b4d2e.pdf Path: Wisconsin >> WILL >> 0043 Fall, 2009 Description: ... Date Added: 2009-06-24 11:31:27 |
| 2b13.pdf Path: Wisconsin >> WILL >> 0063 Fall, 2009 Description: ... Date Added: 2009-06-24 11:32:23 |
| 48774c5d.pdf Path: Wisconsin >> WILL >> 0097 Fall, 2009 Description: ... Date Added: 2009-06-24 11:36:22 |
| 48777e74.pdf Path: Wisconsin >> WILL >> 0112 Fall, 2009 Description: ... Date Added: 2009-06-24 11:43:28 |
| 48777f0f.pdf Path: Wisconsin >> WILL >> 0112 Fall, 2009 Description: ... Date Added: 2009-06-24 11:43:51 |
| 48777f05.pdf Path: Wisconsin >> WILL >> 0112 Fall, 2009 Description: ... Date Added: 2009-06-24 11:43:52 |
| 3b9ad1d8.pdf Path: Wisconsin >> WILL >> 0003 Fall, 2009 Description: ... Date Added: 2009-06-24 11:45:09 |
| 3b9ad36e.pdf Path: Wisconsin >> WILL >> 0003 Fall, 2009 Description: ... Date Added: 2009-06-24 11:46:07 |
| 3b9af4d2.pdf Path: Wisconsin >> WILL >> 0022 Fall, 2009 Description: ... Date Added: 2009-06-24 11:46:52 |
| 3b9af5b6.pdf Path: Wisconsin >> WILL >> 0022 Fall, 2009 Description: ... Date Added: 2009-06-24 11:47:01 |
| 3b9af52a.pdf Path: Wisconsin >> WILL >> 0022 Fall, 2009 Description: ... Date Added: 2009-06-24 11:47:34 |
| a90.pdf Path: Wisconsin >> WILL >> 0054 Fall, 2009 Description: ... Date Added: 2009-06-24 11:49:03 |
| a98.pdf Path: Wisconsin >> WILL >> 0054 Fall, 2009 Description: ... Date Added: 2009-06-24 11:49:19 |
| 3b9b4afe.pdf Path: Wisconsin >> WILL >> 0042 Fall, 2009 Description: ... Date Added: 2009-06-24 11:50:08 |
| cleanair.pdf Path: Syracuse >> PPA >> 745 Fall, 2009 Description: Clean Air in the U.S.: Cooperation, Compliance, Competition, and Complaint Background In 1970, the federal government established the Environmental Protection Agency (EPA) and began to take over a large part of the decision- making responsibility for... Date Added: 2009-06-24 11:51:36 |
| YHL009W-A.t2k.CB_burial_14_7-logo.pdf Path: UCSC >> YHL >> 009 Fall, 2009 Description: YHL009W-A.t2k CB_BURIAL_14_7 3 2 1 AAAAA AA A X B CAB ACB C BBBBBBCBBBCBBBAAX C C C C C C C C C D D D D D D D C D D D E D D D D X X X X X X X X X X X X A X AA X A D C X B B B B C A C A AA B A C E D D D X X X X X X B A A C A C C XX ABBBB... Date Added: 2009-06-24 11:52:24 |
| lect17-num_2up.pdf Path: Allan Hancock College >> CS >> 1021 Fall, 2009 Description: COMP1021/1721/2811: Computing 1B Number Systems COMP1021/1721/2811 c Maurice Pagnucco, UNSW, 2004 COMP1021/1721/2811 05s2 Number Systems 1 Number Systems We use a base 10 system for representing numbers and arithmetic The Sumerian culture used... Date Added: 2009-06-24 11:53:58 |
| q5sp09.pdf Path: SWCCD >> MATH >> 251 Fall, 2009 Description: ... Date Added: 2009-06-24 11:54:09 |
| Induction.pdf Path: Northern Virginia >> PHY >> 232 Fall, 2009 Description: INDUCTION AND D.C. POWER SUPPLY Induction is a phenomenon in which a changing magnetic field produces as emf (or voltage) in a coil of wire. In this laboratory we will investigate induction and see how it can be used in circuits. THEORY: When a magne... Date Added: 2009-06-24 11:54:42 |
| tablesace.pdf Path: Minnesota >> COURSES >> 5822 Fall, 2008 Description: COMPARISON OF APPROVED ACE INHIBITORS Generic Name Trade Name Captopril Capoten 1981 Squibb Enalapril Vasotec 1985 Merck Enalaprilat Vasotec I.V. Merck Lisinopril (1) Prinivil (2) Zestril 1987 (1) Merck (2) Stuart (3) Various No lisinopril carboxyl H... Date Added: 2009-06-24 11:55:45 |
| 016_Quiz_1_fl06.pdf Path: CC Philadelphia >> FACULTY >> 016 Fall, 2009 Description: Math 016 Quiz 1 Compute the following. Show all steps. 1. 2 + 3 5 Name_ 2. 3 23 6 3. 18 9 2 4. 6 5 - 2 ( 3 - 1) 5. ( 6 - 4 ) (12 2 3 - 5 ) 2 ... Date Added: 2009-06-24 11:56:35 |
| YMR172C-A.t2k.alpha-logo.pdf Path: UCSC >> YMR >> 172 Fall, 2009 Description: YMR172C-A.t2k ALPHA 2 1 EAAEEAEEEB A E E A B B H A B B B A B A S HHXXHH H H XXXXXXXXXXXXXXXIXXXHHXX X H H H 1 10 20 30 40 E 2 1 B H B H E B S B E B I B H E E C EEEEA A E E H B B S B B A B A H B HXXXHXXXAABXXEBXXEX H X X XXX XXB X B E H ... Date Added: 2009-06-24 11:57:20 |
| YMR168C.t2k.dssp-ehl2-logo.pdf Path: UCSC >> YMR >> 168 Fall, 2009 Description: YMR168C.t2k DSSP-EHL2 2 1 CCCC 1 C E H E E E E C X X X X X X X X X X X X X X 10 20 30 40 H 2 1 C CX X E H X X E H T S H T E 51 60 70 80 90 T 2 1 HH H T T T S H H H C H H C C C C H C C C C C C C C C C C C C H H H X X X X X X X... Date Added: 2009-06-24 11:59:11 |
| YMR105W-A.t2k.alpha-logo.pdf Path: UCSC >> YMR >> 105 Fall, 2009 Description: YMR105W-A.t2k ALPHA 2 1 D B EAAEEDS EEE A AA A B XXXXXXXX E EE C F B F BBBCII G B C H B S H S A C BAA BBTBBBB T XXXXXXXBXXXXX B E E H EEEEEE AAAAA X AE DS H C BC B D H H S D C H B E G A E B C F T E B T B D I E S C B H E F E E H H S D H C ... Date Added: 2009-06-24 11:59:30 |
| lab5.pdf Path: SUNY Stony Brook >> PHY >> 300 Fall, 2008 Description: PHYSICS 300 FALL 2006 LAB # 5 Polarization of Light Introduction In this experiment, we will study the effects of polarizing media on randomly polarized light from an incandescent bulb. Linear polarizing filters, dielectric reflecting surfaces an... Date Added: 2009-06-24 12:01:41 |
| hw3.pdf Path: NMT >> CS >> 373 Fall, 2009 Description: CS/IT 373 Introduction to Database Systems Home Work #3 DUE: 159pm. April 2, 2009 in class. Spring 2009 1. An ER diagram contains a ternary relationship records relating three entities musician, instrument, and song; an instance (m, i, s) means th... Date Added: 2009-06-24 12:02:39 |
| test1key.pdf Path: Tennessee >> MATH >> 323 Fall, 2009 Description: MATH 323 First Midterm Exam February 9, 2009 Name ID number 1. You order two pizzas from two pizza parlors, Morticia\'s and Gomez\'s. The probability that Morticia\'s delivers in 30 minites or less is .95 and the probability that Gomez\'s delivers in un... Date Added: 2009-06-24 12:07:05 |
| 471 syllabus.doc Path: Sveriges lantbruksuniversitet >> BISC >> 471 Fall, 2009 Description: Biological Sciences 471 Molecular Genetics 2002-3 Professor: Dr. E.M. Verheyen (everheye@sfu.ca) Office: SSB 8111, phone 291-4665 Prerequisites: BISC 331. Recommended prerequisites: BICH 221, BICH 222 Textbooks: Human Molecular Genetics, Peter Sudbe... Date Added: 2009-06-24 12:14:52 |
| aag mmqm.ppt Path: UCSB >> GEOG >> 275 Spring, 2008 Description: Spatial Analysis in a Communicating World Michael F. Goodchild University of California Santa Barbara The New Economy What are its fundamental principles? The computer as processing engine slave, servant, assistant, butler The computer as commu... Date Added: 2009-06-24 12:20:04 |
| MAT579.pdf Path: ASU >> STAT >> 579 Spring, 2009 Description: COLLEGE OF LIBERAL ARTS AND SCIENCES Department of Mathematics and Statistics COURSE ANNOUNCEMENT SPRING 2008 MAT 579 Functional Analysis II Instructor: Time: Location: Class #: Credit Hours: John Quigg 12:15 1:30 Tuesday & Thursday ECG 227 311... Date Added: 2009-06-24 12:22:42 |
| mean.pdf Path: ASU >> STAT >> 371 Fall, 2009 Description: MEAN VALUE JOHN QUIGG Our goal is to prove the following results: Critical Point Lemma. Let f : (a, b) R and t (a, b). If f has a max or a min at t, then f (t) is either 0 or does not exist. Mean Value Theorem. If f : [a, b] R is continuous, and ... Date Added: 2009-06-24 12:23:31 |
| test3.pdf Path: ASU >> STAT >> 371 Fall, 2009 Description: we QUI est Q Instructor: John Quigg hursdyD epril PU Problem Score 1 2 3 4 5 Overall ronor ttementX s hve not reeivedD nor will s giveD ny informtion regrding this exm efore it is returned grded y the instrutorF igned Time limit: IFS hours @WH min... Date Added: 2009-06-24 12:24:40 |
| homework02.pdf Path: ASU >> STAT >> 578 Fall, 2009 Description: MAT 578 HOMEWORK 2 JOHN QUIGG Prove: 1. RN is metrizable; 2. RN is not locally bounded: 3. RR is not metrizable. Date: September 2, 2005. 1 ... Date Added: 2009-06-24 12:24:50 |
| 14positiveintegral.pdf Path: ASU >> STAT >> 473 Fall, 2009 Description: MAT 473 Intermediate Real Analysis II John Quigg Integrating nonnegative functions Exercises 1. Let 0 be simple and c X. Prove that (x + c) dx = 2. Let 0 be simple. Prove that 3. Let f L+ and c X. Prove that f (x + c) dx = f. . Spring 2007 re... Date Added: 2009-06-24 12:25:31 |
| series.pdf Path: ASU >> STAT >> 579 Spring, 2009 Description: MAT 579 Lecture Notes John Quigg Series in Hilbert space Let H be a Hilbert space, and let {xi }iI be a subset of H. The series iI is identied with the following net: let F denote the family of all nite subsets of I, directed by inclusion, so that ... Date Added: 2009-06-24 12:26:04 |
| 2004_Practice_Problems_2.pdf Path: UCLA >> CHEM >> 144 Fall, 2008 Description: Chemistry 144 Practice Problems 2 Propose synthetic routes for the following transformations. O OH OH O O OH O O H O O O Et OH O ne enantiomer 1) 2) 3) O O 4) O O O OH O OH Ra ce mic Racemic OH O OH On e e nantiomer OH O O Me O O One ena ntiome r... Date Added: 2009-06-24 12:28:37 |
| excel.controlchart.pdf Path: Iowa State >> STAT >> 480 Fall, 2008 Description: An Excel spread sheet template for control charts Excel 97 does not have a built in statistical analysis tool for control charts. However, we can create an Excel spreadsheet template and use the Insert Chart to create them almost automatically. Our ... Date Added: 2009-06-24 12:35:52 |
| Ch07-CreatePivotTable.xls Path: Utah >> URPL >> 5010 Fall, 2009 Description: Month Sales Person ID January Jones 255-133 January Jones 255-133 January Andrews 255-253 January Andrews 355-253 January Jones 255-133 January Jones 255-133 January Smith 275-264 January Smith 275-264 January Parker 525-356 January Parker 525-356 Ja... Date Added: 2009-06-24 12:36:40 |
| Annual Expenses.xls Path: Utah >> URPL >> 5010 Fall, 2009 Description: Monthly Expenses Rent Groceries Fuel Electricity Child Care Misc. Total January $750.00 $214.00 $75.00 $87.00 $110.00 $175.00 1,411.00 February 750 311 88 89 110 145 1,493.00 March 750 245 90 99 110 123 1,417.00 April 750 256 79 103 110 211 1,509.00 ... Date Added: 2009-06-24 12:36:41 |
| README-RDQL-tests.txt Path: UMKC >> CS >> 5560 Fall, 2009 Description: This is the RDQL/Jena test suite from the Jena distribution. The URI for RDQL is http:/jena.hpl.hp.com/2003/07/query/RDQL. It is provided so that other implementations of RDQL can get the test suite without needing the whole Jena distribution and to... Date Added: 2009-06-24 12:43:38 |
| winhw3ans.pdf Path: Washington >> M >> 124 Fall, 2009 Description: U l p e ` l V ` QSvSrd3T2QjY7xstV oU2A jsiV `V p` oUgsCdgA9gbx`{p vV joc2g7dgyx`wp vV u` swW ` V X pep | z ` Vt X u V U UT lp | ` sgsV oUgggvSheXg2pA s}iYjsV `v lT fv lX Vc lX p ` Ue lTp p p | vzcve le vu ` g3TA9e ~}yx`{pwV3ggsSryx`... Date Added: 2009-06-24 12:46:26 |
| chem329_fall2003_finalexam_p1_key.pdf Path: Wisconsin >> CHEM >> 329 Fall, 2008 Description: ... Date Added: 2009-06-24 13:05:50 |
| lecture_notes2.ps Path: Iowa State >> CS >> 673 Fall, 2009 Description: %!PS-Adobe-2.0 %Creator: dvips(k) 5.86 Copyright 1999 Radical Eye Software %Title: lecture_notes2.dvi %Pages: 4 %PageOrder: Ascend %BoundingBox: 0 0 596 842 %EndComments %DVIPSWebPage: (www.radicaleye.com) %DVIPSCommandLine: dvips lecture_notes2 -o l... Date Added: 2009-06-24 13:09:31 |
| YLR262C.t2k.CB_burial_14_7-logo.pdf Path: UCSC >> YLR >> 262 Fall, 2009 Description: YLR262C.t2k CB_BURIAL_14_7 3 2 1 AAAAAAAA C C C C C X 1 10 20 30 40 A 3 2 1 C D D B E FG FD D F EGFDEFDBA DA DBDE DE ED C EXDEEEEX C D D C F C D B X X X X X X X X X X X X D B B F E A B ECD C AAAB B X FGF D BB AECEEGFG CD G F X ... Date Added: 2009-06-24 13:13:36 |
| Guide4.pdf Path: MNSU >> BIO >> 274 Fall, 2009 Description: BIO 274-01 Study Guide Exam 4 Students should understand and be able to explain the following key points: Root System Root structure Root function Types of root systems Zones of the root and their funtions Primary meristems elaborated from the RAM... Date Added: 2009-06-24 13:17:35 |
| sol_ch4c.pdf Path: UPenn >> STAT >> 430 Fall, 2008 Description: ... Date Added: 2009-06-24 13:18:14 |
| final.ps Path: Michigan State University >> PHY >> 231 Fall, 2008 Description: %!PS-Adobe-2.0 %Creator: dvipsk 5.55a Copyright 1986, 1994 Radical Eye Software %Title: 173336438.dvi %Pages: 2 %PageOrder: Ascend %BoundingBox: 0 0 612 792 %EndComments %DVIPSCommandLine: dvips -q 173336438.dvi -o %DVIPSParameters: dpi=600, compress... Date Added: 2009-06-24 13:19:06 |
| mtsol.ps Path: Toledo >> CSC >> 324 Fall, 2009 Description: %!PS-Adobe-2.0 %Creator: dvips(k) 5.86 Copyright 1999 Radical Eye Software %Title: mt.dvi %Pages: 5 %PageOrder: Ascend %BoundingBox: 0 0 612 792 %EndComments %DVIPSWebPage: (www.radicaleye.com) %DVIPSCommandLine: dvips -t letter mt.dvi -o mt.ps %DVIP... Date Added: 2009-06-24 13:20:11 |
| M243-TA3.pdf Path: Maryville MO >> MTH >> 243 Fall, 2009 Description: Math 243: Spring 2006 Solutions to Test 3 1. We estimate 2 R 2 (2 + xy ) dA i=1 j =1 f (xi , yj ) A = [f (1/2, 1) + f (3/2, 1) + f (1/2, 3) + f (3/2, 3)]A 3 1 1 1 = 2 (2 + 1) + (2 + 1) + (2 + 3) + (2 + 3) 2 2 2 2 = 2 16 = 32 2. 2 0 0 2 0 0 l... Date Added: 2009-06-24 13:23:46 |
| YKL009W.t2k.stride-ebghtl-logo.pdf Path: UCSC >> YKL >> 009 Fall, 2009 Description: YKL009W.t2k EBGHTL 3 2 1 T C C T T H C E H C H H E C H H E H C C T T B X X X X XXXBXHGGCTHTTCTCXXX X X X X X CCC TTTCCC C TT TT G X GT C TG X CC T H T X X CH H X X X X X HHH 20 1 10 30 40 T 3 2 1 T T H H T E T H HHHHHHHHH X X ... Date Added: 2009-06-24 13:26:49 |
| FinalInt.doc Path: UMKC >> CS >> 451 Fall, 2009 Description: System Integration Tests System Name: RA Bloch Online Cancer Support Page Integration Tests Foreword: All tests assume that all subsystem modules have completed, and passed unit testing. 1.1 Integrate SNI with Individual Subsystem Interfaces SI. As... Date Added: 2009-06-24 13:27:18 |
| Scene_Review.doc Path: Penn State >> SZM >> 142 Fall, 2009 Description: Scene Review: Indigo By Samantha Mayer The two-block line, five dollar cover and couple hundred rhythmically challenged college students do not live up to this sweat fest\'s hot hype. The Daily Collegian carries enticing ads for Indigo, the new club ... Date Added: 2009-06-24 13:35:55 |
| chapter4outline.pdf Path: North Central State College >> PSY >> 130 Fall, 2009 Description: Detailed Chapter Outline with Key Terms Chapter 4: The Study of Human Development Focus: Helen Keller and the World of the Senses CHILDBIRTH AND CULTURE: HOW BIRTHING HAS CHANGED THE BIRTH PROCESS Labor: Contractions of the uterus during childbirth... Date Added: 2009-06-24 13:37:44 |
| hw2.pdf Path: Minnesota >> MATH >> 1151 Fall, 2008 Description: 3.2 Homework (February 4, 2004) 22. Graph f (x) = (x + 2)4 3 using transformations. Solution: Start with the graph of y = x4 (black curve). Shift the graph two units to the left, giving y = (x + 2)4 (green curve). Shift the graph down three units ... Date Added: 2009-06-24 13:39:38 |
| ELEC3700_P0.pdf Path: Allan Hancock College >> ELEC >> 3700 Fall, 2009 Description: ELEC3700 Robotics GFW/28.7.02 Problem 0 - Designing robotic systems Objectives To start participants thinking about the type of sub-systems required to develop complete robotic systems. To introduce participants to a real engineering exercise. T... Date Added: 2009-06-24 13:40:35 |
| thekingoftarp04072009.doc Path: Penn State >> RXC >> 122 Fall, 2009 Description: APRIL 7, 2009 Bailout Man Turns the Screws By DEBORAH SOLOMON WASHINGTON - Late on New Year\'s Eve, James Lambright, a Treasury Department official, sat waiting impatiently for documents to arrive from Citigroup Inc. He\'d just been told by the bank... Date Added: 2009-06-24 13:42:06 |
| chap7_ho2_new_york.xlsx Path: FIU >> CH >> 2518 Fall, 2009 Description: NewYork New York Qtr 1 Breakfast Sales 275000 Lunch Sales 200000 Dinner Sales 1100000 Qtr 2 20000 200000 1200000 Qtr 3 30000 300000 1300000 Qtr 4 40000 400000 1400000 Page 1 ... Date Added: 2009-06-24 13:42:43 |
| McGraw - Candidate Evaluations.pdf Path: North-West Uni. >> JND >> 260 Fall, 2009 Description: Candidate Impressions and Evaluation Kathleen M. McGraw Department of Political Science The Ohio State University mcgraw.36@osu.edu *Very Preliminary* draft. Please do not distribute or cite. Note: Thanks to Sarah Bryner for research assistance. [B... Date Added: 2009-06-24 13:43:39 |
| 6%20-%20BradyVSPERHandout.pdf Path: UT Chattanooga >> CHM >> 121 Fall, 2009 Description: REPRESENTATIVE VSEPR STRUCTURES AX6 AX5E AX4E2 Bonding Domains Nonbonding Domains Hybridization Octahedral 6 0 sp3d2 AX5 Square pyramidal 5 1 sp d 3 2 Square planar 4 2 sp d 3 2 AX4E AX3E2 AX2E3 Bonding Domains Nonbonding Domains Hybridiza... Date Added: 2009-06-24 13:45:28 |
| Ch9Practice.pdf Path: Glendale Community College >> CHM >> 150 Spring, 2008 Description: CHM 150: Practice Problems for Chapter 9 1. White phosphorus, P4, is prepared by fusing calcium phosphate with carbon, C, and sand, SiO2, in an electric furnace: 2 Ca3(PO4)2 (s) + 6 SiO2 (s) + 10 C (s) P4 (g) + 6 CaSiO3 (l) + 10 CO (g) a. Excess ... Date Added: 2009-06-24 13:46:34 |
| HaoTang_JointBoosting.pdf Path: Lake County >> ECE >> 598 Fall, 2009 Description: Joint Boosting - Sharing Features for Multiclass Object Detection Hao Tang Based on A. Torralba, K. Murphy and W.T. Freeman, \"Sharing visual features for multiclass and multiview object detection,\" CSAIL technote, 2004 Agenda Motivation Fundamentals... Date Added: 2009-06-24 13:49:16 |
| project.pdf Path: Lake County >> ECE >> 489 Fall, 2009 Description: ECE 489 Robot Dynamics and Control Final Project, Spring, 2007 Due Dates: 1. April 27, 2007: Due date to have nal project proposal approved by me. 2. May 11, 2007: Due date for nal project report. Procedure: 1. Identify a research article from the l... Date Added: 2009-06-24 13:51:14 |
| lab6.pdf Path: Lake County >> ECE >> 435 Fall, 2009 Description: Laboratory Assignment 6: Independent Project Instructor: B. W. Wah ECE 435 Spring 2008 University of Illinois, Urbana-Champaign Assigned: April 1, 2008 Final Report and Demonstration Due: May 8 1 Specications In the nal course project, you will s... Date Added: 2009-06-24 13:51:43 |
| NRL_FORMULARY_02.pdf Path: Lake County >> ECE >> 458 Fall, 2009 Description: 2002 REVISED NRL PLASMA FORMULARY J.D. Huba Beam Physics Branch Plasma Physics Division Naval Research Laboratory Washington, DC 20375 Supported by The Oce of Naval Research 1 CONTENTS Numerical and Algebraic Vector Identities . . . . . . . . . ... Date Added: 2009-06-24 13:51:52 |
| Lecture8.pdf Path: UCSB >> ECE >> 124 Fall, 2009 Description: ECE 124A VLSI Principles Lecture 8 CMOS Inverters: Delay, Power and Sizing Prof. Kaustav Banerjee Electrical and Computer Engineering E-mail: kaustav@ece.ucsb.edu Lecture 8, ECE 124A, VLSI Principles Kaustav Banerjee Propagation Delay Lecture 8... Date Added: 2009-06-24 13:59:23 |
| Exp1-Scale-Conv2.pdf Path: Bethel VA >> CHE >> 418 Fall, 2009 Description: ... Date Added: 2009-06-24 14:07:45 |
| berg_home230.pdf Path: Harford CC >> PHOTO >> 230 Fall, 2009 Description: What I Call Home Caitlin Berg Caitlin Berg 2008 ... Date Added: 2009-06-24 14:08:03 |
| H193 W02 D03A LECT - Modeling (Hawn)a.ppt Path: Ohio State >> EG >> 193 Fall, 2009 Description: Engineering H193 - Team Project Modeling Week 2 Day 3 Spring Quarter Gateway Engineering Education Coalition P. 1 Engineering H193 - Team Project Modeling What is a model? Why should your group think about creating a model? Spring Quarter ... Date Added: 2009-06-24 14:10:15 |
| hw2.ps Path: Duke >> MATH >> 123 Fall, 2009 Description: %!PS-Adobe-2.0 %Creator: dvips(k) 5.86 Copyright 1999 Radical Eye Software %Title: hw2.dvi %Pages: 1 %PageOrder: Ascend %BoundingBox: 0 0 612 792 %EndComments %DVIPSWebPage: (www.radicaleye.com) %DVIPSCommandLine: dvips -o hw2.ps hw2 %DVIPSParameters... Date Added: 2009-06-24 14:12:36 |
| outline.ps Path: Maryland >> ASTR >> 120 Fall, 2008 Description: %!PS-Adobe-2.0 %Creator: dvipsk 5.58f Copyright 1986, 1994 Radical Eye Software %Pages: 1 %PageOrder: Ascend %BoundingBox: 0 0 612 792 %DocumentPaperSizes: Letter %EndComments %DVIPSCommandLine: dvips -f %DVIPSParameters: dpi=1200, comments removed %... Date Added: 2009-06-24 14:12:45 |
| 487proj1.ps Path: University of Louisiana at Lafayette >> INTERVAL >> 487 Fall, 2009 Description: %!PS-Adobe-2.0 %Creator: dvips(k) 5.86 Copyright 1999 Radical Eye Software %Title: 487proj1.dvi %CreationDate: Tue Feb 05 09:51:38 2002 %Pages: 1 %PageOrder: Ascend %BoundingBox: 0 0 596 842 %DocumentFonts: CMR12 CMBX12 CMTI12 CMR10 CMTT10 CMMI12 CMS... Date Added: 2009-06-24 14:13:41 |
| ViolaDM_05.pdf Path: Indiana >> MUSIC >> 100 Fall, 2009 Description: School of Music Indiana University For students entering the D.M. program in the School of Music: Fall 2005 through Summer 2007 Requirements for: Doctor Of Music Viola Current students may obtain an up-to-date degree audit using OneStart, http:/one... Date Added: 2009-06-24 14:14:40 |
| FluteDM_05.pdf Path: Indiana >> MUSIC >> 100 Fall, 2009 Description: School of Music Indiana University For students entering the D.M. program in the School of Music: Fall 2005 through Summer 2007 Requirements for: Doctor Of Music Flute Current students may obtain an up-to-date degree audit using OneStart, http:/one... Date Added: 2009-06-24 14:14:40 |
| T0331.t06.dssp-ebghstl-logo.pdf Path: UCSC >> T >> 0331 Fall, 2009 Description: T0331.t06 dssp-ebghstl 3 2 1 CCHHHHHHH T EEEEE T C X H X X X X X X X T T S S T G C X X X X X X X HT CCE H SS G H G C X X X S S E T T C S X X X X X X X X X X X E TS SC T C CE C CESCTS CCCEEEC S E EE C T C C C C T T T C H E G X X X X X X X... Date Added: 2009-06-24 14:14:43 |
| implAssignment.txt Path: Georgia Tech >> CS >> 3302 Fall, 2009 Description: Second team assignment Grade: 15% course grade. Due date: Thu Feb 26 In this assignment, you will complete a partial detailed design, implement it fully and hold reviews that you summarize in short reports. Detailed requirements for the assignment ... Date Added: 2009-06-24 14:17:40 |
| CS543 Lecture 1.ppt Path: Western Kentucky University >> CS >> 543 Fall, 2008 Description: CS 543: Computer Information Systems Design Introduction Dr. Huanjing Wang January 23, 2008 CS 543 Lecture 1 1 Outline Get to know each other Course information Syllabus DB foundations January 23, 2008 CS 543 Lecture 1 2 Myself Huanjing Wan... Date Added: 2009-06-24 14:19:16 |
| hw7.pdf Path: UCSB >> ECE >> 235 Fall, 2008 Description: Department of Electrical & Computer Engineering University of California, Santa Barbara ECE 235 Fall 2007 Shynk H.O. #19 HOMEWORK #7 Due Friday, December 7, 2007 (5:00 p.m.)(last one!) Final Exam: Friday, December 14, 7:30 10:30 p.m. (open book, ... Date Added: 2009-06-24 14:19:32 |
| Lamiaceae.pdf Path: Iowa State >> BIO >> 366 Fall, 2009 Description: ... Date Added: 2009-06-24 14:24:31 |
| EmailAssignment.pdf Path: Western Michigan >> BCM >> 1420 Fall, 2008 Description: E-Revolution: E-mail Assignment Like the Industrial Revolution at the turn of the 18th century, the e-revolution is changing the structure of the economy at the turn of the 21st century. As more and more businesses incorporate e-technology into their... Date Added: 2009-06-24 14:31:15 |
| KAP1967 Frequencies.pdf Path: Berkeley >> KAP >> 1967 Fall, 2009 Description: ICPSR Inter-university Consortium for Political and Social Research Knowledge, Attitudes, and Practice of Contraception in Taiwan: Second Province-Wide Fertility Survey (KAP II), 1967 Frequencies L.P Chow, Hsiao-Chang Chen, and Ming-Cheng Chang . ... Date Added: 2009-06-24 14:31:59 |
| COSTUMES_AND_MASKS.doc Path: Appalachian State >> FACULTY >> 5636 Fall, 2009 Description: COSTUMES AND MASKS D ressing up in masks and costumes is one of the most entertaining customs of the Purim holiday. Children in particular enjoy dressing up as the characters found in the Scroll of Esther, including K ing Ahashverosh, Vashti, Queen E... Date Added: 2009-06-24 14:36:29 |
| POMSposting.doc Path: Berkeley >> ATT >> 0174 Fall, 2009 Description: OPERATIONSMANAGEMENTADJUNCTFACULTYPOSITIONS Creative.Caring.Committed. UniversityofMarylandUniversityCollege(UMUC)isseekingtalented facultytochallengestudentsinoneofhighereducation\'smostdynamic learningenvironments. UMUCishiringparttimeadjunctandfull... Date Added: 2009-06-24 14:37:32 |
| 2004624_r01x_0415863.pdf Path: Stanford >> PCQ >> 1043 Fall, 2009 Description: -._. _ ._ . . A CIIRTIFIED MUM COPY .;\',1 21 \' \'.ftl J111)1CfAL PANFU ON WiLTIOISTRICT UTiGATION JUNFI-LE2D 2004 CLERK\'S OFHCE . - - :._ /71/211~te,-._ -\"_) _ 4 .41 giliF:. 4 .4.: A I Fief!\' ANN .: \' _. AI i\'l 1 . -3004- - -. - ... Date Added: 2009-06-24 14:38:20 |
| 610 syllabus 2006.pdf Path: Winthrop >> EDCI >> 610 Fall, 2009 Description: Blackburn, EDCI 610 EDCI 610Early Adolescence in Contemporary Society Department of Curriculum and Instruction Winthrop University, Richard W. Riley College of Education Fall, 2006 Instructor: Barbara R. Blackburn, Ph.D. Office Location: 208 Withers ... Date Added: 2009-06-24 14:44:36 |
| 466ClassExercise4-DomainClassSkaterTest.doc Path: CSU Fullerton >> SYS >> 466 Fall, 2009 Description: SYS466 InClass Exercise: Domain Class Diagram HD Update One Test Record Actor Select Add Test on Maintain Skater Test Menu. Select a skater name System Retrieve skater names and display Maintain Test page with a drop down list of skaters names. Retr... Date Added: 2009-06-24 14:44:48 |
| santaclaus.pdf Path: University of Hawaii - Hilo >> GEOG >> 494 Fall, 2008 Description: Postmodern Tourism: The Santa Claus Industry Postmodernism Consumption, rather than production, becomes dominant Consumption of images and signs, rather than material objects Symbolic commodities and the stimulation of desire Commodity dominant i... Date Added: 2009-06-24 14:52:26 |
| Multiplying and Dividing Integers.doc Path: Pima CC >> ECC >> 200910 Fall, 2009 Description: 2.4 Multiplying and Dividing Integers Even and Odd Is zero an even, an odd or neither? Multiplication is repeated addition. Right? 8 times 7 is 8 + 8 +8 +8 +8 +8 +8 +8 or 7+7 +7+7 +7+7 +7+7 Look at this pattern: 3*4 = 12 2*4 = 8 1*4 = 4 0*4 = 0 -1*... Date Added: 2009-06-24 14:53:53 |
| w9b.pdf Path: National Taiwan University >> G >> 683 Fall, 2009 Description: Geography 683 Introduction to Geographic Analysis Correlation Variables Previously we have examined only one attribute (variable) for an observation What if we are interested in two? y and x Professor Alan Murray Department of Geography 1136 Der... Date Added: 2009-06-24 14:59:36 |
| memo.txt Path: California State University, Monterey Bay >> CS >> 450 Fall, 2009 Description: MEMO.txt for hw6. Huynh Dung Anh The following is the test that i have used: MEval=> (define f (lambda( x) (lambda(y) (cons (g x) y) (define g (lambda ( (dynamic z) (cons z 4) (define x 1) (define h (f 2) (h 5) f MEval=> g MEval=> x MEval=> h ... Date Added: 2009-06-24 15:06:15 |
| hw2.pdf Path: Acton School of Business >> ELEC >> 563 Fall, 2009 Description: ELEC 563 / PHYS 563 Fall 2003 Tuesday, September 9, 2003 Problem Set No. 2 Due Date: 5 PM, Tuesday, September 16, 2003 1. Chemical Potential in Two Dimensions (10 points) Show that the chemical potential of a Fermi gas in two dimensions is given ... Date Added: 2009-06-24 15:12:29 |
| lect17.pdf Path: Maryland >> CMSC >> 212 Fall, 2005 Description: Announcements G G Program #4 Exam Thursday todays material is not on the exam G Tuesday, November 8 9:30 section moving to CSIC 2117 (11:00 will be here but there will be a 106 exam in this room so dont walk in early) G Reading Notes (Today... Date Added: 2009-06-24 15:14:14 |
| finalcomplete.doc Path: MSOE >> EM >> 650 Fall, 2009 Description: Final Project Knowledge Management Milwaukee School of Engineering Managing Information Systems EM 650S Submitted by: Sean Moran Submitted to: Greg Chapman Date: 5/24/03 Table of Contents Executive Summary..2 Topic Statement: .3 Knowledge Managem... Date Added: 2009-06-24 15:14:27 |
| Exam3_Solutions.pdf Path: College of Idaho >> M >> 112 Fall, 2009 Description: ... Date Added: 2009-06-24 15:22:26 |
| s05-finsol.pdf Path: SUNY Stony Brook >> MAT >> 127 Summer, 2008 Description: ... Date Added: 2009-06-24 15:24:41 |
| iupac.pdf Path: NSCC >> CHEM >> 121 Fall, 2009 Description: Simplified IUPAC nomenclature rules for organic compounds Find base name 1. Find the longest continuous chain of carbons (carbon-carbon bond chain). This is the main chain. Find the appropriate alkane name that describes the main chain: this is the b... Date Added: 2009-06-24 15:26:36 |
| Sampling.ppt Path: San Diego State >> PEOPLE >> 690 Fall, 2009 Description: Review the main ideas Research is the process of trying to answer a question empirically. LinesofResearch Research Research Lines Lines What does the Research Say? What do you Want to do? What lines of Research help You? Reading a Research ... Date Added: 2009-06-24 15:28:32 |
| q0r92_sol.pdf Path: SUNY Stony Brook >> MAT >> 125 Summer, 2008 Description: MAT125.R92: QUIZ 0 SOLUTIONS No score will be assigned for this quiz. The graph of the function f (x) is given below: 1 1 (a) Determine the domain and range of f (x). Domain: 4 < x < 1 and 1 < x < 4 (or, in other notations, (4, 1) and (1, 4). We ... Date Added: 2009-06-24 15:30:45 |
| lecture9.pdf Path: Mich Tech >> CM >> 5300 Spring, 2008 Description: ... Date Added: 2009-06-24 15:40:03 |
| PR_Job_2.doc Path: UF >> WRITING >> 3254 Fall, 2009 Description: YOUR Name: Job Applicant Name: GRADE= _(1-10 points): In the boxes to the right, fill in at least two sentences responding to the directions/questions on the left. Give these sheets to the people whose project you are reviewing. Feel free to add addi... Date Added: 2009-06-24 15:40:40 |
| hw4s.pdf Path: UC Davis >> MAT >> 135 Fall, 2008 Description: ... Date Added: 2009-06-24 15:40:48 |
| receptiontmenuoptions.pdf Path: UAB >> GROUP >> 154 Fall, 2009 Description: At Augustana we offer a variety of menu options. Our meals are served as an all-you-can-eat single entre buffet. We are happy to discuss special dietary requirements, however, patrons are responsible to make appropriate choices for their specic circu... Date Added: 2009-06-24 15:40:49 |
| HW 7.doc Path: Texas El Paso >> CE >> 3343 Fall, 2008 Description: vti_encoding:SR|utf8-nl vti_timelastmodified:TR|07 Apr 2004 00:38:06 -0000 vti_extenderversion:SR|5.0.2.2623 vti_backlinkinfo:VX| ... Date Added: 2009-06-24 15:44:09 |
| result_laser_side_699211.ps Path: Stanford >> SOI >> 071003 Fall, 2009 Description: %!PS-Adobe-3.0 %BoundingBox: 0 0 566 765 %Title: Graphics produced by IDL %For: couvidat@n02.Stanford.EDU, /auto/scr20/couvidat/HMI/CPT %Creator: IDL Version 6.4 (linux x86_64 m64) %CreationDate: Sun Oct 14 14:07:53 2007 %DocumentData: Clean7bit %Req... Date Added: 2009-06-24 15:46:19 |
| self-test-review-cs1114-funcs-fall07-AK.doc Path: Cal Poly >> CS >> 1114 Fall, 2009 Description: self-test REVIEW NOT A COMPLETE OR THOROUGH STUDY SPRING 07 We do not give practice tests. This is a sample of some of the things that they are responsible for they should not believe that if they know all the things on this test that they will get... Date Added: 2009-06-24 15:52:11 |
| eameshouse.pdf Path: Wentworth >> ARCH >> 228 Fall, 2009 Description: 01 TECTONICS - ARCH 228 NAME: ANGELA NGO DATE: OCTOBER 27, 2008 EAMES HOUSE CHARLES AND RAY EAMES The Eames House (Case Study #8) was part of the Case Study program during the mid-twentieth century. The goal was to design modern, efficient homes th... Date Added: 2009-06-24 16:01:16 |
| Midterm.pdf Path: SUNY Stony Brook >> MAT >> 303 Summer, 2008 Description: MAT303 Midterm Show all work. IF YOU ARE USING A FORMULA, WRITE IT DOWN AND EXPLICITLY SHOW ALL SUBSITUTIONS. Clearly box your answer. 1. i) Is the equation exact? ii) Find the general solution. You may leave the answer in implicit form. (a) (2xy 5y... Date Added: 2009-06-24 16:01:52 |
| c1908.txt Path: Wisconsin >> ECE >> 556 Spring, 2001 Description: 880 1498 33 25 913 pri 2 0 pri 2 0 pri 2 0 pri 2 0 pri 2 0 pri 2 0 pri 2 0 pri 2 0 pri 2 0 pri 2 0 pri 2 0 pri 2 0 pri 2 0 pri 2 0 pri 2 0 pri 2 0 pri 3 0 pri 2 0 pri 3 0 pri 2 0 pri 2 0 pri 2 0 pri 2 0 pri 3 0 pri 2 0 pri 2 ... Date Added: 2009-06-24 16:08:31 |
| ProjectSD.doc Path: ECCD >> BUSINESS >> 42541 Fall, 2009 Description: Eric Sprott School of Business -Carleton University 42.541 e-Business Architecture SAP R/3 Term Assignment (Updated 2002-03-18) Winter 2002 Introduction SAP R/3 is the worlds leading Enterprise Resource Planning (ERP) system, integrating in real-ti... Date Added: 2009-06-24 16:14:05 |
| Walk.xls Path: Penn State >> JUG >> 187 Fall, 2009 Description: Walk and Rock Music First Quarter Rock-It MP3 Sales Video Mini Micro Flash Accessories Total Northeast Southeast Midwest South West Total $66,145.15 $79,677.10 $34,657.66 $52,517.20 $99,455.49 Total 31,375.24 82,937.72 66,137.50 30,681.82 43,595.24 2... Date Added: 2009-06-24 16:16:53 |
| MisperceptionsSciLiteracy.pdf Path: Texas A&M >> GEOL >> 641 Fall, 2008 Description: ... Date Added: 2009-06-24 16:18:08 |
| notes1.pdf Path: Purdue >> EE >> 264 Fall, 2009 Description: Multidimensional Arrays Each pair of brackets adds a dimension to an array. Examples: int a1[S1] - one dimensional array int a2[S1][S2] - two dimensional array int a3[S1][S2][S3] - three dimensional array The number of elements in a k-dimensional arr... Date Added: 2009-06-24 16:19:29 |
| last_cycle.txt Path: University of Illinois, Urbana Champaign >> ATMOS >> 2007080300 Fall, 2009 Description: <a href=\"././2007080200/MM5a/\">Last</a> ... Date Added: 2009-06-24 16:19:38 |
| Amy Stearns.doc Path: Charleston Law >> BU >> 468 Fall, 2009 Description: A Three-Wave Study of Total Quality Management This article focuses on the process of change involved in implementing TQM, including employees experiences, the impact of employee participation and their commitment to the organization. TQM has come un... Date Added: 2009-06-24 16:19:51 |
| syllabus119.pdf Path: N. Arizona >> MAT >> 244 Fall, 2009 Description: Northern Arizona University College of Engineering and Natural Sciences Department of Mathematics and Statistics MAT 119: Finite Mathematics Section 802, Class 2570 Summer 2009 Instructor: Jessica Baumgartel E-mail: jrs244@nau.edu Website: dana.ucc.... Date Added: 2009-06-24 16:22:44 |
| Radiofrequency.pdf Path: Cornell >> BEE >> 4530 Fall, 2009 Description: BEE 453 : COMPUTER AIDED ENGINEERING Project Project Report Radiofrequency Ablation to kill Kidney Tumors Submitted by Manish Sharma, Tim Lafrance, Richard Ducharme, Kristin Taylor, Nicholas Wobbrock May 2003 Executive Summary and Motivation Rad... Date Added: 2009-06-24 16:23:51 |
| hw4.pdf Path: Stevens >> CS >> 601 Fall, 2009 Description: Algorithmic Complexity CS601A Fall 2005 Prof. Rebecca N. Wright Homework 4 Due: December 1, 2005 If at all possible, please use an appropriate text-processing package to write up your solutions, such as LaTeX or MS-Word. If necessary, you may leave ... Date Added: 2009-06-24 16:24:01 |
| Resume_Kristen M Hlopick.pdf Path: Penn State >> KMH >> 326 Fall, 2009 Description: KRISTEN MARIE HLOPICK, LEED AP Local address: 825 South Allen Street, Apt #8 State College, PA 16801 (814) 282-5431 Objective: Education: kmh326@psu.edu Permanent address: 25841 East Spring Road Springboro, PA 16435 (814) 587-6086 To obtain a full ... Date Added: 2009-06-24 16:24:05 |
| ATC_1000els.txt Path: University of Illinois, Urbana Champaign >> CS >> 2779 Fall, 2009 Description: <!DOCTYPE html PUBLIC \"-/W3C/DTD XHTML 1.0 Strict/EN\" \"http:/www.w3.org/TR/xhtml1/DTD/xhtml1-strict.dtd\"> <html xmlns=\"http:/www.w3.org/1999/xhtml\" lang=\"en\" xml:lang=\"en\"> <head> <title>Changeset 2779 for meshing/trunk/sdgfem_1D/physics/inp... Date Added: 2009-06-24 16:25:48 |
| ferne_saem_2006_bic_agenda_final_051806_revised_090606.pdf Path: Ill. Chicago >> SAEM >> 0506 Fall, 2009 Description: FERNE Brain Injury Course: Treating ED Patients with CNS Illness and Injury Time: Location: Objectives: To review the educational objectives, format, case presentations, and diagnosis & treatment procedures that are included in the FERNE Brain Injury... Date Added: 2009-06-24 16:36:37 |
| homework 3 Path: Temple >> PHYSICS >> 2201 Spring, 2009 Description: narainswamy (ann452) HW3 Mackie (20211) This print-out should have 16 questions. Multiple-choice questions may continue on the next column or page find all choices before answering. 001 (part 1 of 2) 10.0 points A car travels 29 km due north and ... Date Added: 2009-06-24 16:39:23 |
| Practice_Midterm.doc Path: UNC Greensboro >> ISM >> 110 Fall, 2008 Description: 1. The _ performs actual calculations and is often called the \"brain\" of the computer. (a) Motherboard (b) Memory (c) Central processing unit (CPU) (d) Input devices (d) None of these answers are correct 11. 12. Which statement pertaining to viruse... Date Added: 2009-06-24 16:39:26 |
| Chem 255 Assignment 04.doc Path: St. Francis IL >> CHEM >> 255 Fall, 2009 Description: CHEM255 Assignment04 Due:Feb19th,2004 1. WhyistheDglucopyranoseformofglucosemoreabundantthan theDglucopyranoseinaqueoussolution? 2. DrawtheHaworthprojectionforthefollowingcompounds: a) b) DGlucopyronosyl(16)Dglucopyranose Acompoundfoundinthe... Date Added: 2009-06-24 16:53:13 |
| Ind Assignment Two.doc Path: UPenn >> COMM >> 522 Fall, 2009 Description: Communication 522 Second Assignment Please answer each of the following questions. Submit your answers to Dr. Delli Carpini by 9:00 a.m. on October 3. We will review and discuss the questions in class October 4. 1. Researchers are concerned that lo... Date Added: 2009-06-24 16:54:38 |
| Simpmax.xls Path: St. Francis IL >> MATH >> 205 Fall, 2009 Description: Solving a Simple Max Problem using Excel Find the maximum of -x2 + 2x + 5 x= target cell = 5 0 Cell to represent the variable Cell represents the equation. Making sure to start the formula with an equal sign and using full mathematical notation, such... Date Added: 2009-06-24 16:54:39 |
| YPL178W.t2k.w0.5-logo.pdf Path: UCSC >> YPL >> 178 Fall, 2009 Description: YPL178W.t2k w0.5 4 3 2 1 D S F XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX A A V V L A A I S I H G K D G R K D EE A S D K L K R L N D L G N K R I L V V L P K S A K E R E P A K Q S X XX E K E X X L XXXX A A L X S X XX XXVX K T R N S ... Date Added: 2009-06-24 17:08:30 |
| YPL179W.t2k.stride-ebghtl-logo.pdf Path: UCSC >> YPL >> 179 Fall, 2009 Description: YPL179W.t2k EBGHTL 3 2 1 CC X CCCCTTTTTTCCCCTTTTTCTT TTTTTTCCCCCCTTTTCCCCCTCC X XXXXXX X XX XXX E E E X X X G X E E X X G X H T C C H H C C H H H H H C H C H H H H H C T T H T H T T T T H H T T T T T T H H H C T C T C H C C T T C H C C X X X... Date Added: 2009-06-24 17:09:25 |
| ZGlennAyeleGetachew1.pdf Path: UNLV >> CEE >> 301 Fall, 2008 Description: ... Date Added: 2009-06-24 17:09:48 |
| BIintro.ppt Path: Maryland >> GEOG >> 440 Fall, 2009 Description: Introduction to Barrier Islands Found largely along trailing edge continental margins -spits can be found anywhere Low lying coastal plains are the ideal physiographic framework Sand source: muddy coasts, etc., generally not conducive Dominant w... Date Added: 2009-06-24 17:11:12 |
| Baseball_salaries.doc Path: El Paso CC >> MATH >> 243 Fall, 2009 Description: Five Number Summaries and Determining Outliers 1 $300,000 2 $300,500 3 $301,000 4 $301,000 5 $302,000 6 $303,000 7 $303,000 8 $305,000 9 $305,000 10 $308,000 11 $310,000 12 $310,000 13 $312,000 14 $326,000 15 $334,000 16 $340,000 17 $342,500 18 $342,... Date Added: 2009-06-24 17:15:28 |
| homework2.pdf Path: Oregon State >> HW >> 632 Fall, 2009 Description: MTH 632 ASSIGNMENT 2 Due: 02/01/2008 Reading: Sections 53 - 55 in Munkres. 1. Show that every covering map is a local homeomorphism, an open map, and a quotient map. Show that an injective covering map is a homeomorphism. 2. Show that a nite produc... Date Added: 2009-06-24 17:15:36 |
| Art10Lesson10.doc Path: Laurentian >> DAY >> 3601 Fall, 2009 Description: Subject: Art 10 Unit: Acrylic Painting Topic: Artwork Critique and Composition Analysis Lesson: Ten Duration: One Period Date: April 2nd, 2004 At the end of this lesson students will: 1. Describe what they see within their composition and their peers... Date Added: 2009-06-24 17:20:41 |
| 985.txt Path: UNC >> DOCS >> 985 Fall, 2009 Description: The Project Gutenberg EBook of Father Sergius, by Leo Tolstoy This eBook is for the use of anyone anywhere at no cost and with almost no restrictions whatsoever. You may copy it, give it away or re-use it under the terms of the Project Gutenberg Li... Date Added: 2009-06-24 17:25:26 |
| 3827.txt Path: UNC >> DOCS >> 3827 Fall, 2009 Description: Project Gutenberg\'s The Days Before Yesterday, by Lord Frederick Hamilton This eBook is for the use of anyone anywhere at no cost and with almost no restrictions whatsoever. You may copy it, give it away or re-use it under the terms of the Project ... Date Added: 2009-06-24 17:27:15 |
| Econ136_Lecture1.ppt Path: UPenn >> ECON >> 136 Fall, 2009 Description: Law &Economics (Econ136) John A. Del Roccili, Ph.D. Contact Information s E-mail: delrocc@econsult.com I always check my e-mail during the week unless I am out of town which you are likely to know). So, this is a sure bet. Phone: 215-898-8471 - ... Date Added: 2009-06-24 17:27:30 |
| YML100W-A.t2k.str2-logo.pdf Path: UCSC >> YML >> 100 Fall, 2009 Description: YML100W-A.t2k STR2 3 2 1 CC Z Z E H XXXXHXXXXXXXXXXCXXXXXXXXXXXXXXX X S Y H H H C C C ZCCCTCS S Z H H S CC Y HAAH SZZMZZZYYAA ZZZH H TTCCMQMY HAHHAH C CTAQ H C Y X AAAAAAA YZY H C S C H Y E P Q Y C A Z Z C M Z E A Z Z C H Z C Y C H H H Y ... Date Added: 2009-06-24 17:31:52 |
| Group Members.doc Path: N. Georgia >> MESUBL >> 2834 Fall, 2009 Description: Group Members: Megan Sublett, Nicole Alexander, Summer Gilliam, Allison Martin _ _ Group Project Lesson Plan Lesson Plan Title: Developed by: Subject Area: Grade Level: Purpose of the Activity: Learning Objectives (include at least one Georgia QCC o... Date Added: 2009-06-24 17:37:37 |
| hw4.pdf Path: Moravian >> CS >> 120 Fall, 2009 Description: Name: Section: Homework HW4 Due: Friday, October 17th Write a small (12 pp) essay on the pair-programming exercise we did for lab 5. Your essay should be reective in nature, and include your thoughts on the following topics. Who was your partner? ... Date Added: 2009-06-24 17:38:52 |
| a4.pdf Path: UMass (Amherst) >> C >> 24725 Fall, 2009 Description: ECE 7250 Information Theory Assignment 4 (due 7 November) 1. Consider a message source, whose output at time n is a discrete random variable Xn , taking values in the set {0, 1, 2}. Furthermore sequence of outputs {Xn } n=- from this source is a Mark... Date Added: 2009-06-24 17:41:11 |
| o12.doc Path: Kean >> ID >> 1400 Fall, 2009 Description: Mina Guirguis ID 1400 1) Electronic toll collections: This presentation talks about electronic toll collections and how the identifacation number is read and sent to a roadside reader. The information stored in these tags are fixed. These tags hold ... Date Added: 2009-06-24 17:42:00 |
| hw3.ps Path: Case Western >> EECS >> 425 Fall, 2009 Description: %!PS-Adobe-2.0 %Creator: dvips(k) 5.86 Copyright 1999 Radical Eye Software %Title: hw3.dvi %Pages: 1 %PageOrder: Ascend %BoundingBox: 0 0 596 842 %EndComments %DVIPSWebPage: (www.radicaleye.com) %DVIPSCommandLine: dvips -o hw3.ps hw3.dvi %DVIPSParame... Date Added: 2009-06-24 17:42:12 |
| Test Of Problem Solving (TOPS-2).pdf Path: Wisc Stevens Point >> JVANH >> 524 Fall, 2009 Description: CommunicativeDisorder735 September29,2008 JenniferVanHulle TOPS2Adolescent Manufacturer\'sAddress: LinguiSystems Inc. 31004th Avenue EastMoline,IL61244 8005774555 RetailPrice:$169.95 Additionaltestforms:$41.95 http:/www.linguisystems.com/itemdetail.... Date Added: 2009-06-24 17:42:16 |
| sequences.pdf Path: Concordia Chicago >> MATH >> 163 Fall, 2008 Description: Sheet 1: Sequences Ian Biringer and John Lind The aim of this sheet is to start discussing sequences. Denition 1 A sequence of real numbers is a function from N = {0, 1, 2, . . . } to R. A sequence of real numbers is denoted as (an ) where an R is i... Date Added: 2009-06-24 17:47:53 |
| p4.txt Path: UNF >> P >> 6616 Fall, 2009 Description: User\'s Guide to the p4 Parallel Programming System * This is both the reference manual and the User\'s Guide for the p4 parallel programming system. It contains definitions of all functions for both C and Fortran, examples, a brief tutorial, and dis... Date Added: 2009-06-24 17:56:53 |
| Midterm1_sols.pdf Path: Michigan >> EECS >> 312 Fall, 2008 Description: EECS312 Fall 2007 Midterm 1 Solution Problem 1 Note that capacitances and delays have nothing to do with VTC! a) b) c) d) No effect. VTC shifts right. VTC shifts left. Can never be the same since tpLH = 0.69RpC, tpHL = 0.69(Rp|Rn)C, Rp would have to ... Date Added: 2009-06-24 17:58:06 |
| locate-example2.ps Path: Princeton >> CS >> 226 Fall, 2009 Description: ... Date Added: 2009-06-24 18:00:21 |
| Bonnie Earnest Software Assignment.doc Path: N. Georgia >> BLEARN >> 2220 Fall, 2009 Description: Software Evaluation Bonnie Earnest Go to the website for the text, www.scsite/tdc4/ and then go to each chapter( chapters 1-8). Click on Software Corner There will be 5 or 6 descriptions of different software and a link to the company that produces t... Date Added: 2009-06-24 18:03:44 |
| SSRD_QR_LCA_F05A_T19.xls Path: USC >> CSCI >> 577 Fall, 2009 Description: 3cb68e6b87e7d797665b5dde47fe52a784182094.xls - Areas of Concern Log ProjectName: Team19:eBayNotificationSystem Artifact: SSRD Module: LCAdraft MBASE Phase/level: Activity: ExitCriteria: IprovementfromLCOCoresubmission ReviewLeader: AmerMalik ReviewLe... Date Added: 2009-06-24 18:04:02 |
| HST423Fall2007.pdf Path: ASU >> HST >> 423 Fall, 2009 Description: History 423: The Tudor Monarchy (78510) Manzanita Hall, Room 001 MW 1:40-2:55 Professor: Retha M. Warnicke Office Hours: Office Location: Coor 4460 MWF 11:00-ll:30 Phone: 480-727-6489 e-mail rwarnicke@asu.edu web site: http:/www.public.asu.edu/~ier... Date Added: 2009-06-24 18:06:21 |
| YBL101W-B.t2k.str2-logo.pdf Path: UCSC >> YBL >> 101 Fall, 2009 Description: CC T TTC C C C CCC HC C SSSB CSSSCCCSSSSSTTTTCCTTTSTTTTZCGS C T CCCCSCCSSSSSS C H C C C CSSSHHHHHHSC C S G H T H T T T H S C C C G H X XXXXXXTTTXSSXTTXXXTXXXX X X X X X XX X XHGXTGSXXXGCXXXHXXXXHXX X X X X X G Y Z H H CCC B T H H G G X X CCCC... Date Added: 2009-06-24 18:10:48 |
| Ch20.rtf Path: Dallas >> FIN >> 6301 Fall, 2008 Description: Chapter 20: Long-Term Debt 20.1 When you purchase a bond on a day other than a coupon payment date, there will be an adjustment in the actual price paid. Since coupons are paid in arrears, you can think of them as earned monthly, but paid at the end ... Date Added: 2009-06-24 18:11:20 |
| CentralAsiaAS.doc Path: DePaul >> GEO >> 100 Fall, 2009 Description: Name_ Person#_ Geography100 Quiz5CentralAsia MapQuiz:Answerthefollowingquestionsbasedonthemapandplacelist. Inallcases,usethenumbersontheplacelisttofillintheblanksbelow.DO NOTwriteplacenamesonthissheettheywillbemarkedincorrect. 1. BodyofwaterAis_2(C... Date Added: 2009-06-24 18:13:38 |
| lab618_4.pdf Path: Oregon >> PH >> 618 Fall, 2009 Description: 618 Lab 4: JFET Circuits 4.1 Introduction This lab consists of a a short introduction to one member of the FET technology family, the JFET. Although most integrated circuits are based on MOSFETs, JFETs are often used in discrete circuits because t... Date Added: 2009-06-24 18:14:17 |
| mathlesson.xls Path: N. Illinois >> Z >> 095460 Fall, 2009 Description: Last Name First Name Quiz 1 Quiz 2 Quiz 3 Test 1 Test 2 Gordon Waltrip Harvick Labonte Labonte Wallace Martin Kenseth Johnson Bliss Total Average Maximum Minimum Jeff Michael Kevin Bobby Terry Rusty Mark Matt Jimmy Mike 18 17 14 20 13 15 16 17 20 17 ... Date Added: 2009-06-25 18:17:30 |
| quizlab5.ppt Path: Georgia Tech >> CEE >> 200202 Fall, 2009 Description: EngineeringGraphics EngineeringGraphics Lab #5 Quiz 1. Use your personal title block, and 2. Generate the dimensioned, third-angle multiview (f,t,r) CAD drawing on the handout. 3. Print your results on the SEB laserjet. 4. Make your first print atte... Date Added: 2009-06-25 18:20:41 |
| HD23625.24.preplot.p16.1140.ps Path: Cal Poly Pomona >> A >> 12004 Fall, 2009 Description: ... Date Added: 2009-06-25 18:21:43 |
| HD23625.bigplot.ps Path: Cal Poly Pomona >> A >> 12004 Fall, 2009 Description: ... Date Added: 2009-06-25 18:21:52 |
| handouts.pdf Path: East Los Angeles College >> SD >> 103 Fall, 2009 Description: Numerical Methods for Natural Sciences IB Introduction Numerical Methods Natural Sciences Tripos 1B Lecture Notes Lent Term 1999 Stuart Dalziel Department of Applied Mathematics and Theoretical Physics University of Cambridge Phone: (01223) 337911... Date Added: 2009-06-25 18:24:21 |
| ilx12z.txt Path: University of Illinois, Urbana Champaign >> ATMOS >> 20090225 Fall, 2009 Description: UPPER AIR CALCULATIONS AND PLOTTING (Ver 5.48.1-LINUX-X11) Current filename: /mnt/noaaport/nwstg/convert/09022500_upa.wxp Date: 0000Z 25 FEB 09 Searching for KILX. Searching the city database file for: KILX . Date:0000Z 25 FEB 09 Station: KILX... Date Added: 2009-06-25 18:27:24 |
| YIL071C.t2k.w0.5-logo.pdf Path: UCSC >> YIL >> 071 Fall, 2009 Description: YIL071C.t2k w0.5 2 1 M L L Y V H I A I V 1 10 20 30 40 S H 2 1 ELLVEE I L V V I T E T H E S E I XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX I A V GL PV R L I LLN I I V V S S S I A L V Q I K LVG PHF L Y I I I I A A V V V ... Date Added: 2009-06-25 18:28:53 |
| YIL071W-A.t2k.dssp-ehl2-logo.pdf Path: UCSC >> YIL >> 071 Fall, 2009 Description: YIL071W-A.t2k DSSP-EHL2 2 1 CCC 1 E X X X 10 20 30 40 E 2 1 HH X X H C H X X X E T H C C C C X X X X X HH 60 H CX C C C C C C C C C C C C C C C C X X X X X X X HHHHHHHHHHH X X X X X X X X C C X X X C X CC H C X X X H X H H H H... Date Added: 2009-06-25 18:29:24 |
| homewk4.pdf Path: Penn State >> GEOSCI >> 561 Fall, 2009 Description: GEOSCI 561: Homework #4 (Carbonate equilibria revisited) Due: Friday, Feb. 13 Lets return to the problem discussed in Homework #2, namely, the uptake of fossil fuel CO2 by the surface ocean. In the previous homework, we calculated the present equili... Date Added: 2009-06-25 18:30:26 |
| SylSummer2006.rtf Path: S.F. State >> ECON >> 535 Fall, 2009 Description: ECON/URBS 535 Summer 2005 URBAN ECONOMICS Prof. Michael Potepan Phone: 415/338-2833 Fax: 415/338-1057 e-mail: mpotepan@sfsu.edu Office location: Office hours: 146 HSS M: 5.00 - 6.00 pm W: 5.30 - 6.00 pm REQUIRED TEXT Urban Economics. Arthur O\'Sulli... Date Added: 2009-06-25 18:30:39 |
| ws_week9.pdf Path: Sveriges lantbruksuniversitet >> D >> 201 Fall, 2009 Description: Agenda Review of the next assignment. Paper prototyping and Wizard-of-OZing. Assignment 3 hand-back. IAT 201 Week 9 Daniel Ha dha2@sfu.ca Overview of your next four major assignments 2. Conceptual models and generating alterative designs Assig... Date Added: 2009-06-25 18:32:04 |
| financialStatementFraudandCorporateGovernance.pdf Path: SUNY Albany >> ACC >> 695 Fall, 2009 Description: ! ! ! ,-)ABBC)D/($(-/$7)5\"\'\"(\")G*;\"%($(-\") ! H%*#*9\"E)F$9-%/##$%01#-%... Date Added: 2009-06-25 18:33:00 |
| prog3.pdf Path: UPR Mayagüez >> ICOM >> 4015 Fall, 2009 Description: Universidad de Puerto Rico Recinto Universitario de Mayagez ICOM 4015: Programacin Avanzada Tercer Proyecto de Programacin: VoidSpace1 Fecha de entrega: 18 de diciembre de 2008 11:59PM En este proyecto trabajars en parejas El objetivo del proyecto e... Date Added: 2009-06-25 18:34:02 |
| jcrvn10.txt Path: UNC >> DOCS >> 2954 Fall, 2009 Description: Project Gutenberg Etext of Return to Venice, by Jacques Casanova #4 in our series by Jacques Casanova de Seingalt Copyright laws are changing all over the world, be sure to check the laws for your country before redistributing these files! Please t... Date Added: 2009-06-25 18:35:54 |
| exam_info.ppt Path: Western Kentucky University >> PSY >> 321 Fall, 2008 Description: average Multiple choice 41.8 (70%) range 18 - 56 Essay 20.9 (52%) 0 - 39.5 Total After curve 62.8 64.8 18 - 95.5 20 - 97.5 ... Date Added: 2009-06-25 18:41:17 |
| hw3.ps Path: Washington University in St. Louis >> CS >> 201 Fall, 2008 Description: %!PS-Adobe-2.0 %Creator: dvipsk 5.58f Copyright 1986, 1994 Radical Eye Software %Title: hw3.dvi %Pages: 2 %PageOrder: Ascend %BoundingBox: 0 0 612 792 %EndComments %DVIPSCommandLine: dvips hw3.dvi -o %DVIPSParameters: dpi=300, compressed, comments re... Date Added: 2009-06-25 18:52:04 |
| Class 27 Notes.pdf Path: Oregon State >> PH >> 203 Spring, 2008 Description: A review of diffraction of sound waves. Loudspeaker A has a rectangular aperture that is 4 cm wide. Loudspeaker B has a circular aperture that is 4 cm in diameter. In general, which speaker will disperse a given sound frequency more widely? 1. 2. 3.... Date Added: 2009-06-25 18:54:28 |
| swb_fit0.txt Path: Berkeley >> ASTRO >> 00173780 Fall, 2009 Description: Spectra Extracted from tstart=-0.310 tstop=1.490 (Trigger Time, GPS=819165089.000000, Redshift, z=0.5459) Power-Law Model Fit Norm@15keV 3.2061e-01 (2.9550e-01 3.4696e-01) alpha -1.3383 (-1.3961 -1.2804) Energy Fluence (15-350 keV) 2.2130e-06 (2.14... Date Added: 2009-06-25 18:59:59 |
| jessupch05.pptx Path: Laurentian >> MGT >> 200802 Fall, 2009 Description: 6/19/09 Electronic Business, Intranets & Extranets Click to edit Master subtitle style 6/19/09 Electronic Commerce The online exchange of goods, services, and money among firms, and between firms and their customers 25-2 6/19/09 Types of Elect... Date Added: 2009-06-25 19:04:10 |
| enlargement_portugal_23_79.pdf Path: Pittsburgh >> AEI >> 962 Fall, 2009 Description: 23/79 PORTUGAL AND THE EUROPEAN COMMUNITY This information note has been published on the occasion of the official opening by Mr Lorenzo Natali , Vice- President of the Commission of the European Communities , of the Commission Press and Informatio... Date Added: 2009-06-25 19:09:35 |
| european_company_white_paper.pdf Path: Pittsburgh >> AEI >> 1114 Fall, 2009 Description: Bulletin of the European Communities Supplement 3/88 Cover title: Statute for the European company Commission Memorandum to Parliament , the Council and the two sides of industry Internal market and industrial cooperation Statute for the European... Date Added: 2009-06-25 19:10:06 |
| Lab10.doc Path: UNC >> B >> 550 Fall, 2009 Description: Answers to Lab 10 BIOS 550 Fall 2008 Y. Truong 5.65 y y y y a. The marginal density for Y1 is f 1 ( y1 ) = [(1 (1 2e 1 )(1 2e 2 )]e 1 2 dy 2 0 y y y y 2 y = e 1 e 2 dy 2 (1 2e 1 ) (e 2 2e 2 )dy 2 . 0 0 y y y y = e 1 e 2 dy 2 (1... Date Added: 2009-06-25 19:11:10 |
| q5_460.pdf Path: ASU >> MAT >> 460 Fall, 2009 Description: QUIZ 5, MAT 460: VECTOR CALCULUS Instructor: S. K. Suslov Name: (1) (2 points) Prove that if f (x; y ) satis es the Laplace equation @2f @2f + 2 =0 @x2 @y then so does g (x; y ) = f x y ;2 x2 + y 2 x + y 2 ! for (x; y ) 6= (0; 0) : Date : April 30... Date Added: 2009-06-25 19:11:38 |
| QuALMRI_reactions.pdf Path: Toledo >> PSY >> 280 Fall, 2009 Description: Writing Reaction Papers Using the QuALMRI Framework Modified from Organizing Scientific Thinking Using the QuALMRI Framework Written by Kevin Ochsner and modified by others. Based on a scheme devised by Steve Kosslyn. This handout outlines a structu... Date Added: 2009-06-25 19:13:34 |
| ph3Assessment.doc Path: ASU >> CSE >> 412 Fall, 2008 Description: PHASE 3 ASSESSMENT Group #: _ Group Name: _ Assessment Questions Group Enterprise: 1. Access provides a graphical user interface for defining the database schema. Many other database systems only have a textual language for providing schema definitio... Date Added: 2009-06-25 19:14:16 |
| part 3.doc Path: Cal Poly Pomona >> ACCT >> 304 Fall, 2009 Description: Part 3 of the Inventory Systems Flowchart: File Update and Reporting 1. The inventory master file (2) is received from the File Maintenance process, containing the updates for nonroutine changes. 2. The inventory transaction file is received from tra... Date Added: 2009-06-25 19:15:34 |
| oscs.rtf Path: Michigan State University >> LECTURES >> 126 Fall, 2009 Description: OperatingSystemandComputerSecurity WhatdoesOperatingSystemdo n n MostlyusedOS n Manages all the resource in a computer (including processor, memory, i/o devices) Provides an interface between the hardware and application software. Desktop n n n W... Date Added: 2009-06-25 19:16:19 |
| T0428.t04.n_notor2-logo.pdf Path: UCSC >> T >> 0428 Fall, 2009 Description: T0428.t04 n_notor2 7 6 5 4 3 2 1 MGSSHHHHHHSSGLVPRGSTYKLTLIRHGESEWNKENRFTGWTDVSLSEQGVSEAIEAGRMLLEKGFKFDVVYTSVLKRAIMTTWTVLKELGNINCPIIN 1 10 20 30 40 50 60 70 80 90 N 7 6 5 4 3 2 1 AB PBPB N SG N SNS H GIN P NSH GIN HWRLNERHYGALQGLNKSETASKFGEDQ... Date Added: 2009-06-25 19:21:39 |
| T0428.t06.o_sep-logo.pdf Path: UCSC >> T >> 0428 Fall, 2009 Description: T0428.t06 o_sep 4 3 2 1 MGSSHHHHHHSSGLVPRGSTYKLTLIRHGESEWNKENRFTGWTDVSLSEQGVSEAIEAGRMLLEKGFKFDVVYTSVLKRAIMTTWTVLKELGNINCPIIN 10 20 30 40 50 60 70 80 90 1 D 4 3 2 1 BD A D GD GH BGD A H B HBH BD HWRLNERHYGALQGLNKSETASKFGEDQVKIWRRSFDVPPPVLE... Date Added: 2009-06-25 19:21:41 |
| Projects on MSVISION Server.doc Path: Ill. Chicago >> CS >> 340 Fall, 2008 Description: Creating a New Project on MSVISION Server Open Visual Studio .NET. Click on File->New->Project In the New Project Dialog box, select type of new project desired (usually J# or C# Web App). For location type in http:/msvmsdnaa.msvision.org/username.... Date Added: 2009-06-25 19:27:10 |
| hw6.pdf Path: George Mason >> ECE >> 331 Fall, 2008 Description: ECE 331 Digital System Design Fall 2007 Nathalia Peixoto Student:_ HOMEWORK 6 due Thursday, October 11th at 6pm 1) Feedback (3pts) to be completed after you finish. F1. If you worked on it with classmates and your solutions might be TOO similar,... Date Added: 2009-06-25 19:29:27 |
| karagianis1.pdf Path: ASU >> DAN >> 321 Fall, 2009 Description: Working with Music, Musicians and Sound A Guide for Contemporary Choreographers, Dance Videographers, Performance Artists, and Projects Utilizing Music and Sound Part One: Foundations and Considerations by David Karagianis UCLA Department of World ... Date Added: 2009-06-25 19:29:39 |
| m310_field_work_v2.ppt Path: NMSU >> M >> 310 Fall, 2009 Description: Fieldwork (Click icon for audio) Dr. Michael R. Hyman, NMSU Who Conducts Fieldwork? FIELD INTERVIEWING SERVICE FIELDWORKERS IN-HOUSE INTERVIEWERS BRIEFING SESSIONS 2 In-House Training MAKING INITIAL CONTACT PROBING RECORDING RECORDING RESPONSES RE... Date Added: 2009-06-25 19:30:03 |
| row_operations.pdf Path: Harvard >> MATH >> 121 Fall, 2009 Description: From tomc@math.harvard.edu Thu Apr 1 13:24:43 2004 Date: Sat, 20 Mar 2004 10:55:55 -0500 (EST) From: Tom Coates <tomc@math.harvard.edu> To: Tom Coates <tomc@math.harvard.edu> Subject: row operations As promised in class, here is an outline of the mat... Date Added: 2009-06-25 19:30:41 |
| HW1.pdf Path: Texas El Paso >> GEOL >> 1312 Fall, 2008 Description: GEOL 1312 Name _ HOMEWORK #1 Basic Geology Concepts Due Tuesday, February 10th IN CLASS Answers to the questions must be given in complete sentences (except where indicated), using correct grammar and spelling. Please be as brief and to-the-point... Date Added: 2009-06-25 19:31:06 |
| Igoshin_aggreg.pdf Path: Oakland University >> CSE >> 598 Fall, 2009 Description: Waves and aggregation patterns in myxobacteria Oleg A. Igoshin*, Roy Welch, Dale Kaiser, and George Oster Departments of *Physics, Molecular and Cellular Biology, and Environmental Sciences, Policy, and Management, University of California, Berkeley,... Date Added: 2009-06-25 19:34:00 |
| Equipment List_05.pdf Path: Laurentian >> CHEM >> 24101 Fall, 2009 Description: Glassware and Equipment 6 Glassware and Equipment List In Week 1 of the laboratory course you will be assigned a locker of glassware and laboratory equipment. It is your responsibility to see that all elements of your kit are present and that it is... Date Added: 2009-06-25 19:34:27 |
| Cunningham-Responding to Propaganda.pdf Path: Sveriges lantbruksuniversitet >> CMNS >> 425 Fall, 2009 Description: Journal of Mass Media Ethics, 16(2&3), 138147 Responding To Propaganda: An Ethical Enterprise Stanley B. Cunningham1 University of Windsor o By virtue of its epistemic deficits, propaganda is very much an unethical phenomenon. Coping effectively wit... Date Added: 2009-06-25 19:38:41 |
| exam2akey.pdf Path: Washington >> GS >> 37103 Fall, 2009 Description: GENOME371 Berg/Brewer Autumn 2003 Exam2A Key 7 November 2003 GENOME371 1A) (3 points) b. autosomal 1B) (3 points) a. D3/d1 EXAM 2A WHITE KEY Autumn 2003 1C) (1 point each) Recombinant type 1 = D1 Recombinant type 2 = d3 15% 15% 1D) (6 points... Date Added: 2009-06-25 19:41:37 |
| ExecTech2.pdf Path: Penn State >> ERS >> 164 Fall, 2009 Description: ErikShearer MountSt.MarysStudentHousing TechnicalAssignment#2 MechanicalOption __ EXECUTIVESUMMARY __ Thepurposeofthisreportistoperformadetailedenergyanalysisofthe newstudenthousingprojectsoontobebuiltattheMountSt.MarysUniversity. Severalme... Date Added: 2009-06-25 19:43:04 |
| 86dat.txt Path: Minnesota >> STAT >> 5421 Fall, 2008 Description: \"y\" \"L\" \"C\" \"H\" \"E\" 62 \"1-TooLittle\" \"1-TooLittle\" \"1-TooLittle\" \"1-TooLittle\" 17 \"2-AboutRight\" \"1-TooLittle\" \"1-TooLittle\" \"1-TooLittle\" 5 \"3-TooMuch\" \"1-TooLittle\" \"1-TooLittle\" \"1-TooLittle\" 90 \"1-TooLittle\" \"2-AboutRight\" \"1-TooLittle\" \"1-TooLit... Date Added: 2009-06-25 19:50:55 |
| commandes.txt Path: Université du Québec à Montréal >> INFO >> 3140 Fall, 2009 Description: Principales commandes pour l\'utilisation de l\'outil USE = Remarques prliminaires : - La mise en oeuvre de l\'outil USE est en Java et elle est suppose pouvoir fonctionner sur n\'importe quelle machine virtuelle Java, indpendamment de la plateform... Date Added: 2009-06-25 19:59:00 |
| types.ps Path: Allan Hancock College >> CS >> 4132 Fall, 2009 Description: %!PS-Adobe-2.0 %Creator: dvips(k) 5.92b Copyright 2002 Radical Eye Software %Title: types.dvi %Pages: 4 %PageOrder: Ascend %Orientation: Landscape %BoundingBox: 0 0 596 842 %DocumentFonts: AvantGarde-Demi AvantGarde-Book ZapfDingbats CMSY9 %+ CMMI9 C... Date Added: 2009-06-25 20:00:32 |
| 20361.txt Path: UNC >> DOCS >> 20361 Fall, 2009 Description: Project Gutenberg\'s The Voice of the Machines, by Gerald Stanley Lee This eBook is for the use of anyone anywhere at no cost and with almost no restrictions whatsoever. You may copy it, give it away or re-use it under the terms of the Project Guten... Date Added: 2009-06-25 20:01:09 |
| habit.pdf Path: Columbia >> MU >> 2166 Fall, 2009 Description: Journal of Monetary Economics 49 (2002) 533569 The priceconsumption puzzle of currency pegs$ Mart n Uribe* Department of Economics, University of Pennsylvania, 3718 Locust Walk, Philadelphia, PA 19104-6297, USA Received 8 November 2000; received in ... Date Added: 2009-06-25 20:02:38 |
| cs154a_01intro.ppt Path: UC Davis >> CS >> 154 Fall, 2008 Description: CS154A Computer Architecture Winter 2006 Lecture 1: Introduction Sudip Chahal Adapted from lecture notes by: Stephen Brown and Zvonko Vranesic, University of Toronto Mary Jane Irwin, Pennsylvania State University David Patterson & John Hennessy, 200... Date Added: 2009-06-25 20:05:38 |
| Mechanical Systems Existing Conditions.pdf Path: Penn State >> JMS >> 917 Fall, 2009 Description: Mechanical Systems Existing Conditions Design Conditions ... Date Added: 2009-06-25 20:05:44 |
| hmwk8.pdf Path: CSU Northridge >> MATH >> 53971 Fall, 2009 Description: Math 501. Fall 2008. Homework 8 Chapter Two, Section 4. Exercises 1, 2, 3, 4, 5, 7, 8 Chapter Two. Section 5. Exercises 1, 2, 3, 5, 7, 8 Problem 1. A subspace of a regular space is regular. A nonempty product space is regular if and only if each fact... Date Added: 2009-06-25 20:06:14 |
| ProjetGGR_Binette_Caya.docx Path: NSULA >> GGR >> 7010 Fall, 2009 Description: Prolongement de la Haute-Ville sur la Basse-Ville Autoroute Universit Laval Une barrire naturelle divise le territoire en deux secteurs encore connus sous les noms de Haute-Ville et Basse-Ville Avant la construction de l autoro Basse-Ville Basse-Vill... Date Added: 2009-06-25 20:09:18 |
| MODULE 15 glossary.doc Path: Academy of Art >> M >> 605 Fall, 2009 Description: MODULE15 <Back1page Nonewvocabularyforthismodule. ... Date Added: 2009-06-25 20:09:19 |
| takahashi.pdf Path: Washington >> MICRO >> 553 Fall, 2009 Description: INFECTION AND IMMUNITY, Apr. 1999, p. 18661870 0019-9567/99/$04.00 0 Copyright 1999, American Society for Microbiology. All Rights Reserved. Vol. 67, No. 4 Capsular Sialic Acid Limits C5a Production on Type III Group B Streptococci SHINJI TAKAHASH... Date Added: 2009-06-25 20:09:39 |
| factor.ps Path: Texas >> M >> 391 Fall, 2009 Description: %!PS-Adobe-2.0 %Creator: dvips(k) 5.86 Copyright 1999 Radical Eye Software %Title: factor.dvi %Pages: 26 %PageOrder: Ascend %BoundingBox: 0 0 612 792 %DocumentFonts: Times-Bold Times-Roman Times-Italic Courier %EndComments %DVIPSWebPage: (www.radical... Date Added: 2009-06-25 20:13:23 |
| hw4sol.pdf Path: Concordia Chicago >> MATH >> 256 Fall, 2009 Description: PS 4 Solutions Math 256 Section 31 April 27, 2005 1 III.E.2.ii) 0 0 0 3 0 0 0 det = 9, trace = 7. 3 III.E.5) A matrix is diagonalizable i its Jordan form is diagonal, but Jn (r) is its own Jordan form and it is not diagonal if n > 1. ii and iv a... Date Added: 2009-06-25 20:13:44 |
| lecture-5china.doc Path: U. Memphis >> GEOG >> 4306 Fall, 2008 Description: Lecture 5 China\'s Physical Foundations I. Geological Background Three old land masses composed of these hard rocks form buttresses between which the younger sedimentary formations accumulated and were subsequently folded. These shields or massifs are... Date Added: 2009-06-25 20:14:12 |
| Assignment #4 S03.doc Path: U. Memphis >> GEOG >> 4306 Fall, 2008 Description: Univ 4506 Thematic Studies, The Chinese Geography 4/6306 Geography of East Asia (China) Spring, 2003 Instructor: Dr. Hsiang-te Kung Rm. 107, Johnson Hall Ph. 678-4538 Text: Robert F. Dernberger, Kenneth J. DeWoskin, Steven M. Goldstein, Rhoads Murph... Date Added: 2009-06-25 20:14:14 |
| me332eq.pdf Path: VMI >> HW >> 336 Fall, 2009 Description: ME 332 Equation Sheet Conduction dT q\' \' = k dx Convection Radiation 4 q \' \' = F FG (TW T4 ) q\' \' = h(Tw T ) Thermal resistance 1 x ln(ro / ri ) R= = = hA Ak 2kL q= T R 3D Transient conduction in rectangular coordinates & 1 T 2T 2T 2T q = 2... Date Added: 2009-06-25 20:15:06 |
| week3.ppt Path: Allan Hancock College >> COMP >> 2070 Fall, 2009 Description: 1 COMP 5116 Semester 1, 2009 Lecture 3 Network Layer: Internet Protocol IP The University of Sydney 2 Comer Readings Chapter 4 Introduction to IP (Recap) Chapter 6 IPv4 datagrams Chapter 7 IP forwarding Chapter 5 ARP The University of ... Date Added: 2009-06-25 20:16:50 |
| 481week1.doc Path: WVU >> EE >> 480 Fall, 2008 Description: WEST VIRGINIA UNIVERSITY COLLEGE OF ENGINEERING AND MINERAL RESOURCES Lane Department of Computer Science and Electrical Engineering DESIGN PROJECT TEAM WEEKLY REPORT TEAM NO/TITLE Group 16: Bio-Web_DATES:_Week 16_ Member Gregory Chappell Kevin Davi... Date Added: 2009-06-25 20:19:50 |
| newmanbio.htm.doc Path: University of Louisiana at Lafayette >> SFW >> 4608 Fall, 2009 Description: Hello My name is Willie Smith. I am from Breaux Bridge, LA. I am twenty years old. I am a Youth Minister at Christ Gospel Ministries of Louisiana. My major is Computer Engineering at the University of Louisiana at Lafayette in Lafayette, LA. I am a... Date Added: 2009-06-25 20:25:26 |
| MachConfig.txt Path: University of Illinois, Urbana Champaign >> CS >> 1730 Fall, 2009 Description: <!DOCTYPE html PUBLIC \"-/W3C/DTD XHTML 1.0 Strict/EN\" \"http:/www.w3.org/TR/xhtml1/DTD/xhtml1-strict.dtd\"> <html xmlns=\"http:/www.w3.org/1999/xhtml\" lang=\"en\" xml:lang=\"en\"> <head> <title>Changeset 1730 for meshing/trunk/physics/config/CL/Mac... Date Added: 2009-06-25 20:27:48 |
| Sect1920_Rules.pdf Path: Binghamton >> MATH >> 220 Fall, 2009 Description: Sections 19 & 20 Some of our Rules involving Exponential Functions and Logs Math 220-01 Summer 2009 Natural Logarithm Simplication Rules: General Logarithm eln x = x aloga x = x ln ex = x loga ax = x ln(b c) = ln(b) + ln(c) loga (b c) = loga (b)... Date Added: 2009-06-25 20:31:46 |
| Chapter_28.ppt Path: UMass (Amherst) >> ECON >> 368 Fall, 2009 Description: Chapter 28 Fixed vs Flexible Exchange Rates This chapter is about a debate Should the world adopt fixed or flexible exchange rates? Should any group of countries adopt fixed or flexible exchange rates? Fixed vs flexible exchange rates To think a... Date Added: 2009-06-25 20:32:24 |
| Chapter 28.ppt Path: UMass (Amherst) >> ECON >> 368 Fall, 2009 Description: Chapter 28 Fixed vs Flexible Exchange Rates This chapter is about a debate Should the world adopt fixed or flexible exchange rates? Should any group of countries adopt fixed or flexible exchange rates? Fixed vs flexible exchange rates To think a... Date Added: 2009-06-25 20:32:25 |
| gcnR_flux_ul.txt Path: Berkeley >> ASTRO >> 00213486 Fall, 2009 Description: 58.752 1.637385e-03 3.016174e-04 none yes 637.632 2.366741e-04 4.359698e-05 none yes ... Date Added: 2009-06-25 20:34:08 |
| SolutionsHW4.doc Path: Acton School of Business >> STAT >> 280 Fall, 2008 Description: Chapter 8. Correlation 1. The answer is (d). With (a), the averages are too low. With (b), the SDs are too small. With (c), the SDs are too big and the correlation is too high. 3. The correlation would be 1.00: all the points on the scatter diagram (... Date Added: 2009-06-25 20:34:22 |
| Polar Coordinates.pdf Path: Colorado State >> M >> 261 Fall, 2009 Description: Polar Cordinates Define i j E r t cos t sin t E t sin t cos t i j E r and E are unit vectors in the radial and angular directions associated with polar coordinates. Then E r t t and E t E r t . Moreover, r d dt d dt Er t E... Date Added: 2009-06-25 20:34:27 |
| Assn01.pdf Path: Evansville >> EE >> 411 Fall, 2009 Description: EE 411 Assignment 01 Sept. 2, 2002 Due:Sept. 9, 2002 1. From Chapter 1 Problems pp. 19-21 do 2, 4, and 5 2. From Chapter 2 Problems pp. 44-48 do:6, 8, 10, 11, and 22. ... Date Added: 2009-06-25 20:35:36 |
| KaplanRauhDec08.pdf Path: UF >> FIN >> 6434 Fall, 2008 Description: Are U.S. CEOs Overpaid? Steven N. Kaplan University of Chicago Booth School of Business 1 2008 by S. Kaplan U.S corporate governance system has been demonized. Ebbers - Worldcom Skilling - Enron Grasso - NYSE Scrushy - Healthsouth Kozlowski ... Date Added: 2009-06-25 20:39:40 |
| handout.doc Path: Minnesota >> TARRE >> 004 Fall, 2009 Description: Qu hacas en los aos 80? Paso #1: Lee las siguientes frases y escribe tu respuesta en la segunda columna. Entonces, escribe tres de tus propias preguntas. Paso #2: Habla con tus compaeros de clase y pregntales qu hacan en los aos 80. Escribe su respue... Date Added: 2009-06-25 20:39:56 |
| Lab05SuppQA.pdf Path: Texas >> BOT >> 321 Fall, 2009 Description: SUPPLEMENTARY QUESTIONS FOR LABORATORY 5 STATION 3: RICCIOCARPUS GAMETOPHYTE A. Given what you read about the leafy liverworts in station 2, why do you think rhizoids are not considered to be true roots? STATION 6: RICCIOCARPUS YOUNG SPOROPHYTE A. W... Date Added: 2009-06-25 20:40:29 |
| analysisResults.ppt Path: UF >> CIS >> 4914 Summer, 2008 Description: Analysis / Results A preliminary CIFS client has been written. Socket code, encryption and kernel extension are successful. SMB messages successfully assemble. Increased NT market share guarantees financial rewards for IBM. ... Date Added: 2009-06-25 20:41:54 |
| n002.pdf Path: Rutgers >> FO >> 1957 Fall, 2009 Description: 0 1 ( ) \' ! 2 d W o X i d i w h 2 m h E fs E I g I d # ld i ( X I d } 8 }d \" j s X 0d d t w E D ( p ... Date Added: 2009-06-25 20:46:33 |
| hw1s.pdf Path: Washington >> INDE >> 510 Fall, 2009 Description: ... Date Added: 2009-06-25 20:52:16 |
| gauss_ep_flu.txt Path: Berkeley >> ASTRO >> 00218582 Fall, 2009 Description: # Ep lEiso 1.026 -10.096 1.057 -9.895 1.231 -9.908 1.335 -10.137 1.391 -9.958 1.516 -9.935 1.594 -10.261 1.663 -9.912 1.769 -10.091 1.773 -10.286 1.891 -9.885 2.113 -10.074 2.195 -10.101 2.365 -10.120 2.530 -10.031 2.598 -10.035 2.894 -9.863 2.941 -1... Date Added: 2009-06-25 20:59:23 |
| index39.txt Path: Berkeley >> ASTRO >> 00159994 Fall, 2009 Description: chi^2/nu= 194.70890 / 58 The fit is rejectable at 100.00000 % Confidence 0.22000006 3.8999999 7.5748015 -0.35167657 4972.6703 3.8999999 84.406998 8.9938873 -1.3680356 22... Date Added: 2009-06-25 21:03:04 |
| index37.txt Path: Berkeley >> ASTRO >> 00159994 Fall, 2009 Description: chi^2/nu= 194.70890 / 58 The fit is rejectable at 100.00000 % Confidence 0.22000006 3.8999999 7.5748015 -0.35167657 4972.6703 3.8999999 84.406998 8.9938873 -1.3680356 22... Date Added: 2009-06-25 21:03:04 |
| index38.txt Path: Berkeley >> ASTRO >> 00159994 Fall, 2009 Description: chi^2/nu= 194.70890 / 58 The fit is rejectable at 100.00000 % Confidence 0.22000006 3.8999999 7.5748015 -0.35167657 4972.6703 3.8999999 84.406998 8.9938873 -1.3680356 22... Date Added: 2009-06-25 21:03:04 |
| index44.txt Path: Berkeley >> ASTRO >> 00159994 Fall, 2009 Description: chi^2/nu= 194.70890 / 58 The fit is rejectable at 100.00000 % Confidence 0.22000006 3.8999999 7.5748015 -0.35167657 4972.6703 3.8999999 84.406998 8.9938873 -1.3680356 22... Date Added: 2009-06-25 21:03:05 |
| index40.txt Path: Berkeley >> ASTRO >> 00159994 Fall, 2009 Description: chi^2/nu= 194.70890 / 58 The fit is rejectable at 100.00000 % Confidence 0.22000006 3.8999999 7.5748015 -0.35167657 4972.6703 3.8999999 84.406998 8.9938873 -1.3680356 22... Date Added: 2009-06-25 21:03:05 |
| index41.txt Path: Berkeley >> ASTRO >> 00159994 Fall, 2009 Description: chi^2/nu= 194.70890 / 58 The fit is rejectable at 100.00000 % Confidence 0.22000006 3.8999999 7.5748015 -0.35167657 4972.6703 3.8999999 84.406998 8.9938873 -1.3680356 22... Date Added: 2009-06-25 21:03:05 |
| index42.txt Path: Berkeley >> ASTRO >> 00159994 Fall, 2009 Description: chi^2/nu= 194.70890 / 58 The fit is rejectable at 100.00000 % Confidence 0.22000006 3.8999999 7.5748015 -0.35167657 4972.6703 3.8999999 84.406998 8.9938873 -1.3680356 22... Date Added: 2009-06-25 21:03:05 |
| index43.txt Path: Berkeley >> ASTRO >> 00159994 Fall, 2009 Description: chi^2/nu= 194.70890 / 58 The fit is rejectable at 100.00000 % Confidence 0.22000006 3.8999999 7.5748015 -0.35167657 4972.6703 3.8999999 84.406998 8.9938873 -1.3680356 22... Date Added: 2009-06-25 21:03:05 |
| Multiple Choice Questions_E_portfolio.doc Path: Penn State >> MKW >> 165 Fall, 2009 Description: Marlyse Williams AEE 530 March 27, 2007 Quiz 3: Multiple Choice Questions E-Portfolio Concepts 1. Objective: Identify the software package used by this class to build the eportfolio. Cognitive level: Knowledge What software package is endorsed by AEE... Date Added: 2009-06-25 21:08:46 |
| BIO7103B.pdf Path: Texas State >> UCC >> 09262008 Fall, 2009 Description: ... Date Added: 2009-06-25 21:12:28 |
| IE4399.pdf Path: Texas State >> UCC >> 09262008 Fall, 2009 Description: ... Date Added: 2009-06-25 21:12:30 |
| BLBC 438.doc Path: N.E. Illinois >> BLBC >> 438 Fall, 2009 Description: Jee Kang 09/27/05 BLBC 438 Fall 2005, Tue 4:15-6:55 Inst: Prof. Parul Raval Article Summary and Analysis Article Gmez, Leo. Freeman, David. Freeman, Yvonne. (2005) Dual Language Education: A Promising 50-50 Model. Bilingual Research Journal, Volume 2... Date Added: 2009-06-25 21:15:36 |
| mstrip2.ps Path: Portland >> EE >> 432 Fall, 2009 Description: %!PS-Adobe-2.0 %Creator: dvips 5.490 Copyright 1986, 1992 Radical Eye Software %Title: mstrip2.dvi %Pages: 7 1 %Orientation: Landscape %BoundingBox: 0 0 612 792 %EndComments %DVIPSCommandLine: dvips32 -t landscape mstrip2 %BeginProcSet: texc.pro %! /... Date Added: 2009-06-25 21:19:29 |
| 2025-L23.pdf Path: Georgia Tech >> ECE >> 2025 Fall, 2008 Description: EE-2025 Fall-2001 Final Exam Info Calendar: Final Exam(s) Period 3, Monday, 10-Dec @ 2:50 pm Period 11, Thurs, 13-Dec @ 11:30am 11 AM Lecture NOON Lecture *Must take exam with your assigned section* Lecture 23 H(z) & Frequency Response 30-No... Date Added: 2009-06-25 21:19:42 |
| grades.txt Path: Dickinson State >> CSCI >> 061 Fall, 2009 Description: Grades will be posted here by magic number.... Date Added: 2009-06-25 21:21:15 |
| hw12sol.pdf Path: Case Western >> ENGR >> 210 Fall, 2009 Description: 12-2 By voltage division we can compute the transfer function j L ( 300 ) j L | 300 = 600 + j L | 300 j L ( 900 ) + 180, 000 Substituting in the value of L and doing some simplification gives j 20 10 6 1 1 j 10 7 1 j 10 7 (1) TV ( j ) = = = 3 j 20... Date Added: 2009-06-25 21:21:29 |
| ch02.ppt Path: N.E. Illinois >> MGT >> 3800 Fall, 2009 Description: Spreadsheet Modeling & Decision Analysis: A Practical Introduction to Management Science 3d edition by Cliff Ragsdale 1 Chapter 2 Introduction to Optimization and Linear Programming Spreadsheet Modeling and Decision Analysis, 3e, by Cliff Ragsdale... Date Added: 2009-06-25 21:29:19 |
| chapter1_2.ppt Path: UMass Lowell >> CS >> 413 Fall, 2009 Description: C hapte 1: I ntroduction r Our goal: ge conte ove w, fe l t xt, rvie e Ove w: rvie whats theInte t rne whats a protocol? ne twork e dge ne twork core acce ne physical m dia ss t, e Inte t/IS structure rne P pe rform : loss, de ance lay prot... Date Added: 2009-06-25 21:29:25 |
| 1914_index.pdf Path: CSU Chico >> BCD >> 1914 Fall, 2009 Description: ... Date Added: 2009-06-25 21:32:23 |
| ANATOLIAN.doc Path: Purdue >> CE >> 571 Spring, 2008 Description: vti_encoding:SR|utf8-nl vti_timelastmodified:TR|15 Apr 2008 18:51:25 -0000 vti_extenderversion:SR|5.0.2.6790 vti_backlinkinfo:VX|index.html ... Date Added: 2009-06-25 21:34:00 |
| Lec1b.pdf Path: Princeton >> CHE >> 199 Fall, 2009 Description: Ammonia Synthesis N2 + 3H2 2 NH3 Invented by Fritz Haber and Carl Bosch. It produces heat rather than consume heat. The conversion is very low until the pressure is increased to several hundred atmospheres. Remember the explosion of Hindenbuerg and... Date Added: 2009-06-25 21:36:21 |
| AnswKeys-Set-5.pdf Path: Sveriges lantbruksuniversitet >> C >> 340 Fall, 2009 Description: Chem 340, Answer Keys - Problem Set # 5 1) 4): Refer to Notes, Textbook and Reference Book. 5) (1.29) (a) Ti-O=a/2=1.953 ; (b) Sr-O= a2/2 =2.761 ; (c) 2 Ti and 4 Sr (and 8 O); (d) D = WZ/VoNA = 5.116 g/cm3; (e) Primitive, Z=1. 6) (1.39) (a) & (b): R... Date Added: 2009-06-25 21:36:24 |
| 070420NESR_HBBLW01.pdf Path: Wisconsin >> SH >> 070420 Fall, 2009 Description: 4.8262 4.0312 time (UTC) 3.2363 2.4413 1.6464 0.8514 SHIS LW Noise Estimates 20Apr2007 UTC HBB Radiances (FBF) TOTAL NOISE ESTIMATE 1.5 1 0.5 600 700 800 900 1000 1100 1200 0 4.8262 4.0312 time (UTC) 3.2363 2.4413 1.6464 0.8514 UNCORREL... Date Added: 2009-06-25 21:41:39 |
| Solution.pdf Path: Toledo >> TE >> 0304 Fall, 2009 Description: Dror Bar-Natan: Classes: 2003-04: Math 157 - Analysis I: Math 157 Analysis I Solution of Term Exam 2 web version: http:/www.math.toronto.edu/drorbn/classes/0304/157AnalysisI/TE2/Solution.html Problem 1. Let f (x) and g (x) be continuous functions ... Date Added: 2009-06-25 21:45:12 |
| Minitab_Tutorial.doc Path: St. Olaf >> STAT >> 263 Fall, 2009 Description: vti_encoding:SR|utf8-nl vti_timelastmodified:TR|28 Feb 2001 16:22:25 -0000 vti_title:SR| vti_author:SR|becker vti_modifiedby:SR|becker vti_timecreated:TR|06 Sep 2002 18:35:51 -0000 vti_backlinkinfo:VX|classes/stat263/index.htm vti_extenderversion:SR|... Date Added: 2009-06-25 21:45:34 |
| modl.txt Path: Berkeley >> ASTRO >> 00107547 Fall, 2009 Description: chi^2/nu= 170.49005 / 63 The fit is rejectable at 100.00000 % Confidence -6.76500 -3.30500 1571.9706 -3.30500 -1.57500 1655.0468 -1.57500 0.155000 1702.1948 0.155000 1.8850... Date Added: 2009-06-25 21:51:48 |
| WNCG03_CZT.pdf Path: Dallas >> HXM >> 025000 Fall, 2009 Description: A R EDUCED C OMPLEXITY, I MPROVED F REQUENCY O FFSET E STIMATION FOR OFDM-BASED WLAN S Hlaing Minn , Member, IEEE and Vijay K. Bhargava , Fellow, IEEE Dept. of Electrical Engineering, University of Texas at Dallas. Dept. of Electrical and Computer En... Date Added: 2009-06-25 21:53:46 |
| conclusions.txt Path: Stanford >> MEETING >> 050222 Fall, 2009 Description: So DCH-DCT calibration shows problems with new TSF board Y5. the TSF comparison shows that the problems are for cells: 132,133,137,139 SL7 127,128,129,131,132, SL6 (and this is the same for both the 2 dch-dct calibrations taken (4075 & 4076). in TSF... Date Added: 2009-06-25 21:55:36 |
| eff_plot.ps Path: Stanford >> MEETING >> 051122 Fall, 2009 Description: %!PS-Adobe-2.0 %Title: eff_plot.ps (Portrait A 4) %Pages: (atend) %Creator: HIGZ Version 1.26/04 %CreationDate: 2005/11/22 12.02 %EndComments %BeginProlog /s {stroke} def /l {lineto} def /m {moveto} def /t {translate} def /sw {stringwidth} def /r {ro... Date Added: 2009-06-25 21:55:55 |
| EIA_USA.pdf Path: Occidental >> PHYS >> 168 Fall, 2009 Description: United States Energy Data, Statistics and Analysis - Oil, Gas, Electricity, Coal Page 1 of 17 United States Last Updated: November 2005 Background The United States of America is the world\'s largest energy producer, consumer, and net importer. It ... Date Added: 2009-06-25 22:02:41 |
| 272ch23a.pdf Path: University of Hawaii - Hilo >> CH >> 272 Fall, 2009 Description: ... Date Added: 2009-06-25 22:04:00 |
| cse271exm2s05solPOST.doc Path: Penn State >> CSE >> 271 Fall, 2008 Description: Exam II CSE271 Spring 2005 Section: _ Name: _ Student ID number (last 4 digits): _ This is an OPEN BOOK and CLOSED NOTE exam. Please write your name on every page and show all your work. Write your solution clearly. You may use backside of each p... Date Added: 2009-06-25 22:04:08 |
| lisatek.ppt Path: Neumont >> DIFT >> 3380 Fall, 2009 Description: 1 LISATek LISATekpourconcevoirdesprocesseurs FrdricBastien2006 UniversitdeMontral 2 Plan de la prsentation Plan prsentation Caractristique Lecodagedumodle Pipeline Synthse Gnrationdedocumentation Modledjexistant Conclusion Rfrence FrdricBastien2... Date Added: 2009-06-25 22:04:23 |
| example08.pdf Path: East Los Angeles College >> PX >> 407 Fall, 2009 Description: PX407 Quantum Physics II Worked Example: A Toy Molecule Consider a particle in 1D, with an attractive delta potential V (x ) = ( 2 /m)(x ). If we set E = ( 2 /2m), the Schrdinger equation takes the form (x ) + (x ) = 2(x ) (x ) and o there is just... Date Added: 2009-06-25 22:05:45 |
| YDL007C-A.t2k.dssp-ebghstl-logo.pdf Path: UCSC >> YDL >> 007 Fall, 2009 Description: YDL007C-A.t2k EBGHSTL 3 2 1 C X X X X 10 20 30 40 H 3 2 1 C C C H H X X X X X H T E T H T H T G C G G H T C G T G C H T H S X XXXXXXXXXCXXXXXXXXXXXXXXXXXH C H H H S C T CC CTSCSTTGGGG S S X TT CHHHHHHHHHH T T T T HH C HHHHHHH T T ... Date Added: 2009-06-25 22:12:26 |
| YDL006W.t2k.w0.5-logo.pdf Path: UCSC >> YDL >> 006 Fall, 2009 Description: YDL006W.t2k w0.5 4 3 2 1 R A A X 1 10 20 30 40 E 4 3 2 1 L T E T XX A 51 60 70 80 90 E 4 3 2 1 S H T H H 4 3 2 1 E T E S SR X Q S G TKVVL Y L C A X RI A E G L G V G XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX N D V R G I N I I... Date Added: 2009-06-25 22:12:28 |
| YDL086C-A.t2k.CB_burial_14_7-logo.pdf Path: UCSC >> YDL >> 086 Fall, 2009 Description: YDL086C-A.t2k CB_BURIAL_14_7 2 1 AA 1 A BBAAXXAAXACCXC B BB B B BB CC D D D D X X X X B A D C C A C C C D D X X B A B B A A A B A C B A F B F A D F F B B B B F B C C B B C C E E D E C A E C C E C C E D D D D D D D D D D D D X X X X X X X X X X X ... Date Added: 2009-06-25 22:12:33 |
| YDL076C.t2k.dssp-ehl2-logo.pdf Path: UCSC >> YDL >> 076 Fall, 2009 Description: YDL076C.t2k DSSP-EHL2 2 1 CC E X X H CXXXXHHCCHCCCCCCCCCCCCCCCCHX CCC E C C H X X X X X CCC HHH X X X X X X X X HHHHHHHHHHHHH 20 X X X X X X X X X X C C C C X X C C C E H X X X X X X X X X X X X X X X X X C C C C C CC C C C C C C C X ... Date Added: 2009-06-25 22:12:42 |
| YDL056W.t2k.str2-logo.pdf Path: UCSC >> YDL >> 056 Fall, 2009 Description: YDL056W.t2k STR2 3 2 1 TCC Z T Z SS CY YCY H Z SA ZYZCCTTCC CSYC A T H C S SXSHXXXXXTHSSAEMYYEXSCCY XEATCCSXCCH CX Z X X X X XX X X XX X X H X X Z A Z Z HHA HHAAH S A C AAAA TT AAA ZYZ TT A A CZZZZZZY H X X X Z Y X A Y S Y T X G B Z S X X X M... Date Added: 2009-06-25 22:12:47 |
| L06.ppt Path: UMBC >> PUB >> 104 Fall, 2009 Description: Algorithms, Part 3 of 3 Topics Top down-design Reading Sections 1.4 1.5 , 3.3 L06 Pseudocode and Then Some We can write an algorithm for finding the 1 2 3 4 5 average of two integers: Read integer <num1>, from the user Read integer <num2> fro... Date Added: 2009-06-25 22:14:50 |
| Francis.pdf Path: UF >> EIN >> 6918 Fall, 2008 Description: Industrial and Systems Engineering Graduate Seminar Demand Point Aggregation Methods for Location Models Dr. Richard Francis Department of Industrial and Systems Engineering University of Florida Thursday, October 16, 2003 Mechanical Engineering Buil... Date Added: 2009-06-25 22:16:47 |
| pictograph.xls Path: U. Houston >> CUIN >> 3111 Fall, 2008 Description: Type of food Number sold Pizza Hamburger Fries Apples Oranges Soda Milk Ice Cream 11 8 10 6 11 12 4 8 Monday Ice Cream Milk Soda Oranges Type of Food Apples Fries Hamburger Pizza Number s 0 2 4 6 8 10 12 14 Number Sold Number sold 0 12 14 ... Date Added: 2009-06-25 22:17:25 |
| Lecture829.ppt Path: Missouri S&T >> CS >> 307 Fall, 2009 Description: CS307 CS307 Software Testing And Software Quality Assurance Quality Frank Liu Lesson Title: Overview of Lesson Software Testing When Bugs are Introduced? When Errors Requirements Analysis Faults Errors Design Faults Code Errors Testing Defect P... Date Added: 2009-06-25 22:19:13 |
| Chap10_HW.xls Path: S.F. State >> FIN >> 350 Fall, 2008 Description: X 1 2 3 4 5 Avg Var Std 11% 6% -8% 28% 13% 10% 0.02 12.98% Y 36% -7% 21% -12% 43% 16% 0.06 24.83% 1 2 3 4 5 6 Arithmetric Geometric 29% 14% 23% -8% 9% -14% 8.83% 129% 114% 123% 92% 109% 86% 7.69% ... Date Added: 2009-06-25 22:19:54 |
| YKL149C.t2k.dssp-ehl2-logo.pdf Path: UCSC >> YKL >> 149 Fall, 2009 Description: YKL149C.t2k DSSP-EHL2 2 1 E E X X X CCCCE 1 E 2 1 C C H X X E ECCCCCC X X X X X 10 20 30 40 T H T E S E H GH 51 60 70 80 90 T 2 1 H T H T E S H T E EE CC X X S 2 1 E TE T E T H T CCCC E C C C E E E E E C C C C ... Date Added: 2009-06-25 22:20:50 |
| YKL180W.t2k.dssp-ehl2-logo.pdf Path: UCSC >> YKL >> 180 Fall, 2009 Description: YKL180W.t2k DSSP-EHL2 2 1 CCCCCCCCCC 1 H E E E E E E E E H H X X X X X X X X X X X X CC E C X X C EHHCE H C C C H EEE C H X CC E X X X X X EECCH CE E CCCCCXXXCCCHHEECCXXXCCCCC X X X X X X X X X 10 20 30 40 T 2 1 E H T H HHH 51... Date Added: 2009-06-25 22:21:06 |
| YKL113C.t2k.w0.5-logo.pdf Path: UCSC >> YKL >> 113 Fall, 2009 Description: YKL113C.t2k w0.5 6 5 4 3 2 1 M G L I GI L F XXXXXXXXXXXX T R L N K P S F D A 1 10 20 30 40 H 6 5 4 3 2 1 E T E G H T E H T X XXXXX XXXXXXXXXXXXXXXXXXXXXXXXXXX L D D N T G P P I V L A V T Y I Y S M I G H L F L F L R I K I ... Date Added: 2009-06-25 22:21:11 |
| YKL119C.t2k.w0.5-logo.pdf Path: UCSC >> YKL >> 119 Fall, 2009 Description: YKL119C.t2k w0.5 3 2 1 L L M Y XXXXXXXXXXXXXXXXX I N V K 1 10 20 30 40 E 3 2 1 Y F L E R H T H GT H 51 60 70 80 90 TH 3 2 1 LEY I V H E H T H E 3 2 1 H E 3 2 1 XXXX K K T ST S H 201 210 XXXXXXXXXXX KTKVEKKKVLSKITL I K ... Date Added: 2009-06-25 22:21:27 |
| kmpshrt.ps Path: Rutgers >> CS >> 344 Fall, 2009 Description: %!PS-Adobe-2.0 %Creator: dvips 5.528 Copyright 1986, 1994 Radical Eye Software %Title: kmpshrt.dvi %CreationDate: Wed Apr 19 11:04:36 2000 %Pages: 2 %PageOrder: Ascend %BoundingBox: 0 0 612 792 %DocumentFonts: CMBX12 CMR12 CMMI12 CMR8 CMSY10 CMMI8 CM... Date Added: 2009-06-25 22:23:17 |
| a675hgsa.txt Path: Mt. Holyoke >> ASOL >> 675 Fall, 2009 Description: -11.2574 8515 -11.2115 8430 -11.1656 8490 -11.1198 8609 -11.0739 8635 -11.0281 8647 -10.9822 8678 -10.9364 8700 -10.8905 8713 -10.8447 8715 -10.7988 8639 -10.7530 8585 -10.7071 8611 -10.6612 8623 -10.6154 8551 -10.5695 8474 -10.5237 8506 -10.4778 859... Date Added: 2009-06-25 22:25:33 |
| adaptedsewingtest.pdf Path: Wisc Stevens Point >> TSTEW >> 892 Fall, 2009 Description: ... Date Added: 2009-06-25 22:26:14 |
| ep_fl_dat.txt Path: Berkeley >> ASTRO >> 00273180 Fall, 2009 Description: # Ep dEp lprob lEiso dlEiso 33.295 0.027 1.29e-04 -12.576 0.122 33.324 0.031 5.76e-04 -12.576 0.117 33.358 0.036 8.33e-04 -12.576 0.117 33.396 0.041 1.43e-03 -12.576 0.117 33.439 0.047 1.99e-03 -12.576 0.117 33.489 0.053 2.51e-03 -12.576 0.117 33.546... Date Added: 2009-06-25 22:32:33 |
| HJ06b.pdf Path: SD State >> BIOL >> 204 Fall, 2009 Description: Chapter 6 (contd) The Chemical Structure, Replication and Manipulation of DNA Genome Kilobase Megabase C-value paradox Purines Pyrimidines Adenine Guanine Thymine Cytosine Nucleoside Nucleotide Polynucleotide chain Phosphodiester bond 5end; 3 end Hy... Date Added: 2009-06-25 22:33:56 |
| security.ppt Path: Auburn >> DAY >> 525 Fall, 2009 Description: Security Security A key attribute of Java is its concern for security with built in languages features. Security is at all levels of Java Language level VM level API level Trade-off Security is not absolute - there are tradeoffs between secur... Date Added: 2009-06-25 22:34:04 |
| ex.ps Path: Southern Oregon >> P >> 5573 Fall, 2009 Description: %!PS-Adobe-2.0 %Creator: dvips(k) 5.86 Copyright 1999 Radical Eye Software %Title: book.dvi %Pages: 10 %PageOrder: Ascend %BoundingBox: 0 0 612 792 %DocumentFonts: CMBX12 CMR10 CMMI10 CMR7 CMMI7 CMSY10 CMEX10 CMR9 CMSY7 %+ CMR6 CMMI9 CMMI6 CMSY9 %End... Date Added: 2009-06-25 22:34:37 |
| p3_of_tst1.pdf Path: LSU >> MATH >> 1100 Fall, 2008 Description: ... Date Added: 2009-06-25 22:36:05 |
| Oct26_Khosrow_LMXB.ppt Path: Princeton >> AST >> 541 Fall, 2009 Description: X-ray Bursts in Neutron Stars Type-I Thermonuclear Bursts Type-I Khosrow Allaf-Akbari Khosrow October 26, 2007 Princeton University Observatory Contents: Observations - the early clues Theory - the early recognition of the nature of the bursts... Date Added: 2009-06-25 22:36:25 |
| Ans4.pdf Path: NMT >> GEOP >> 505 Fall, 2009 Description: Spring, 2001 Data Processing and Analysis (GEOP 505) Rick Aster April 5, 2001 Geop 505 Problem Set 4 Answers 1) Obtain a formula for the innite number of FIR lter coecients for a band-limited dierentiator, which has a normalized frequency response gi... Date Added: 2009-06-25 22:42:14 |
| lect2.ppt Path: UNF >> CDA >> 6506 Fall, 2008 Description: CDA 6505 Network Architecture and Client/Server Computing Lecture 2 Protocols and the TCP/IP Suite by Zornitza Genova Prodanoff Le ct1.ppt - 01/06/05 Outline Introduction Layered Protocol Architecture Key Features of a Protocol TCP/IP Layers ... Date Added: 2009-06-25 22:44:17 |
| MP.ppt Path: Georgia Tech >> CS >> 3911 Fall, 2008 Description: PlasmaCore Display Team 10 Sarah Kanel Ryan Keith Muntaqa Peracha Younus Rashid Andy Vaskys Project Vision Goal Project Vision Goal Project Vision Goal PlasmaCore will be viewed on a large plasma screen in the CoC lobby. Viewers will utilize the... Date Added: 2009-06-25 22:47:55 |
| Cecilia Site Mapinbs530.doc Path: Mt. Mercy >> INBS >> 530 Fall, 2009 Description: HOME: Neighborhood Outreach Ministries N OM 7.0 Contact 8.0 Search 9.0 1.0: About Us 1.1 Our Mission 1.2 History 1.3 Staff 1.4 Testimonial 1.5 Locate Us / By Bus, Car, Subway 2.0 Our Services 3.0 Our Store 4.0 Join Us 5.0 Donate 6.0 My Accou... Date Added: 2009-06-25 22:57:52 |
| Dreams and Careers Game.pdf Path: WVU >> UNIV >> 101 Fall, 2008 Description: Dreams and Careers Game Match the Person with the Story 1. In high school, played around a lot: surfing, racing cars, playing cards, partying. Graduated high school with no intention of going to college, man\'ied, took a construction worker job, parti... Date Added: 2009-06-25 22:59:44 |
| eecs4980Project3.pdf Path: Toledo >> EECS >> 4980 Fall, 2008 Description: Project 3 : An Address Book EECS 4980: Special Topics: Java Due: Start of Class, Friday February 25, 2000 Description In this project you are to create a personal summary page viewing tool A sample screen from this tool would be: Joe Cool Picture go... Date Added: 2009-06-25 23:08:13 |
| Assignment on Diamond Sutra and Heart Sutra.doc Path: Seattle >> THRS >> 231 Fall, 2009 Description: Assignment on Diamond Sutra and Heart Sutra: Length: 4-6 pages. Double-spaced. Due Date: _ 1/ Please write a 1-page summary of each of the sutras. 2/ Design 1-page TABLE comparing \"Diamond Sutra\" and \"Heart Sutra:. (The following table is only an exa... Date Added: 2009-06-25 23:18:39 |
| Human sexuality.doc Path: Middlebury >> S >> 0185 Fall, 2009 Description: THE CHANGING FACES OF SEXUALITY AND MARY MAGDALENE Phoebe Chap Human sexuality is one of the fundamental elements of human nature. It has a long and complex history that can be traced throughout our past and today has produced a Western view of sexu... Date Added: 2009-06-25 23:19:59 |
| es210s3a4.pdf Path: Alaska Anch >> ES >> 210 Fall, 2008 Description: ... Date Added: 2009-06-25 23:22:44 |
| YJL225C.t2k.stride-ebghtl-logo.pdf Path: UCSC >> YJL >> 225 Fall, 2009 Description: 3 2 1 TCTCCCEE CTTGCTCEEETTCC TCC G C X C H H E T H C G E E T H T E T C C C E C G C T E X X X X X X X X X X X X X X X X X X X X X X 301 310 320 330 340 T 3 2 1 E T HT HTH T TGT H HHHHHHHHHHHHHHHHHHH T C X X X X X X X X X X X X X 351... Date Added: 2009-06-25 23:31:11 |
| addr_out.txt Path: Cincinnati >> CAS >> 253 Fall, 2009 Description: -rAX=0000 BX=0000 CX=007B DX=0000 SP=0040 BP=0000 SI=0000 DI=0000 DS=149B ES=149B SS=14AB CS=14B0 IP=0000 NV UP EI PL NZ NA PO NC 14B0:0000 B8AF14 MOV AX,14AF -t AX=14AF BX=0000 CX=007B DX=0000 S... Date Added: 2009-06-25 23:31:36 |
| HW04.pdf Path: St. Cloud >> CSCI >> 220 Fall, 2008 Description: CSCI 220: Computer Architecture I (Spring 2009) Instructor: Pranava K. Jha HW 4 Due Friday, March 6 Q. 1. [20 points] Using a Karnaugh map, obtain a minimal product-of-sums expression for the following Boolean function: f(w, x, y, z) = m(6, 7, 9, 10... Date Added: 2009-06-25 23:32:59 |
| syllabus_CHEM 335a Fall 05 .pdf Path: Washington >> CHEM >> 335 Fall, 2008 Description: UNIVERSITY OF WASHINGTON Department of Chemistry CHEM 335a Fall, 2005 Instructor: Prof. Glenn Bartholomew Telephone: 206.616.8493 Email: gbart@u.washington.edu Home Department: Chemistry Box 351700, mailbox located in Bagley Hall mailroom Office Loc... Date Added: 2009-06-25 23:33:59 |
| MEW 1031 CH14.pdf Path: Colorado >> CHEM >> 1031 Fall, 2008 Description: Thermochemistry: Energy Flow and Chemical Change Thermochemistry: Energy Flow and Chemical Change Forms of Energy and Their Interconversion Enthalpy: Heats of Reaction and Chemical Change Calorimetry: Laboratory Measurement of Heats of Reaction Stoi... Date Added: 2009-06-25 23:39:57 |
| Week3Solutions.pdf Path: CSU Fresno >> ZIMMER >> 100 Fall, 2009 Description: MATH 100, Week three solutions Next week we will keep working on fractions by using pattern blocks. Specically multiplication and division (still chapter 5 from the book). Also, you should read what was posted on Blackboard last week (Liping Ma read... Date Added: 2009-06-25 23:40:23 |
| Q3Solutions.pdf Path: CSU Fresno >> ZIMMER >> 100 Fall, 2009 Description: MATH 100, Quiz 3 Solutions Name: Oscar Date: 03/13/09 Please explain all your work (I will not give credit for just the answer, or unjustied arguments). Recall that it is more important to clearly explain your ideas than the answer itself. Finally, ... Date Added: 2009-06-25 23:40:24 |
| T0320.t06.CB_burial_14_7-logo.pdf Path: UCSC >> T >> 0320 Fall, 2009 Description: T0320.t06 CB_burial_14_7 3 2 1 AAA C D D X X X BB BCCX D 210 220 230 240 A 3 2 1 AD A FD FDBEA BDBDEDEBA DBD FEFDED 250 BB NEPICGLYGKGFTSIGGINNSLPNPHLRKDSNNPALHFEWEIIHAFGKDA C A B D A D D X X D C C D D XXCXXX D A B AA BB X A F B C... Date Added: 2009-06-25 23:46:08 |
| TP_DCP_F08a_T08_V1.1.pdf Path: USC >> CSCI >> 577 Fall, 2009 Description: Transition Plan (TP) AAA Petal Pushers Remote R&D Team #8 Chatupoln Taparugssanagorn Ampatcha Satornsantikul Kantipa Lumyai Chatchai Sinthop Sattawat Suppalertporn Saranya Iranoppaiboon Ryan Lee Hoover Ibrahim Ersin Senol Project Manager Requirem... Date Added: 2009-06-25 23:47:00 |
| hw5.pdf Path: Maryland >> MATH >> 402 Fall, 2008 Description: MATH 402: Homework 5 Key Points: Symmetric Groups. Due Thursday, 28 February 2008 1. Let = (1365)(24), = (152643), = (163). Find each of the following. For (a)-(d), write each rst as a product of disjoint cycles, then as a product of 2-cycles, ... Date Added: 2009-06-25 23:47:22 |
| pinellas.pdf Path: Fayetteville State University >> SDFS >> 0506 Fall, 2009 Description: Florida School Environmental Safety Incident Report (SESIR) Incidents and Resultant Disciplinary Actions 2005-2006 School Year * 2005-2006 reported in Automated Student Information System Survey 5 Incidents Having Appropriate Disciplinary Matches 0 0... Date Added: 2009-06-25 23:52:06 |
| 1106.pdf Path: University of Illinois, Urbana Champaign >> MATH >> 430 Fall, 2009 Description: Higher homology and cohomology: beginnings 6 November We have already studied the singular homology groups H0 and H1. These groups had several properties which made them useful and computable. 1. (Homotopy invariance) If f, g : X Y are homotopic, t... Date Added: 2009-06-25 23:55:35 |
| AE568_HW 5.pdf Path: Iowa State >> AE >> 568 Fall, 2009 Description: Instructor: Tae Hyun Kim (3101 NSRIC) Phone: 515-294-7136, Email: thkim@iastate.edu A E 568X Pretreatment of Biomass Homework #5. Lab Report : Biomass Compositional analysis (Due; 2/24) Please, submit an individual lab report. Lab reports should in... Date Added: 2009-06-25 23:56:50 |
| short.pdf Path: Maryville MO >> WANGL >> 050206 Winter, 2009 Description: SIMULTANEOUS QUANTITATION OF ESCHERICHIA COLI O157:H7, SALMONELLA AND SHIGELLA IN GROUND BEEF BY MULTIPLEX REAL-TIME PCR AND IMMUNOMAGNETIC SEPARATION Luxin Wang Dr. Azlin Mustapha, Thesis Supervisor ABSTRACT The objectives of this study were to e... Date Added: 2009-06-26 00:02:04 |
| SolutionsDevoir10.pdf Path: Neumont >> PHY >> 1651 Fall, 2009 Description: ... Date Added: 2009-06-26 00:02:50 |
| L05_08.pdf Path: Iowa State >> CS >> 425 Fall, 2009 Description: COMS/CPRE 425 Spring 2005 Lecture 8 Ricky A. Kendall rickyk@cs.iastate.edu 1/28/2005 ComS 425 Spring 2005 1 of 39: Lecture 8 Logistics Any questions about the lecture or homework? Homework 2 done yet? 1/28/2005 ComS 425 Spring 2005 2 of 39: L... Date Added: 2009-06-26 00:14:14 |
| Chapter4.pdf Path: Delaware >> ELEG >> 833 Fall, 2008 Description: Nonlinear Signal Processing ELEG 833 Gonzalo R. Arce Department of Electrical and Computer Engineering University of Delaware arce@ee.udel.edu Fall 2008 Gonzalo R. Arce (Department of Electrical and Computer Engineering University of Delaware arce@... Date Added: 2009-06-26 00:16:02 |
| solhwch02.pdf Path: Oakland University >> STA >> 226 Fall, 2008 Description: Solutions to Homework of Chapter 2 4. a. Outcome 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 b. c. d. e. Home Mortgage Number 1 2 3 4 F F F F F F F V F F V F F F V V F V F F F V F V F V V F F V V V V F F F V F F V V F V F V F V V V V F F V V F V V V V F V... Date Added: 2009-06-26 00:22:03 |
| syllabus.pdf Path: Minnesota >> SPA >> 1001 Fall, 2009 Description: Syllabus AST 1001 / AST 1005 Summer 2008, Session I You are responsible for all information contained in this syllabus as well as any changes made during the session (www.astro.umn.edu/~mboyer/1001/syllabus). Basic Course Information: Title: Explo... Date Added: 2009-06-26 00:28:03 |
| Chapter7S.pdf Path: FGCU >> FIN >> 3504 Fall, 2009 Description: Chapter 7 BKM Essentials 6e Solutions 7-30 7-31 E (rA ) = .07 + .5(.01) + 1.25(.07) = .1625 2 P = .09(1.30) 2 = .1521 7-32 7-36 7-37 E (r x ) would normally be .05 + 1.15(.15 - .05) = 16.5% E (rm ) = .04 + 3(.0225) = 10.75 p = 7-38 7-39 600 40... Date Added: 2009-06-26 00:30:21 |
| Kines 395A Practicum Experience.doc Path: Penn State >> JPM >> 5010 Fall, 2009 Description: Kines 395A Teaching Practicum Experience Jim Malloy In the spring of 2008, I had the opportunity to work with ninth and tenth grade students at State College Area High School. Over the course of ten weeks, I got to spend twenty hours interacting wi... Date Added: 2009-06-26 00:30:37 |
| Time Value Clips.xls Path: High Point >> BUA >> 234 Fall, 2009 Description: Today, you invest $10,000 in a mutual fund. If you earn 8% annually, how much will PV FV N I PMT 0 $10,000 10000 $21,589.25 10 0.08 Future Value = Present Value * (1 + inte FV = $10,000 * (1.08^10) nnually, how much will you have in the fund in 10 ... Date Added: 2009-06-26 00:33:30 |
| m137tr.txt Path: East Los Angeles College >> M >> 137 Fall, 2009 Description: 20 67 1732 Actual line C:\\My Documents\\Miao\\Concordance\\TextFromClipboard-File5.txt 24/10/2001 09:07:15 Program copyright (c) R.J.C. Watt 1998. All rights reserved. -ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz ABOUT 38 10 15 To spea... Date Added: 2009-06-26 00:34:16 |
| PracticeProblems_4315_solutions.pdf Path: Texas El Paso >> FIN >> 4315 Fall, 2008 Description: SOLUTIONS TO PRACTICE PROBLEMS Chapter 1: 1. 2. HPR = Ending Value/Beginning Value = 77.39/50 = 1.5478 Annual HPR = (HPR)1/n = (1.5478)1/5 = 1.0913 Annual HPY = Annual HPR - 1 = 1.0913 - 1 = 0.0913 = 9.13% Time 3/01/94 3/01/95 3/01/96 3/01/97 3/01/98... Date Added: 2009-06-26 00:39:49 |
| hw1.pdf Path: Rutgers >> HW >> 602 Fall, 2009 Description: Homework I Reading: Kaxiras, Chapter 6, pp. 203226; Taylor and Heinonen, Chapter 6, pp. 93107. 1. Consider a one dimensional crystal containing atoms of mass M and lattice constant a. Take the force constant matrix Anm to be given for n = m by Anm = ... Date Added: 2009-06-26 00:44:25 |
| equipot.txt Path: RIT >> PHYS >> 273 Fall, 2009 Description: EQUIPOTENTIAL CURVES AND LINES OF FORCE PURPOSE: In this experiment you will study the properties of electric fields by mapping equipotential lines and constructing the corresponding lines of electric force. THEORY: Although it is relatively eas... Date Added: 2009-06-26 00:50:58 |
| zpow1.5.ps Path: Duke >> STA >> 294 Fall, 2008 Description: ... Date Added: 2009-06-26 00:53:56 |
| Bernoulli-penny lift.doc Path: Alabama >> PH >> 101 Fall, 2008 Description: Bernoulli Take a penny, lay it flat on the table and blow air across it towards the opening of a cup. How hard do you have to blow to get the penny lifted off the table and landing in the cup? Calculate the answer, i.e. the required speed of air. ... Date Added: 2009-06-26 01:09:24 |
| tut_7.pdf Path: Allan Hancock College >> MATH >> 132 Fall, 2009 Description: MACQUARIE UNIVERSITY Division of Information and Communication Sciences DEPARTMENT OF MATHEMATICS MATH132 MATHEMATICS IA (ADVANCED) (2008 D1) TUTORIAL QUESTIONS FOR WEEK 7 1. Use the denition of limit to prove each of the following: a) lim (4x + 5... Date Added: 2009-06-26 01:13:46 |
| 7_inner_classes.ppt Path: UMBC >> PUB >> 331 Fall, 2009 Description: Java Inner Classes Interfaces An interface describes methods but does not supply bodies for them. interface KeyListener { public void keyPressed(KeyEvent e); public void keyReleased(KeyEvent e); public void keyTyped(KeyEvent e); } Four kinds of i... Date Added: 2009-06-26 01:39:48 |
| HardwareOverview.pdf Path: Lake County >> LIS >> 315 Spring, 2009 Description: Grad School of Lib & Info Sci., Univ. of Illinois http:/www.lis.uiuc.edu/ Hardware Overview LIS 315 * Spring 2004 Introduction to Networked Systems http:/www.isrl.uiuc.edu/mwolske/lis315/spring04 Martin Wolske mwolske@uiuc.edu 1/26 ? i P More o... Date Added: 2009-06-26 01:49:00 |
| camera.pdf Path: Georgia Tech >> CS >> 4803 Fall, 2008 Description: Camera and Scene Setup Where to put the camera? How much to show within the frame? When to move the camera? Camera Position Catch the most expressive aspect No unintentional surprises How much to show? long shot medium shot closeups Camera Angle... Date Added: 2009-06-26 02:05:51 |
| Lecture17.ppt Path: Oregon State >> ENGR >> 151 Fall, 2009 Description: CS 151 Midterm exam Friday (Nov 7) A practice midterm is located on web page No quiz this week. No programming assignment this week. Note that Programming assignments #5 will appear on web page shortly. Midterm exam In this room. One hour. B... Date Added: 2009-06-26 03:08:42 |
| chapter_six.pdf Path: Rochester >> VERSION >> 44503 Fall, 2009 Description: Studying Students The Undergraduate Research Project at the University of Rochester edited by Nancy Fried Foster and Susan Gibbons cover.indd 1 8/14/2007 11:26:01 AM Studying Students: The Undergraduate Research Project at the University of Roch... Date Added: 2009-06-26 03:56:38 |
| seminar review.doc Path: Allan Hancock College >> INFO >> 2070 Fall, 2009 Description: UNIVERSITY OF SYDNEY School of Information Technologies INFO5991 IT Professional Services 1. YOUR REVIEW AND EVALUATION FOR THIS WEEK 1. What did you find most valuable in the course this week, (from the readings, class discussions, assignments, pr... Date Added: 2009-06-26 04:00:30 |
| pr6ec70205.pdf Path: UPenn >> EC >> 70205 Fall, 2009 Description: Econ 702, Spring 2005 Problem Set 6 Due Tuesday March 15 Problem 1 Consider the baseline model of industry equilibrium studied in class last week. Suppose that a firm has to pay the amount ce in order to enter the industry. The firm draws a producti... Date Added: 2009-06-26 04:31:27 |
| pr6ec70205.pdf.pdf Path: UPenn >> EC >> 70205 Fall, 2009 Description: Econ 702, Spring 2005 Problem Set 6 Due Tuesday March 15 Problem 1 Consider the baseline model of industry equilibrium studied in class last week. Suppose that a firm has to pay the amount ce in order to enter the industry. The firm draws a producti... Date Added: 2009-06-26 04:31:31 |
| Cook03.pdf Path: Midwestern State University >> CSE >> 6362 Fall, 2009 Description: Learning to Control a Smart Home Environment Diane J. Cook, Manfred Huber, Karthik Gopalratnam, and Michael Youngblood Department of Computer Science Engineering University of Texas at Arlington Email: cook@cse.uta.edu Abstract The goal of the MavHo... Date Added: 2009-06-26 04:38:37 |
| l10.ps Path: Midwestern State University >> CSE >> 5311 Fall, 2009 Description: %!PS-Adobe-2.0 %Creator: dvips(k) 5.78 Copyright 1998 Radical Eye Software (www.radicaleye.com) %Title: l10.ul.dvi %Pages: 9 %PageOrder: Ascend %BoundingBox: 0 0 596 842 %EndComments %DVIPSCommandLine: dvips -f l10.ul.dvi %DVIPSParameters: dpi=600, c... Date Added: 2009-06-26 04:38:47 |
| l10.pdf Path: Midwestern State University >> CSE >> 5311 Fall, 2009 Description: e 3t 4 e e 4 vt4tx$ f p @7 e@ \' f \' 7 \'5 mg53(SX4)4d23~6vdAf n ey f p @7 e@ 8 c 7 \'5 mg53va3C4)()~6vdAf H $ttt f %Yg e ) \'57 W 7 \'5 T) h2@ i6hg61kCa7 `7 c f5 `75) 7 \'... Date Added: 2009-06-26 04:38:47 |
| 2005Math416Homework8.pdf Path: Michigan >> PERSONAL >> 416 Fall, 2009 Description: p Rv i p i p R| i p \"b i p h i p Rf i p \"Y i I@ 1 B 41 4 BQ W i3 4B 3B W g @1 3 g1 3 m 4 m W18 9\"TH7APRAIT\'lBCmWhTy4\'\"Cku1z`754DhBlg\"rSf3n4rCIRhRlICmn4Cm54\"`rI4 h37dh`7AC9DlBr1W\"d\"`HPA`CH5Bh9`hfAb Rwgt0 rqi m B m Y 4k g I W1 1 BQ1 B 41 ... Date Added: 2009-06-26 04:45:08 |
| finalAsol.pdf Path: UCSB >> WEB >> 221 Fall, 2009 Description: UNIVERSITY OF CALIFORNIA, SANTA BARBARA Department of Physics Physics 221A Quantum Field Theory Fall 2007 http:/www.kitp.ucsb.edu/~joep/Web221A/221A.html FINAL EXAM SOLUTIONS 1. a) The propagator for eld i = A, B, C is i/(k 2 + m2 i ). There is an ... Date Added: 2009-06-26 04:52:41 |
| IZ2.pdf Path: UCSB >> WEB >> 221 Fall, 2009 Description: ... Date Added: 2009-06-26 04:52:46 |
| lesson_1.pdf Path: Texas Tech >> M >> 5364 Fall, 2009 Description: LESSON 1: The Rule and Boxes Here is the syntax for the rule command: \ ule[lift]{width}{total_height) Here are a few examples: \ ule{4in}{2pt} \ ule{4in}{1pt} \ ule[.1in]{4in}{1pt} Another useful item is the fbox 1. To set the width of the lines c... Date Added: 2009-06-26 04:57:55 |
| dmx2004.pdf Path: Texas >> ISCHOOL >> 2081 Fall, 2009 Description: Dreamweaver MX 2004 Basics Dreamweaver MX 2004 Basics Sara Fuchs, Libby Peterek, & Holly Robertson Information Technology Lab School of Information University of Texas at Austin Spring 2004 Objectives Website construction and maintenance is quickly ... Date Added: 2009-06-26 05:08:10 |
| course_overview-2008.pdf Path: Bergen CC >> EE >> 224 Fall, 2009 Description: EE 224A: Digital Communication, Fall 2008 Instructor: Prof. Ahmad Bahai, Room: 511 Cory Hall , (510) 643 0155, Office Hours: Wed. 1-3 Course Schedule: MW 10-12, Cory 299 Teaching Assistant: None Course Website: http:/inst.EECS.Berkeley.EDU/~ee224 (un... Date Added: 2009-06-26 05:42:27 |
| Lecture19.pdf Path: Bergen CC >> EE >> 225 Spring, 2009 Description: ... Date Added: 2009-06-26 05:43:27 |
| assign4.pdf Path: Bergen CC >> CS >> 282 Spring, 2009 Description: UNIVERSITY OF CALIFORNIA Department of Electrical Engineering and Computer Sciences Computer Science Division CS 282 Fall 2002 Prof. R. Fateman Assignment 4: Simplication, Integration Due: Wed, 27 March, 2002 1. Experiment with the integration p... Date Added: 2009-06-26 05:43:46 |
| outline.pdf Path: Bergen CC >> EE >> 100 Fall, 2009 Description: c c c c w c c shbCycsCycbCycsCbCwc z k x re h v z z k h WXuupr7uX!FA!sqphumHXqp0r pp g g m g z h g t rm XAiswimqqpRh1qimuHuX1 hh hm z gm merm mt CX T qimHqCXeuqru57n \' { v x om h tp qmsqimFt c CCycCv dw fwcd gdYCu !Xi... Date Added: 2009-06-26 05:44:22 |
| final_spec.pdf Path: Bergen CC >> EE >> 105 Fall, 2009 Description: EECS 105 Microelectronic Devices and Circuits Spring 2001, Prof. A. R. Neureuther Dept. EECS, 510 Cory 642-4590 UC Berkeley Office Hours M11, (Tu2), W2, Th2, F11 Course Web Site http:/www-inst.EECS.Berkeley.EDU/~ee105/ Final Exam, 8-11 Monday May 1... Date Added: 2009-06-26 05:44:40 |
| Kaplan Biology Molecular Genetics Test 1 Path: NYIT >> BIO >> 110 Spring, 2009 Description: MCAT Topical Tests Dear Future Doctor, The following Topical Test and explanations should be used to practice and to assess your mastery of specific topical information in test format. This is an opportunity to practice the STOP, THINK, PREDICT metho... Date Added: 2009-06-28 14:55:18 |
| HW3 2009 Path: Georgia Tech >> CEE >> 4310 Spring, 2009 Description: CEE 4310 WATER QUALITY ENGINEERING SPRING 2009 HOMEWORK #2 (DUE MAR 5) 1. (40 pts). A wastewater at temperature 20oC and pH 10.0 containing 10 g of NH4Cl (MW = 53.5) is stored in an enclosed reactor for further treatment. The volume of wastewater (... Date Added: 2009-06-29 19:04:25 |
| 63-Ductus epididymis (tail) Path: Pacific >> BIOL >> BIOL 011 Spring, 2009 Description: ... Date Added: 2009-06-30 17:34:23 |
| 4_pure_bending Path: N.C. State >> MAE >> 314 Summer, 2009 Description: Third Edition CHAPTER 4 MECHANICS OF MATERIALS Ferdinand P. Beer E. Russell Johnston, Jr. John T. DeWolf Lecture Notes: J. Walt Oler Texas Tech University Pure Bending 2002 The McGrawHill Companies, Inc. All rights reserved. MECHANICS OF MATE... Date Added: 2009-07-01 16:01:42 |
| 200a_f08_ps_5_ak Path: UC Davis >> ARE >> 200a Winter, 2009 Description: University of California, Davis ARE/ECN 200A Fall 2008 Joaquim Silvestre v (p; w) = w; ln w = i:e:; v (p; w) = L pj j (ln w 0 j=1 0 + L j=1 L j=1 ln pj + 1 j ln pj 2 j 1 L L ln pi ln pj 2 i... Date Added: 2009-07-01 23:00:54 |
| Path: Utah >> KOREAN >> 1020 Spring, 2009 Description: ... Date Added: 2009-07-02 16:31:40 |
| ABCs_arrays Path: Georgia Tech >> CS >> CS 1371 Fall, 2008 Description: function [A B C D_rows D_cols E F G H I J] = ABCs_arrays(num1, arr1, arr2, i, j, arr3, arr4, arr5, vec1) % PROBLEM 3. THe ABCs of Arrays % This is a multi-part problem. Do each of the parts below. % % DO NOT CHANGE THE FUNCTION HEADER (the first lin... Date Added: 2009-07-06 07:29:25 |
| ac115ch7 Path: 東京大学 >> MGT >> BAM313 Spring, 2009 Description: Internal Control & Cash Chapter 7 Copyright 2007 Prentice-Hall. All rights reserved 1 Internal Control All policies and procedures managers use to: Safeguard assets Encourage employees to follow company policies Promote operational efficiency... Date Added: 2009-07-06 20:27:22 |
| Soln11099 Path: LSU >> CE >> 2460 Spring, 2009 Description: COSMOS: Complete Online Solutions Manual Organization System Chapter 11, Solution 99. (a) At the landing point, Horizontal motion: Vertical motion: from which y = x tan 30 x = x0 + ( vx )0 t = v0t y = y0 + v y t2 = ( )0 t 1 gt 2 = 1 gt 2 2 2 ... Date Added: 2009-07-07 11:56:47 |
| Hansen_Preproposal.pdf Path: Washington University in St. Louis >> ID >> 137 Fall, 2009 Description: Form Approved Through 11/30/2010 Department of Health and Human Services Public Health Services LEAVE BLANK-FOR PHS USE ONLY. Type Activity Number Review Group Formerly Council/Board (Month, Year) OMB No. 0925-0001 Grant Application Do not exceed c... Date Added: 2009-07-08 08:26:25 |
| w_Proj05_Lenschow.pdf Path: Washington University in St. Louis >> ID >> 160 Fall, 2009 Description: Lenschow, Deborah J. A. Specific Aims: Alphaviruses are global human pathogens known to cause encephalitis, fever, rash and arthritis. The recent epidemic of Chikungunya virus in La Reunion Island and India has highlighted our need for a better under... Date Added: 2009-07-08 08:26:26 |
| Midterm i review Path: UCLA >> LIFE SCI >> LS 3 Fall, 2008 Description: Midterm: You may write in pencil No cell phones, food, drink, notes on desk No bathroom stops Only 3 questions a piece Office hours WED: 2-3 pm in GEOLOGY 6704 Review ! ! ! ! Griffith Experiment o transformation Avery et al. Experiment Hershey-Chase ... Date Added: 2009-07-08 12:24:56 |
| Personal Health - Assessing the Risks for Hereditary Cancers - NYTimes.com Path: UCLA >> LIFE SCI >> ls 4 Winter, 2008 Description: Personal Health - Assessing the Risks for Hereditary Cancers - NYTimes.com 5/28/08 11:19 AM May 27, 2008 PERSONAL HEALTH Red Flags for Hereditary Cancers By JANE E. BRODY All cancers are genetic in origin. When genes are working properly, cell gr... Date Added: 2009-07-08 12:59:29 |
| Ecen 248 HW5 Sol Path: Texas A&M >> ECEN >> 248 Spring, 2007 Description: ... Date Added: 2009-07-08 13:21:56 |
| Lec01intro Path: Cornell >> ECE >> 4880 Spring, 2009 Description: ECE 488 RF Circuits and Systems Spring 2009 Lecture 1 2009/1/19 ECE 488 Topics What is RF? (Information carriers) Resonant Circuits (LC, sinusoids) Impedance Matching (ZIN=ZLOAD) Amplifiers (Classes: A, B, AB, C, and D) Filters and Mixers (LP, ... Date Added: 2009-07-09 00:44:53 |
| Lec05filters Path: Cornell >> ECE >> 4880 Spring, 2009 Description: ECE 488 RF Circuits and Systems Spring 2008 Lecture 5 2009/1/28 Announcements Labs start next week, February 2. Read Lab 1 Handout. Fill in boxes under \"Before Your Lab\" Filters Butterworth Chebyshev Bessel Matched Go to proper section in 229 ... Date Added: 2009-07-09 00:44:54 |
| Autumn 2005- TBS 907- Tutorial 5 - Share Valuation- Solutions Path: BCHS >> FIN >> FIN Spring, 2009 Description: TBS 907 AUTUMN 2005 TUTORIAL 5 SOLUTIONS SHARE VALUATION Question 1 There are a number of approaches to the problem of valuing a company that does not have a share price determined in the market place. These include the following: 1. PV of expected f... Date Added: 2009-07-10 01:46:55 |
| 2_9 Path: WVU >> MAE EE IEN >> mae ee ien Spring, 2009 Description: ... Date Added: 2009-07-10 13:25:06 |
| QuickGuide Path: Illinois >> MATH >> 210 Spring, 2009 Description: Aspire one Series User Guide Copyright 2008. Acer Incorporated. All Rights Reserved. Aspire one Series User Guide Original Issue: 07/2008 Changes may be made periodically to the information in this publication without obligation to notify any pers... Date Added: 2009-07-15 12:09:00 |
| Quiz 08 Posted Answers Path: USC >> BISC >> 220 Spring, 2009 Description: Quiz 08 Covers lectures 23, 24, 25: Mar 9 (Intro to Physiol) through Mar 13 (Blood) Posted: Friday, March 13, 1 pm Deadline: Wednesday, March 25, 6 am (1 week extension due to Spring Break) 1. If a molecule diffusing through extracellular fluid trave... Date Added: 2009-07-15 20:15:56 |
| econfig Path: Stony Brook University >> CHE >> 131 Fall, 2008 Description: Atomic Structure : Electron Configurations Electron Configuration - Describes the distribution of electrons in atomic orbitals according to specific rules. Electron Diagram - Illustrates the distribution of electrons in atomic orbitals according to ... Date Added: 2009-07-15 23:11:15 |
| Untitled40 Path: Tuskegee >> MENG >> 212 Spring, 2009 Description: ... Date Added: 2009-07-16 11:33:48 |
| SP09 Bio 202.02 ANSWER SHEET ERSTER Exam 2_1 Path: Stony Brook University >> BIO >> 202 Spring, 2008 Description: Bio 202.02 Professor Susan Erster Exam 2 Answers Spring 2009 THIS IS YOUR ANSWER SHEET, If your exam starts with: \"Which statement about.\" 1. E 11. A 21. E 2. B 12. D 22. E 3. C 13. E 23. A 4. A 14. B 24. C 5. A 15. C 25. D 6. A 16. A 26. B 7. D 17... Date Added: 2009-07-16 19:54:54 |
| hw9sol Path: Berkeley >> MATH >> mat 55 Spring, 2009 Description: Math 55: Discrete Mathematics UC Berkeley, Spring 2009 Solutions to Homework # 9 (due February 18) 7.1 # 5 r2 - 8r + 16 = (r - 4)2 , so the general solution is c1 4n + c2 n4n . a. c1 = c2 = 0, yes. b. No. c. No. d. Yes. e. Yes. f. Yes. g. No. h. No. ... Date Added: 2009-07-17 17:56:37 |
| lecture18annotat Path: MIT >> ELECTRICAL >> 6.012 Fall, 2005 Description: 6.012 - Microelectronic Devices and Circuits - Fall 2005 Lecture 18-1 Lecture 18 - The Bipolar Junction Transistor (II) Regimes of Operation November 10, 2005 Contents: 1. Regimes of operation. 2. Large-signal equivalent circuit model. 3. Outpu... Date Added: 2009-07-20 12:21:25 |
| projectinfo Path: MIT >> ELECTRICAL >> 6.111 Fall, 2002 Description: Massachusetts Institute of Technology Department of Electrical Engineering and Computer Science 6.111 - Introductory Digital Systems Laboratory Project Information Introduction The term project in 6.111 is your opportunity to specify a small digital ... Date Added: 2009-07-20 12:39:28 |
| PhyMeasureSummary Path: USC >> AME >> 341AL Fall, 2007 Description: Physical Measurements and their Errors Physical measurements Procedure for making quantitative measurement: 1. Make a judicious choice of: a. coordinate system b. units of measurement (always SI) c. dimension of measure (dimensional analysis, dimensi... Date Added: 2009-07-20 17:22:14 |
|
|
Get Started With Course Hero Today!
Get study guides, join study groups, and more!
Sign up in seconds with your Facebook account!
Course Hero is a Facebook Application Partner.
Click below to sign-up for FREE.
Our Social Learning Network was built to provide students and key learning partners like professors a platform to share, meet and collaborate while accelerating their comprehension of course-related theories and concepts. We are committed to providing you immediate access to a growing wealth of study materials and an unparalleled academic network of students, professors and other key partners. Why do you care? Because you want the best grade possible and at times need a 24/7 resource that’s responsive to your needs. |
|
What People Are Saying About Course Hero
|
|||
|
|||
|
Explore the benefits of joining Course Hero's social learning network.
|
|||
 |
Get millions of study materials now!Need lecture notes for a missed class or want insightful explanation of the theories and concepts you learn in class? Look no further, Course Hero’s Study Materials empowers you to find a broad and deep set of materials that can help you right now!
Click below to sign-up for FREE.
|
||
 |
Get over 200,000 textbook solutions now!Having difficulty with your homework and need documents that are relevant for your Textbook? Don't be frustrated. Course Hero's Textbook Help presents you study materials from many college courses.
Click below to sign-up for FREE.
|
||
 |
Meet over 300,000 students and your fellow classmates now!Want to meet your current classmates or those that took the class last year? Don’t worry or have anxiety. Course Hero’s Study Groups gives you the seamless opportunity to develop both anonymous or direct relationships with those classmates whom you want to meet and get help from right now!
Click below to sign-up for FREE.
|
||
