Course Solutions And Notes - hansen 3d
| solutions.pdf Path: Cornell >> P >> 214 Fall, 2009 Description: ... Date Added: 2009-04-16 19:58:00 |
| 256Mb_SDRAM_Addendum-6A.pdf Path: Western Michigan >> ECE >> 6050 Fall, 2008 Description: 256Mb: x8, x16 SDRAM Addendum SYNCHRONOUS DRAM Features Supports PC100 and PC133 functionality Fully synchronous; all signals registered on positive edge of system clock Internal pipelined operation; column address can be changed every clock cycl... Date Added: 2009-04-16 19:59:18 |
| tc-2.pdf Path: Cornell >> GB >> 285 Fall, 2009 Description: INTERNATIONAL LABOUR OFFICE GB.285/TC/2 285th Session Geneva, November 2002 Governing Body Committee on Technical Cooperation TC SECOND ITEM ON THE AGENDA Further developments regarding technical cooperation activities in the United Nations syst... Date Added: 2009-04-16 20:00:07 |
| gb-20.pdf Path: Cornell >> GB >> 280 Fall, 2009 Description: INTERNATIONAL LABOUR OFFICE GB.280/20 280th Session Geneva, March 2001 Governing Body TWENTIETH ITEM ON THE AGENDA Composition and agenda of standing bodies and meetings Contents Page Tripartite Meeting on Human Resources Development, Employment... Date Added: 2009-04-16 20:00:15 |
| velocity115.pdf Path: Western Michigan >> ME >> 358 Fall, 2009 Description: ... Date Added: 2009-04-16 20:03:48 |
| blank_grid.pdf Path: Cornell >> ASTROSUN >> 2 Fall, 2009 Description: ... Date Added: 2009-04-16 20:04:40 |
| SLCSP105.pdf Path: Western Michigan >> SLCSP >> 105 Fall, 2009 Description: Different Perspectives on the Natural World: Biology Professors and Their Students (AKA: Breadth vs. depth: a comparison of student and professor conceptualizations of nature\" A paper presented at the 1992 annual meeting of the National Association ... Date Added: 2009-04-16 20:06:15 |
| 09_NeurobioSmell.pdf Path: Cornell >> FS >> 430 Fall, 2009 Description: Olfaction 6000 BC Timeline for Wine History 4000 BC 2000 BC 2000 AD 2 Champagne Perception 0 BCE 1 Caucasia Mesopotania Greece Roman Egypt orthonasal retronasal 8,000 Years 1600 1700 400 Years Champagne Development Chemical Science 1800 FS 4... Date Added: 2009-04-16 20:11:47 |
| lecture-23.pdf Path: Cornell >> CS >> 5410 Fall, 2009 Description: KenBirman i CornellUniversity.CS5410Fall2008. Failuredetectionvs Masking Failuredetection:insomesense,weakest Assumesthatfailuresarerareandlocalized Developsamechanismtodetectfaultswithlowratesoffalse positives(mistakenlycallingahealthynodefaulty) ... Date Added: 2009-04-16 20:11:57 |
| Lect20a.pdf Path: Cornell >> CS >> 530 Spring, 2008 Description: Timers R. Monson-Haefel, Enterprise Java Beans (4th Edition), OReilly. New functionality in EJB 2.1 in past you were almost forced to do this from a client application! Useful for project CS530 S05 Timer Example public abstract class MyClass ... Date Added: 2009-04-16 20:20:53 |
| 13moon.pdf Path: Cornell >> CS >> 667 Fall, 2008 Description: CS667 Jon Moon Lecture 13: Photon Mapping with Participating Media 9 March 2004 Lecturer: Steve Marschner 1 1.1 Aside: Problem 4 discussion Reection and Transmission From a Layer of Optical Medium We can think of modeling a surface as a thin la... Date Added: 2009-04-16 20:21:30 |
| lec14-fa07.pdf Path: Cornell >> CS >> 611 Fall, 2001 Description: CS611 Lecture 14 State and mutable variables 23 September 2007 Lecturer: Andrew Myers 1 Some thoughts about state State refers to the ability to have mutation: a change in value over time. The functional languages we have studied so far, such as t... Date Added: 2009-04-16 20:30:48 |
| S12OSCV2.pdf Path: Purdue >> ECE >> 362 Fall, 2008 Description: DOCUMENT NUMBER S12OSCV2/D OSC Block User Guide V02.03 Original Release Date: 19 July 2002 Revised: 12 February 2003 Motorola, Inc. Motorola reserves the right to make changes without further notice to any products herein to improve reliability, ... Date Added: 2009-04-16 20:38:04 |
| Corbetta.pdf Path: UCSD >> COGS >> 273 Fall, 2009 Description: REVIEWS CONTROL OF GOAL-DIRECTED AND STIMULUS-DRIVEN ATTENTION IN THE BRAIN Maurizio Corbetta and Gordon L. Shulman We review evidence for partially segregated networks of brain areas that carry out different attentional functions. One system, which... Date Added: 2009-04-16 20:38:12 |
| lec07.pdf Path: University of Illinois, Urbana Champaign >> CS >> 475 Fall, 2008 Description: Closure Properties 119 Closure Properties Pumping Lemma: Any regular language is closed under strings obtained from pumping long strings. Describes closure of a language under some string operations We will now consider closure properties of a cla... Date Added: 2009-04-16 20:41:43 |
| Chapter 14 Path: UGA >> PADP >> 7110 Spring, 2009 Description: Chapter 14: Conclusion Components of Bureaucratic Responsibility Accountability: faithful obedience To the law To higher officials directions To standards of efficiency and economy Ethical behavior Adherence to moral standards Avoidance of ev... Date Added: 2009-04-16 21:56:09 |
| deadlines Path: Columbia CC >> PSYC >> 201 Spring, 2008 Description: Deadlines, Deadlines, Deadlines You should print this document so you have quick and easy access to it as needed ALL WORK FOR THE CLASS WILL BE DUE AS INDICATED BELOW. No late work will be accepted unless we have discussed the matter at least three ... Date Added: 2009-04-17 13:14:00 |
| cse355a_grades.pdf Path: ASU >> CSE >> 355 Fall, 2008 Description: Posting ID 0927-214 0825-223 1781-564 7827-138 6391-999 3094-763 5943-481 6401-710 9547-731 8053-015 0150-861 8847-480 5089-257 8072-057 1157-289 0898-516 9205-164 3895-887 8595-314 1777-588 3855-664 9883-620 8558-326 1075-929 1557-636 8767-527 0387-... Date Added: 2009-04-17 18:54:06 |
| chreact3_p06_07.pdf Path: ASU >> ISSUE >> 3 Fall, 2009 Description: Farmer, Jack. \"Stoneys Story.\" Chain Reaction 3 (2001): 6-7. Excerpt from Chain Reaction Volume 3, Number 1, Fall 2001 Pages 6-7 http:/chainreaction.asu.edu Chain Reaction Magazine is produced by the Office of Research Publications and published by... Date Added: 2009-04-17 18:55:36 |
| syllabus.pdf Path: ASU >> CHM >> 332 Fall, 2009 Description: Syllabus CHM 234, General Organic Chemistry II : Spring 2009 : Ian R. Gould Office Hours Office: PS D-109 Mon. 1:00 - 2:00 PM Phone: 965-7278 Tues. 6:00 - 7:00 PM Lectures: Mon., Wed., Fri., 7:30 - 8:20 AM Wed. 9:00 - 10:00 AM Location: LS-A191 Fri. ... Date Added: 2009-04-17 18:55:57 |
| exam4key.pdf Path: ASU >> CHM >> 331 Fall, 2009 Description: CHEM 233, Fall 2008 FINAL EXAM Ian R. Gould PRINTED FIRST NAME ANSWER PRINTED LAST NAME KEY ASU ID or Posting ID Person on your LEFT (or Aisle) !PRINT YOUR NAME ON EACH PAGE! READ THE DIRECTIONS CAREFULLY! USE BLANK PAGES AS SCRATCH PAPER w... Date Added: 2009-04-17 18:55:59 |
| cv-fr-detail-002.pdf Path: Cornell >> TNL >> 7 Fall, 2009 Description: Tristan Lefbure e Population Medicine & Diagnostic Sciences College of Veterinary Medicine Cornell University Ithaca, NY 14850, USA Tel : (+1) 607 253-4228 Fax : (+1) 607 256-5608 TNL7@cornell.edu http:/www.people.cornell.edu/pages/tnl7 Cursus unive... Date Added: 2009-04-17 18:56:12 |
| WIP_embedding_entrepreneurship_in_the_computing_curricula.pdf Path: ASU >> I >> 3 Fall, 2009 Description: Session S2G Work-in-Progress: Embedding Entrepreneurship in the Computing Curricula Kevin Gary, Anshuman Razdan, Harry Koehnemann, Adrian Sannier, Albert Kagan Arizona State Universitys Polytechnic Campus, kgary@asu.edu, razdan@asu.edu, harry@asu.ed... Date Added: 2009-04-17 18:56:56 |
| WIP_embedding_entrepreneurship_in_the_computing_curricula.pdf - Part 2 Path: ASU >> I >> 3 Fall, 2009 Description: IC has created a pipeline of 74 SME opportunities, of which 12 projects have already been completed, with 8 more going t... Date Added: 2009-04-17 18:56:56 |
| Lesson_2.2.1_Probability_Intro.pdf Path: ASU >> MAT >> 142 Fall, 2009 Description: Probability, An Introduction PROBABILITY IS AS INTIMATELY RELATED TO COUNTING PROCESSES AS YOU ARE TO YOUR SKELETON ! WITHOUT COUNTING WE CANNOT COVER THE CONCEPT EXCEPT IN FUZZY GENERALITIES. BY THE END OF THIS SECTION YOU SHOULD BELIEVE THIS. Howev... Date Added: 2009-04-17 18:57:36 |
| 2007_03_11_15_54_35-doc.pdf Path: Cornell >> ASIAN >> 436 Spring, 2008 Description: JINHEN NAAZ HAI HIND PAR: THE HISTORICAL AND SOCIETAL COMMENTARY OF INDIAN FILM Despite the fact that the plots of Sujata, Mughal-e-Azam, Pyaasa and Awara revolve around what are ultimately love stories, all four films additionally focus on a number ... Date Added: 2009-04-17 18:57:41 |
| recapmkt_pac2005.pdf Path: ASU >> CHLIU >> 1 Fall, 2009 Description: Professor Crocker H. Liu Real Estate Capital Markets Revised: September 26, 2005 Problem Set 4: PACs, TACs, Floaters, and Inverse Floaters Download the spreadsheet that accompanies this assignment and use the appropriate worksheet in the workbook t... Date Added: 2009-04-17 18:59:03 |
| homework13.pdf Path: ASU >> MATH >> 371 Fall, 2009 Description: MAT 371 Homework 13 John Quigg Due Wednesday November 23 For each n N dene fn : (0, 1) R by fn (x) = xn . Prove that (fn ) does not converge uniformly. Note that the domain is the open interval (0, 1). Also note that we have already shown that (f... Date Added: 2009-04-17 18:59:58 |
| commentary.pdf Path: Cornell >> CWC >> 181 Fall, 2009 Description: CU MAKING AN INVESTMENT IN SCIENCE AND TECHNOLOGY AND IN SCIENCE EDUCATION The House Science Committee Kevin Stearns/CU Sheila Marikar Sheila Marikar \'05 interviews Congressman Sherwood Boehlert, Chairman of the House Science Committee. and \"to e... Date Added: 2009-04-17 19:00:53 |
| Slope.pdf Path: ASU >> KIN >> 335 Fall, 2009 Description: IMPORTANT Association between position, velocity, and acceleration: Velocity: rate of change of position w.r.t. time Acceleration: rate of change of velocity w.r.t. time Instantaneous velocity is reflected by the slope of the position curve at so... Date Added: 2009-04-17 19:01:15 |
| 01linearmap.pdf Path: ASU >> MATH >> 473 Fall, 2009 Description: MAT 473 Intermediate Real Analysis II John Quigg Spring 2009 revised January 14, 2009 Linear maps Exercises 1. Fix x Rn , and dene S L(R, Rn ) and T L(Rn , R) by St = tx and T y = x y. Prove that S = T = x . 2. Let T L(X, Y ) be onto. Prove th... Date Added: 2009-04-17 19:07:56 |
| PS4_sampleQs_soln2008.pdf Path: Cornell >> CEE >> 331 Fall, 2008 Description: ... Date Added: 2009-04-17 19:11:31 |
| PS4_sampleQs_soln2008.pdf Path: Cornell >> CEE >> 20 Fall, 2009 Description: ... Date Added: 2009-04-17 19:11:31 |
| VitaCurrent.pdf Path: Cornell >> JTP >> 35 Fall, 2009 Description: VITA JEFFREY T. PRINCE 139 Pine Tree Rd. Ithaca, NY 14850 E-mail: jtp35@cornell.edu Web page: http:/www.people.cornell.edu/pages/jtp35/ Office: 607-254-4744 Fax: 607-255-9984 PERSONAL INFORMATION Born: April 29, 1976 Citizenship: USA ACADEMIC POSITI... Date Added: 2009-04-17 19:13:01 |
| denmark_2.pdf Path: Cornell >> LC >> 02 Fall, 2009 Description: Ninth Meeting of European Labour Court Judges Geneva, 3-4 December 2001 DENMARK SEXUAL HARASSMENT Questionnaire General Reporter: Professor Alan Neal Professor of Law, University of Warwick, United Kingdom and Chairman of Employment tribunals (London... Date Added: 2009-04-17 19:15:17 |
| nice2005.pdf Path: ASU >> SHS >> 465 Fall, 2008 Description: Nice (1925) A child who would not talk Pedagogical Seminary, 32, 105-142. Overview Four daughters, Norman, Oklahoma; Longitudinal Diary Study At least 8 articles, 1915 to 1925; Rich description of Rs first 38 words; R from first words to age 4;0. Voc... Date Added: 2009-04-17 19:16:34 |
| HFESPenMice04.pdf Path: Cornell >> HFES >> 04 Fall, 2009 Description: Evaluation of Pen-Shaped and Conventional Mouse Designs Chia-chen Chao and Alan Hedge Cornell University, NYS College of Human Ecology Department of Design and Environmental Analysis, Ithaca, NY 14853, USA Hedge, A. and Chen, C.C. (2004) Evaluation ... Date Added: 2009-04-17 19:19:21 |
| SUSUSTBS.pdf Path: ASU >> MAJORMAP >> 08 Fall, 2009 Description: Major Map: Sustainability Bachelor of Science (B.S.) School of Sustainability, Tempe Campus Catalog Year: 2008-2009 Completed ATP: Course Subject and Title (courses in bold/shading are critical) Hrs. Upper Division Transfer Course/Grade Yes No Co... Date Added: 2009-04-17 19:19:50 |
| Q813.pdf Path: Cornell >> P >> 101 Fall, 2009 Description: ... Date Added: 2009-04-17 19:20:03 |
| lec6.kr.pdf Path: Cornell >> CS >> 630 Fall, 2004 Description: CS630 Lecture 6: The BM25/Okapi method Date: February 14th, 2006 Lecturer: Lillian Lee Scribes: Ari Rabkin and Victoria Krat In this lecture, well describe BM25/Okapi, a state-of-the-art (classic) probabilistic retrieval approach. Contents 1 Last Ti... Date Added: 2009-04-17 19:20:24 |
| lec6.kr.pdf - Part 2 Path: Cornell >> CS >> 630 Fall, 2004 Description: relevance labels. It s hard to get users to do this, however, since it s a real commitment of time and energy, for p... Date Added: 2009-04-17 19:20:24 |
| LokenOregonT.pdf Path: ASU >> GEOMATHVER >> 2 Fall, 2009 Description: Oregon or Bust: The Journey West Along the Oregon Trail Students learn of the influence of places and environments on the events and conditions settlers experienced on their journey along the Oregon Trail. These influences can be compared mathematica... Date Added: 2009-04-17 19:22:24 |
| onPapertiger.pdf Path: ASU >> HOW >> 2 Fall, 2009 Description: Put On Your Red Shoes And Dance: Special Feature on Australian Womens Poetry Papertiger #4 The newest edition of high octane Australian CDRom journal papertiger: new world poetry offers a feast of poetical features and creatures. Stylishly designed b... Date Added: 2009-04-17 19:23:39 |
| lec26-fa07.pdf Path: Cornell >> CS >> 611 Fall, 2001 Description: CS611 Lecture 26 Simply-Typed -Calculus 26 October 2007 Lecturer: Andrew Myers 1 Introduction Type checking is a lightweight technique for proving simple properties of programs. Unlike theorem-proving techniques based on axiomatic semantics, type ... Date Added: 2009-04-17 19:24:09 |
| lils-9.pdf Path: Cornell >> GB >> 292 Fall, 2009 Description: INTERNATIONAL LABOUR OFFICE GB.292/LILS/9 292nd Session Geneva, March 2005 Governing Body Committee on Legal Issues and International Labour Standards LILS NINTH ITEM ON THE AGENDA Form for reports on the application of unratified Conventions (a... Date Added: 2009-04-17 19:24:31 |
| PHY571lect1-3.pdf Path: ASU >> PHY >> 571 Fall, 2008 Description: PHY 571: Quantum Physics John Venables 5-1675, john.venables@asu.edu Spring 2008 Introduction and Background Topics Module 1, Lectures 1-3 Introduction to Quantum Physics Discussion of Aims Starting and End Points Optional Diagnostic Test Effo... Date Added: 2009-04-17 19:25:28 |
| human_capital_2.pdf Path: Oregon >> ECON >> 450 Fall, 2009 Description: Human Capital Part II: The Firm Perspective I. The Signaling Model. A. Dim view of education 1. \"good-old-boys\" society 2. signaling hypothesis - education is correlated with but not the cause of \"skill\". Education is a signal of productivity B. No S... Date Added: 2009-04-17 19:29:55 |
| Ball&Dagger-ch5-123-127.pdf Path: Oregon >> INTL >> 240 Fall, 2008 Description: ... Date Added: 2009-04-17 19:31:07 |
| 554hw2.pdf Path: Cornell >> ECE >> 554 Spring, 2008 Description: ... Date Added: 2009-04-17 19:34:41 |
| WTO.pdf Path: Cornell >> CHARLESTON >> 07 Fall, 2009 Description: WTO Agricultural Negotiations Implications for the U.S. Dairy Sector Jonathan R. Coleman U.S. International Trade Commission Disclaimer The opinions expressed in this presentation are solely the opinions of the author and in no way reflect the opi... Date Added: 2009-04-17 19:35:40 |
| 23feb04.pdf Path: Oregon >> PSY >> 607 Fall, 2008 Description: Traumas Legacy Psychology 607, Winter 2004, University of Oregon Discussion Questions for Denial of Abuse Readings Monday, Feb 23, 1:30-3:30 Becker Blease, K.A. & Freyd, J.J. (under review) Research participants telling the truth about their lives: T... Date Added: 2009-04-17 19:36:30 |
| pixela.pdf Path: Oregon >> VISIT >> 07 Fall, 2009 Description: NMOS n+ P-Well n+ PMOS p+ p+ NMOS n+ P-Well n+ Detector (V= 2.5) n+ N-Well Deep N-Well NMOS n+ P-Well n+ PMOS p+ p+ NMOS n+ P-Well n+ N-Well (V=1.8) N-Well (V=1.8) c b c a Depleted P-epi 7um Undepleted P-epi d V=0 Charged Particle or la... Date Added: 2009-04-17 19:36:40 |
| midterm2rev.pdf Path: Oregon >> MATH >> 111 Fall, 2008 Description: Midterm II Review The second midterm examination will be held Monday, 21 November 2005. It will explicitly cover sections 3.7 through 5.2A; however, it might involve previous material. Here is a list of topics with which you should be familiar: 1. In... Date Added: 2009-04-17 19:37:17 |
| rubric_crit_esay2.pdf Path: Alaska Anch >> ED >> 674 Fall, 2009 Description: School of Education University of Alaska Southeast Ed 674-07 Performance Assessment-Critical Essay Element Not accepted 0-2 The issue selected is one that is not clearly related to the acquisition of oral or written language and/or reading process ... Date Added: 2009-04-17 19:39:47 |
| Chapter_06.pdf Path: Alaska Anch >> CHEM >> 341 Fall, 2009 Description: Chapter 6 1. What is the IUPAC name of the following alkyl halide? [A] 2-methyl-4-bromopentane [B] 4-methyl-2-bromopentane [C] 2-bromo-4-methylpentane [D] 2-bromo-2-methylpentane [E] 2-bromo-1-isopropylpropane 2. What is the IUPAC name of the follow... Date Added: 2009-04-17 19:40:31 |
| Chapter_4_key.pdf Path: Alaska Anch >> ECON >> 202 Fall, 2009 Description: Chapter 4: Supply and Demand 1. a) Assuming that beef is a normal good, demand for beef increases with consumer income, causing the equilibrium price and quantity exchanged to increase. b) An increase in the price of beef, ceteris paribus, decreases... Date Added: 2009-04-17 19:41:53 |
| Chapter_3.pdf Path: Alaska Anch >> ED >> 691 Fall, 2009 Description: ... Date Added: 2009-04-17 19:41:55 |
| Astr225_SM08_Exam_3_Study_Guide.pdf Path: Alaska Anch >> ASTR >> 225 Fall, 2009 Description: ASTR225 Summer 2008 Exam 3 Study Guide Exam3isatwohour,proctored,closedbook,nostudentnotes,paperexam. UASSitkaofficeemailstheexamtoyourproctorwhothenprintsacopyforyou.Yourproctorfaxesor scansyourcompletedexambacktotheSitkaoffice.TheSiktaofficeemai... Date Added: 2009-04-17 19:41:58 |
| SM08_Astr225_Week10_Checklist_Revised.pdf Path: Alaska Anch >> ASTR >> 225 Fall, 2009 Description: PleasenotethattheduedateforLTDetectingExtrasolarPlanetsisSundayJuly27,notAug8. Summer2008ASTR225TD1Checklist Week10:MondayJuly21throughSundayJuly27 (*duedatesextendedthroughendofsemester*) WEEK10 Preview Uses Proctor? Activity WebMeetingWedJuly... Date Added: 2009-04-17 19:42:01 |
| In_class3_Answerkey.pdf Path: Alaska Anch >> ECON >> 201 Fall, 2009 Description: Macroeconomics Fall 2006 Inclass #3 Answer Key 1. What is the governments role in the savings and investment market? What are the consequences of a government budget surplus and deficit? The government changes total savings supply in the savings and... Date Added: 2009-04-17 19:42:27 |
| NABC16_banquet.pdf Path: Cornell >> NABC >> 16 Fall, 2009 Description: PART V BANQUET AND LUNCHEON SPEAKERS Frankenfoods: What to do When the Devil Has All the Good Songs Peter Calamai Agricultures Future: Reading the Tea Leaves John P Oliver . Disaggregating Biotechnology and Poverty: Finding Common International Goal... Date Added: 2009-04-17 19:42:34 |
| Test1_M200_Outline.pdf Path: Alaska Anch >> MATH >> 200 Fall, 2009 Description: Calculus I Test 1 Study Suggestions This test will cover Limits and Continuity, i.e., all topics from Chapter 2. Remember, though, that a good understanding of material in Chapter 1 (a review of Pre Calculus) is essential for Chapter 2. Study Suggest... Date Added: 2009-04-17 19:42:38 |
| CEE601_Nov1402_McMahon.pdf Path: Cornell >> CEE >> 20 Fall, 2009 Description: SEMINAR Thursday, November 14, 2002 4:30 p.m. (refreshments at 4:15 p.m.) 366 Hollister Hall Biological phosphorus removal in activated sludge: how do polyphosphate accumulating bacteria do their job? Prof. Trina McMahon Department of Civil & Enviro... Date Added: 2009-04-17 19:43:09 |
| CEE601_Nov1402_McMahon.pdf Path: Cornell >> CEE >> 601 Fall, 2008 Description: SEMINAR Thursday, November 14, 2002 4:30 p.m. (refreshments at 4:15 p.m.) 366 Hollister Hall Biological phosphorus removal in activated sludge: how do polyphosphate accumulating bacteria do their job? Prof. Trina McMahon Department of Civil & Enviro... Date Added: 2009-04-17 19:43:10 |
| pr-11-pm.pdf Path: Cornell >> ILC >> 88 Fall, 2009 Description: Seventh sitting Tuesday, 6 June 2000, 3.15 p.m. President: Mr Moorhead, Mr. Agyei GLOBAL REPORT FOLLOW-UP TO THE DECLARATION ON FUNDAMENTAL PRINCIPLES AND RIGHTS AT WORK: DISCUSSION (cont.) UNDER THE The PRESIDENT (Mr MOORHEAD) I am pleased to open... Date Added: 2009-04-17 19:43:44 |
| luraline_page3.pdf Path: Cornell >> ECN >> 26 Fall, 2009 Description: LED Lighting Design Section 6=1-0 Emma Nagle ecn26@cornell.edu 201.835.8804 ... Date Added: 2009-04-17 19:44:13 |
| Self_Dwelling_Final_Board.pdf Path: Cornell >> ECN >> 26 Fall, 2009 Description: ... Date Added: 2009-04-17 19:44:18 |
| braband2.pdf Path: Cornell >> PROJ >> 00 Fall, 2009 Description: Facilitation of School District IPM Implementation Report on a Community IPM Demonstration Project December 22, 2000 Project Leader: Lynn Braband (Community IPM, Geneva, NY) Collaborators: Livonia School District, Genesee Valley BOCES, CCE of Livings... Date Added: 2009-04-17 19:45:33 |
| Writing_Vocabulary.pdf Path: Alaska Anch >> ED >> 661 Fall, 2009 Description: ... Date Added: 2009-04-17 19:45:51 |
| westonP.pdf Path: Cornell >> PROJ >> 02 Fall, 2009 Description: Final Project Report to the NYS IPM Program, Agricultural IPM 2002-2003 Title: Evaluation of hemlocks for resistance to hemlock woolly adelgid Project Leader(s): Paul A. Weston, Department of Entomology, Cornell University, Ithaca, NY Cooperator(s)... Date Added: 2009-04-17 19:46:53 |
| Case02_OliversMarket.pdf Path: Southern Oregon >> BA >> 427 Fall, 2008 Description: Assignment Questions 1. What are the key elements of the strategy at Olivers Market? Which of the five generic competitive strategies discussed in Chapter 5 is Olivers Market pursuing? 2. What competitive pressures must Olivers Market be prepared to ... Date Added: 2009-04-17 19:47:14 |
| journal1.pdf Path: CSU LA >> AREED >> 2 Fall, 2009 Description: 580 Communications of the Association for Information Systems (Volume 13, 2004)580-588 THE SUBTLE AND COUNTERINTUITIVE HAZARDS OF NON-SEQUENTIAL EVALUATION IN LANGUAGES OF THE C FAMILY Adam Reed Knox B. Wasley Department of Computer Information Sy... Date Added: 2009-04-17 19:47:49 |
| cis484_final_reading_S08.pdf Path: CSU LA >> CIS >> 484 Fall, 2009 Description: CIS 484 Reading Suggestion for Final Exam Spring 2008, Dr. Song Xing The following materials are suggested to study for the Final exam. 1. Lecture slides #4 (pages 41-105), Lecture slides #5, Lecture slides (short version) #6, Lecture slides (short v... Date Added: 2009-04-17 19:48:07 |
| 459f07-final_studyguide.pdf Path: CSU LA >> INSTRUCTIO >> 1 Fall, 2009 Description: POLS 459 Politics of East Asia Final Exam Study Guide 1. The final exam is comprehensive. This means that the questions will cover any material covered in the required readings and lectures from the first session up to and including session #21. You ... Date Added: 2009-04-17 19:51:38 |
| ocean-rocky03.pdf Path: Cornell >> EAS >> 154 Fall, 2008 Description: Temperate Rocky Intertidal Communities Temperate Rocky Intertidal Communities Community structure Community structure Define community and terms Intermediate Disturbance Hypothesis Controls of Community Structure > Top down > Bottom up Competitio... Date Added: 2009-04-17 19:52:03 |
| ocean-rocky03.pdf - Part 2 Path: Cornell >> EAS >> 154 Fall, 2008 Description: Come to Shoals Marine Lab for 3 weeks just before classes start (5 credits) Biology of the Marine Invertebrates Taught... Date Added: 2009-04-17 19:52:03 |
| dbalg4.pdf Path: Old Dominion >> CS >> 450 Fall, 2006 Description: Set Theoretic Ops 2001 Irwin Levinstein GOOD FNAME Frank Alice Joyce Ahmad Union LNAME Wong Zelaya English Jabbar SAL 40K 25K 25K 25K WELL_PAID FIRST LAST Frank Wong Jenny Wallace Ram Narayan James Borg SAL 40K 43K 38K 55K 2001 Irwin Levins... Date Added: 2009-04-17 19:54:09 |
| Quiz2-3_Pg4.pdf Path: Old Dominion >> CS >> 381 Fall, 2008 Description: ... Date Added: 2009-04-17 19:55:24 |
| Ch2-1.pdf Path: Old Dominion >> P >> 111 Fall, 2009 Description: Ch. 2 -1 Pg. 1 Chapter Two Physics 111N One Dimensional Motion - Translation A. Outline: ! Displacement ! Average Velocity ! Instantaneous Velocity ! Acceleration ! Rectilinear Equations - where a = constant ! Free Fall Examples Dynamics - study of ... Date Added: 2009-04-17 19:56:46 |
| 9October.pdf Path: Old Dominion >> BIOL >> 221 Spring, 2008 Description: Checklist of Plants for 9 October 2001. Merchant Millpond and Sand Banks, Gates County, s NC WOODY PLANTS Acer rubrum Carya cordiformis Chamaecyparis thyoides Cornus florida Juglans nigra Liquidambar styraciflua Nyssa aquatica Nyssa sylvatica Pinus e... Date Added: 2009-04-17 19:58:04 |
| AtonementInContext.pdf Path: Vanderbilt >> ANS >> 212 Fall, 2009 Description: Atonement Report Romans 2-3:31 September 15, 2008 Keeping in mind Dr. Pattes emphasis on the idea that our interpretation matters our group sought to define atonement, based on the context in which we find ourselves. These are the points our group ... Date Added: 2009-04-17 19:59:17 |
| week6b.pdf Path: Vanderbilt >> P >> 276 Fall, 2009 Description: Armstrong, Gleitman, & Gleitman (1983) Week 6 : Thursday According to Armstrong, Gleitman, and Gleitman, in what ways might prototype theories be inadequate (and in what ways might the apparent death of the classical theory be overstated)? What evi... Date Added: 2009-04-17 20:00:13 |
| groupprob20051111.pdf Path: Vanderbilt >> A >> 311 Fall, 2009 Description: A311, 2005-11-11 1. (a) From linearizing the mass and momentum equations (neglecting viscosity and gravitational potential), we showed that small perturbations propogate as waves with speed: as0 = k T0 m P . Show that in the case of an isentropic ... Date Added: 2009-04-17 20:00:26 |
| 20060622probs.pdf Path: Vanderbilt >> A >> 102 Fall, 2009 Description: Astro 102 Group Problems #3 2006-June-22 Useful Data 1 year = 3.156 107 seconds 1 AU = 1.496 1011 m 1 pc = 206, 265 AU c = 3.00 10 m s 8 1 M = 1.99 1030 kg R = 6.97 108 m L = 3.8 1026 J s1 T = 5, 800 K = 5.67 108 W m2 K4 1 rad = 206, 265 18... Date Added: 2009-04-17 20:00:28 |
| scansion.pdf Path: Cornell >> CLASS >> 417 Fall, 2009 Description: Assignment:StichicMetersofOldComedy 1.Introductory:readRaven,GreekMetre2732(iambictrimeter)345(trochaictetrameter),569 (stichicanapaests) 2.Advanced(optional):West,GreekMetre8893(iambictrimeterandtrochaictetrameterin comedy);946(anapaestsincomedy,st... Date Added: 2009-04-17 20:02:41 |
| R_Seeber_CV.pdf Path: Cornell >> RS >> 60 Fall, 2009 Description: RONALD L. SEEBER Curriculum Vitae Personal Home Address: 4184 Deer Path Circle Marcellus, NY 13108 Telephone: 315-673-4108 New York State School of Industrial and Labor Relations 309 Ives Hall Cornell University Ithaca, NY 14853-3901 Telephone: 607-2... Date Added: 2009-04-17 20:04:20 |
| CHM105P32.pdf Path: Missouri State >> CHM >> 105 Fall, 2008 Description: CHM 105 & 106 MO1 UNIT FOUR, LECTURE THREE 1 CHM 105/106 Program 32: Unit 4 Lecture 3 IN OUR PREVIOUS LECTURE WE WERE LOOKING AT THE BEHAVIOR OF GASSES AND SOME OF THE RELATIONSHIPS INVOLVED. WE TALKED FIRST OF ALL ABOUT MOLAR VOLUME, THAT IS, TH... Date Added: 2009-04-17 20:06:18 |
| finland_1.pdf Path: Cornell >> LC >> 02 Fall, 2009 Description: Ninth Meeting of European Labour Court Judges Geneva, 3-4 December 2001 FINLAND THE ROLE OF LABOUR COURT JUDGES IN THE IMPLEMENTATION OF SOCIAL POLICIES Questionnaire General Reporter: Judge Stephen Adler, President National Labour Court of Israel 1... Date Added: 2009-04-17 20:06:28 |
| 101hwk.pdf Path: N. Illinois >> MATH >> 101 Fall, 2008 Description: Math 101 Core Competency in Mathematics SPRING 2009 Homework Assignments Assignment Homework #1 Homework #2 Homework #3 Section I.1 I.2 I.2 I.2 I.3 I.3 I.4 I.5 I.5 I.5 I.6 I.6 I.6 II.1 II.2 II.3 II.3 II.4 III.1 III.1 III.2 III.2 VI VI VI III.3 III.3 ... Date Added: 2009-04-17 20:07:47 |
| test1soln.pdf Path: N. Illinois >> MATH >> 230 Fall, 2008 Description: MATH 230 4 1. (8 pts each) Find the derivative of each function. cos x (a) y = ln(sin x) y = = cot x sin x (b) y = ln 4 EXAM I Solutions 2/20/2007 x2 1 x2 + 1 x = 1 1 ln(x2 1) ln(x2 + 1) 4 4 y = sec2 e x y = 1 2x 1 2x x 2 2 = 4 4 x 1 ... Date Added: 2009-04-17 20:08:00 |
| quiz9ans.pdf Path: N. Illinois >> SEC >> 230 Spring, 2009 Description: Math 230 Section 2 Quiz #9 Solutions x2n+1 . n! n=0 1. Find the radius and interval of convergence for The simplest thing to do here is take absolute values and use the ratio test. You get an+1 lim = lim n an n |x2(n+1)+1 | (n+1)! |x2n+1 | n! = l... Date Added: 2009-04-17 20:09:48 |
| genetics14.pdf Path: N. Illinois >> BIOS >> 208 Fall, 2008 Description: BIOS 208, Solutions to Genetics Problems, Chapter 14 Professor Stafstrom Page 1 A couple of general suggestions: - When beginning a problem, immediately convert verbal descriptions into symbols. - Try to avoid using Punnett squares; instead, us the... Date Added: 2009-04-17 20:10:30 |
| Exam2sol.pdf Path: N. Illinois >> MATH >> 229 Fall, 2008 Description: MATH 229 : Exam 2 - October 27 Instructor Oce : DuSable 370 E-mail Web Page for Math 229 : RACOVITAN Michael ; Oce Phone : 753-1146 : racovita@math.niu.edu : www.math.niu.edu/ racovita/Math229.html 1 Solutions (Ex. 1) State the following formulas, ... Date Added: 2009-04-17 20:11:36 |
| hw4.pdf Path: Cornell >> P >> 317 Fall, 2009 Description: 4 Atomic structure Exercise 4.1: Quantum numbers Exercise 9.11 from Serway, Moses, and Moyer. Exercise 4.2: Orbital and spin angular momentum Exercise 9.14 from Serway, Moses, and Moyer. Exercise 4.3: Magnitude of spin-orbit coupling (a) Exercise... Date Added: 2009-04-17 20:11:52 |
| tabs.pdf Path: N. Illinois >> WORD >> 2003 Fall, 2009 Description: Microsoft Word 2003 Tabs Paula Propst Information Technology Services Customer Support Services Northern Illinois University November 18, 2004 Tabs Microsoft Word 2003 Table of Contents Click on the topic you wish to learn about._Toc79288457 Se... Date Added: 2009-04-17 20:13:00 |
| notes-2008-09-15-dw.pdf Path: IPFW >> VCDP >> 374 Fall, 2009 Description: Fall 2008 VCD P374 Computer Art and Design II Overview of Adobe Dreamweaver Notes for September 15, 2008 Topics Learning the Workspace Changing Preferences Setting up a Site Creating a New Document Saving Pages Editing a Page Working w... Date Added: 2009-04-17 20:14:09 |
| mcgaha.pdf Path: IPFW >> ARTICS >> 04 Fall, 2009 Description: From: Cervantes: Bulletin of the Cervantes Society of America , 24.1 (2004): 173-88. Copyright 2004, The Cervantes Society of America. Is There a Hidden Jewish Meaning in Don Quixote? MICHAEL MCGAHA t will probably never be possible to prove that ... Date Added: 2009-04-17 20:14:37 |
| section5.1answers.pdf Path: IPFW >> MA >> 153 Fall, 2008 Description: Section 5.1 1. (a) x 1 f(11) = 0 f(01) = f(1) = 0 1 f(11) = f(0) = 2 2 f(21) = f(1) = 1 3 f(31) = f(2) = 1 g(x) = f(x1) f(2) = 3 (b) x h(x) = f(x+1) (c) 3 f(3+1) = f(2) = 3 2 f(2+1) = f(1) = 0 1 f(1+1) = f(0) = 2 0 f(0+1) = f(1) = 1 1 f(... Date Added: 2009-04-17 20:15:01 |
| ReadingQuestions1.3and1.4.pdf Path: IPFW >> MA >> 153 Fall, 2008 Description: Reading Questions for Section 1.3 and 1.4 (6 pts) Name _ Due Date: _ Bring this completed sheet with you to class on the due date to be handed in at the very beginning of the period. (1) 1. On page 20, the text writes a linear function as y = b + m... Date Added: 2009-04-17 20:15:03 |
| martin.pdf Path: IPFW >> ARTICF >> 01 Fall, 2009 Description: 21.2 (2001) Reviews 227 Ingeniosa Invencin: Essays on Golden Age Spanish Literature for Geoffrey L. Stagg in Honor of his Eighty-fifth Birthday. Ed. Ellen Anderson and Amy Williamsen. Newark, DE: Juan de la Cuesta, 1999. xx + 258 pp. ISBN: 0-93638... Date Added: 2009-04-17 20:15:24 |
| pspcad.pdf Path: CSU Northridge >> VER >> 8 Fall, 2009 Description: MicroSim PSpice A/D & Basics+ Circuit Analysis Software Users Guide MicroSim Corporation 20 Fairbanks Irvine, California 92618 (714) 770-3022 Version 8.0, June, 1997. Copyright 1997, MicroSim Corporation. All rights reserved. Printed in the United... Date Added: 2009-04-17 20:16:26 |
| noteset_03.pdf Path: CSU Northridge >> COMP >> 182 Fall, 2009 Description: COMP 182 Fall 2008 Note Set #3 Recursion Recursion is a strategy or technique for solving a class of problems. Its closely related to the concept of proof by mathematical induction. In the context of programming, we frequently use recursion as a stra... Date Added: 2009-04-17 20:18:07 |
| alternative01f04.pdf Path: CSU Northridge >> SF >> 70713 Fall, 2009 Description: Problem of the Week. Proposed by Bernardo brego and Silvia Fernndez. August 23-30 Four basketballs, 12 inches in diameter, are placed on the oor forming a square. Any two balls forming a side of the square are touching (see gure below). A fth baske... Date Added: 2009-04-17 20:18:34 |
| math581_hw3.pdf Path: CSU Northridge >> MATH >> 581 Fall, 2009 Description: MATH 581 Numerical Methods for Linear Systems Spring 2008 Homework 3 Due: Thurs. March 6, 2008 Lecture 10, pg. 76: 10.1, 10.2, 10.3 Lecture 11, pg. 85: 11.1, 11.3 Additional Problem 1. For a given matrix A Rmn , with m n: (a) Find the orthogonal... Date Added: 2009-04-17 20:19:56 |
| math581_hw3.pdf Path: CSU Northridge >> MATH >> 715473 Fall, 2009 Description: MATH 581 Numerical Methods for Linear Systems Spring 2008 Homework 3 Due: Thurs. March 6, 2008 Lecture 10, pg. 76: 10.1, 10.2, 10.3 Lecture 11, pg. 85: 11.1, 11.3 Additional Problem 1. For a given matrix A Rmn , with m n: (a) Find the orthogonal... Date Added: 2009-04-17 20:19:56 |
| probweek03f05.pdf Path: CSU Northridge >> SF >> 70713 Fall, 2009 Description: Department of Mathematics Proposed by Bernardo brego and Silvia Fernndez September 19-26 Consider an arbitrary collection of six irrational numbers. Show that there are always three of them whose sums by pairs are also irrational. That is, show th... Date Added: 2009-04-17 20:20:15 |
| Solutions_PE3.pdf Path: CSU Northridge >> TAB >> 2595 Fall, 2009 Description: ... Date Added: 2009-04-17 20:22:53 |
| table.pdf Path: CSU Northridge >> SK >> 287035 Fall, 2009 Description: ... Date Added: 2009-04-17 20:23:16 |
| experiment7.pdf Path: CSU Northridge >> CHEM >> 355 Fall, 2009 Description: Experiment 7: Dynamic NMR spectroscopy (Dated: July 24, 2008) I. INTRODUCTION In general spectroscopic experiments are divided into two categories: optical spectroscopy and magnetic spectroscopy. In previous experiments optical spectroscopy based ... Date Added: 2009-04-17 20:26:35 |
| pset3_s99.pdf Path: Cornell >> P >> 214 Fall, 2009 Description: Physics 214 Spring 99|Problem Set 3|Solutions Handout February 18 1999 1. Reading Assignment and Computer Lab 1 Reading Assignment: Week Beginning February 8: Serway 16.6,16.8 Week Beginning February 15: Serway 18.1,18.2,18.3,18.4 Computer Lab 1, p... Date Added: 2009-04-17 20:27:56 |
| Burcu.pdf Path: Texas San Antonio >> ES >> 6973 Fall, 2009 Description: ASSESSMENT OF THE SEA ICE ELEVATION AND THE MECHANICAL PROCESSES THAT INFLUENCE ICE THICKNESS USING THE ICE CLOUD AND LAND ELEVATION SATELLITE (ICESAT) Burcu 0. Cicek 04/29/2005 SCOPE OF THIS PRESENTATION 1. Introduction Overview the Ice Cloud and... Date Added: 2009-04-17 20:28:27 |
| CountPanel.pdf Path: Texas San Antonio >> CS >> 4773 Fall, 2008 Description: JBuilder - Filename = D:/Classes/CS4773/web/cs4773s2004/projects/frames/src/edu/utsa/frames/CountPanel.java Printed on February 2, 2004 at 8:19 AM by Kay A. Robbins Page 1 of 1 package edu.utsa .frames ; import java .awt.*; import java .awt.event .... Date Added: 2009-04-17 20:31:07 |
| Lecture-Btrees-Handout.pdf Path: Texas San Antonio >> CS >> 5633 Fall, 2008 Description: CS 5633 - Spring 2006 External memory dictionary Task: Given a large amount of data that does not fit into main memory, process it into a dictionary data structure Need to minimize number of disk accesses With each disk read, read a whole block of... Date Added: 2009-04-17 20:32:52 |
| 04_Admission_98-99.pdf Path: Texas San Antonio >> UG >> 98 Fall, 2009 Description: 4. ADMISSION Classifications and Requirements First-Time Freshmen High School Graduates GED Applicants Recommended Preparation Early Admission Admission by Individual Approval Provisional Admission Transfer Students With Less Than 30 Semester Credit... Date Added: 2009-04-17 20:34:15 |
| 04_Admission_98-99.pdf - Part 2 Path: Texas San Antonio >> UG >> 98 Fall, 2009 Description: not required to submit SAT or ACT scores; admission for these students is based on satisfactory GED scores as outlined a... Date Added: 2009-04-17 20:34:15 |
| 04_Admission_98-99.pdf - Part 3 Path: Texas San Antonio >> UG >> 98 Fall, 2009 Description: oint average be in good standing at the last institution attended be eligible to return (i.e., free of suspension, dismi... Date Added: 2009-04-17 20:34:15 |
| 04_Admission_98-99.pdf - Part 4 Path: Texas San Antonio >> UG >> 98 Fall, 2009 Description: itizen who accepts responsibility for the student\'s financial needs. 6. Submit evaluation of foreign credentials. Reques... Date Added: 2009-04-17 20:34:15 |
| 04_Admission_98-99.pdf - Part 5 Path: Texas San Antonio >> UG >> 98 Fall, 2009 Description: er for courses are not retained indefinitely. The University reserves the right to decline admission to applicants with... Date Added: 2009-04-17 20:34:15 |
| Class9_Sridaran.pdf Path: Dartmouth >> CS >> 188 Fall, 2009 Description: Recovering Social Networks From Massive Track Datasets Christopher I. Connolly J.Brian Burns Hung H. Bui AIC, SRI International Presenter: Geethmala Sridaran CS88/188 Agenda Aim Approach Evaluation Extension Strengths and Limitations Improvements S... Date Added: 2009-04-17 20:34:53 |
| midF2007.pdf Path: Dartmouth >> CS >> 8 Fall, 2009 Description: Name: COSC 8, Fall 2007 Midterm Exam October 30, 2007 Problem Grade Points Grader 1 2 3 4 5 6 Total 15 20 15 20 15 15 100 General Instructions There are six (6) problems on this exam. Please check now that you have a complete exam ... Date Added: 2009-04-17 20:35:19 |
| sec38.pdf Path: Dartmouth >> C >> 2 Fall, 2009 Description: Difference Equations to Differential Equations Section 3.8 Finding Maximum and Minimum Values Problems involving nding the maximum or minimum value of a quantity occur frequently in mathematics and in the applications of mathematics. A company may ... Date Added: 2009-04-17 20:35:56 |
| sec38.pdf Path: Dartmouth >> C >> 3 Fall, 2009 Description: Difference Equations to Differential Equations Section 3.8 Finding Maximum and Minimum Values Problems involving nding the maximum or minimum value of a quantity occur frequently in mathematics and in the applications of mathematics. A company may ... Date Added: 2009-04-17 20:35:56 |
| jin-dai-lu-sdm06.pdf Path: Dartmouth >> SDM >> 06 Fall, 2009 Description: Spatial-Temporal Data Mining in Traffic Incident Detection Ying Jin, Jing Dai, Chang-Tien Lu Department of Computer Science, Virginia Polytechnic Institute and State University {jiny, daij, ctlu}@vt.edu Abstract Real time traffic incident detection ... Date Added: 2009-04-17 20:36:16 |
| jin-dai-lu-sdm06.pdf - Part 2 Path: Dartmouth >> SDM >> 06 Fall, 2009 Description: on. Since data collected from freeway detectors have an inherently temporal and spatial context, the time and space comp... Date Added: 2009-04-17 20:36:16 |
| jin-dai-lu-sdm06.pdf - Part 3 Path: Dartmouth >> SDM >> 06 Fall, 2009 Description: ve time slots, which indicates the high potentiality of real incident, the alarm level will increase to a certain value... Date Added: 2009-04-17 20:36:16 |
| jin-dai-lu-sdm06.pdf - Part 4 Path: Dartmouth >> SDM >> 06 Fall, 2009 Description: detection approach. In the implementation we assume outliers are 5% of all data samples. In Figure 4 and Figure 5, incid... Date Added: 2009-04-17 20:36:16 |
| m69w09day1.pdf Path: Dartmouth >> M >> 69 Fall, 2009 Description: Math 69 Winter 2009 Monday, January 5 Propositional Logic and Truth Tables Here are some propositional connectives. Not: And: Or: If . . . then: If and only if: One way to give the meaning of a propositional connective is via a truth table, such... Date Added: 2009-04-17 20:39:01 |
| dreamx_stylesheets1.pdf Path: Texas El Paso >> DREAMX >> 06 Fall, 2009 Description: Working with Dreamweaver MX, UTEP Tutorial 6: Style Sheets, page 1 1b) We will begin in our recently developed website, and open one of our pages. 1c) To work with Style Sheets, open the Style Sheet Inspector with the command Window: CSS Styles and ... Date Added: 2009-04-17 20:42:56 |
| b6b-121.pdf Path: Texas El Paso >> CHEM >> 0608 Fall, 2009 Description: College of Science Bell Hall 100 747-5536 The University of Texas at El Paso El Paso, Texas 79968-0509 Updates: Bachelor of Science Degree Plan Chemistry - Psychology Minor (128/45) Name Major: Chemistry Department Chair: Dr. Jorge Gardea-Torresde... Date Added: 2009-04-17 20:44:06 |
| vytiniotis-2006.pdf Path: Cal Poly >> CSC >> 530 Fall, 2009 Description: Boxy Types: Inference for Higher-Rank Types and Impredicativity Dimitrios Vytiniotis Stephanie Weirich Simon Peyton Jones Microsoft Research simonpj@microsoft.com University of Pennsylvania {dimitriv,sweirich}@cis.upenn.edu Abstract Languages with r... Date Added: 2009-04-17 20:46:15 |
| info_architecture.pdf Path: Cal Poly >> ENGL >> 518 Fall, 2009 Description: cover BY MIR G. HAYNES, Carolina Chapter s we await the beginnings of an economic recovery, its more important than ever to optimize rather than to innovate. Business is slower and budgets are smaller. Projects are more often about evolving a proce... Date Added: 2009-04-17 20:46:29 |
| day31.pdf Path: Cal Poly >> STAT >> 130 Fall, 2009 Description: Stat 130 - Day 31 Chapter 20: The House Edge: Expected Values The expected value of a random process that has numerical outcomes is found by multiplying each possible value by its probability and then summing over all possible values. The Law of La... Date Added: 2009-04-17 20:48:17 |
| day7.pdf Path: Cal Poly >> STAT >> 252 Fall, 2009 Description: STAT 252 - Day 7 Comparing Two Proportions (cont.) Example 1: Perceptions of Self-Attractiveness A survey conducted by the Gallup organization in 1999 asked American adults whether they are satisfied with their physical attractiveness or wish they co... Date Added: 2009-04-17 20:49:13 |
| paper.pdf Path: Cal Poly >> CLA >> 331 Fall, 2009 Description: Paper Guidelines The Motet Paper (Paper 1) Due: Wednesday, February 18 The first paper is a 2-3-page analysis of Guillame de Machauts isorhythmic motet Qui es promesses / Ha! Fortune Et non est qui adjuvat. You should examine the work from as many ... Date Added: 2009-04-17 20:49:50 |
| lecture4Geodatabases.ppt Path: Midwestern State University >> SOILS >> 468 Fall, 2009 Description: GIS Lecture 4 Geodatabases GIS 1 Outline Administrative Data Example Data Tables Data Joins Common Datasets Spatial Joins ArcCatalog Geodatabases Editing Tables Excel Tips GIS 2 Administrative Data Example GIS 3 Administrative Data Mission Wha... Date Added: 2009-04-17 20:53:12 |
| infilt.doc Path: Midwestern State University >> CSS >> 413 Fall, 2009 Description: Infiltration and Redistribution of Water in a Soil Column The rate at which water can infiltrate soil determines whether rain or irrigation will enter the soil or will run off. Vertical infiltration into a dry soil starts at a high rate, but decrease... Date Added: 2009-04-17 20:53:17 |
| PerchloricHood.doc Path: Midwestern State University >> GJOHNSO >> 2 Fall, 2009 Description: Chemistry Department Standard Operating Procedure Title: Perchloric Acid Use Date: Principal Investigator: Room & Building: Phone Number: Section 1: (Check One) Process Process Hazardous chemical Hazard class February 3, 2004 Fulmer Hall x x Oxidi... Date Added: 2009-04-17 20:53:36 |
| abstract_krakatau_approved.doc Path: Midwestern State University >> EE >> 415 Fall, 2009 Description: Title: \"Design of 6 kW Power Control System for Fuel Cell\" Sponsor: ClearEdge Power Inc. URL of Sponsor: www.clearedgepower.com Team Name: Krakatau Abstract: The objective of this student project is to design a 6 kW power control system for the use o... Date Added: 2009-04-17 20:53:53 |
| EX2Review198.pdf Path: Midwestern State University >> PSYCH >> 198 Fall, 2009 Description: Psychology 198: Exam 2 Review Sheet Exam will cover information presented in the textbook, assigned readings, lecture, films and handouts Sensation & Perception (Ch. 4) Thresholds (absolute threshold) Just noticeable difference (JND) Perception witho... Date Added: 2009-04-17 20:54:26 |
| topic3.pdf Path: Midwestern State University >> BIOL >> 251 Fall, 2009 Description: Biology 251 Fall 2007 TOPIC 3: THE CELL MEMBRANE I. Importance and Objectives A. We have an entire topic on cell membranes because membrane structure and function are critical to the way that electrical impulses are conducted. What you learn in thi... Date Added: 2009-04-17 20:54:36 |
| presGradingSheet.doc Path: Midwestern State University >> CS >> 420 Fall, 2009 Description: CS420 FINAL PRESENTATION GRADING SHEET/FINAL EXAM (20 % of Grade) Criteria Student\'s Contribution to the Project Q1. Do you feel you\'ve contributed to at least 1/4 of the work? Q2. What percentage would you say you\'ve done? Q3. Do your team members a... Date Added: 2009-04-17 20:55:17 |
| hahn.txt Path: Midwestern State University >> CS >> 330 Fall, 2009 Description: 24.41E0 .591E0 34.82E0 1.547E0 44.09E0 2.902E0 45.07E0 2.894E0 54.98E0 4.703E0 65.51E0 6.307E0 70.53E0 7.03E0 75.70E0 7.898E0 89.57E0 9.470E0 91.14E0 9.484E0 96.40E0 10.072E0 97.19E0 10.163E0 114.26E0 11.615E0 120.25E0 12.005E0 127.08E0 12.478E0 133.... Date Added: 2009-04-17 20:56:43 |
| 200606.pdf Path: Midwestern State University >> TAKE >> 5 Fall, 2009 Description: Volume 11, Number 7 Section Break (Continuous) Section Break (Continuous) June 2006 IN THE MEDIA Restaurants\' Roles in Preventing Obesity Since Americans get a third of their calories when eating away from home, restaurants can play key roles in pr... Date Added: 2009-04-17 20:57:25 |
| math202syllabus.pdf Path: Midwestern State University >> MATH >> 202 Fall, 2009 Description: ... Date Added: 2009-04-17 20:58:06 |
| ULS_SetupCost.dat.txt Path: Midwestern State University >> FILESMATH >> 567 Fall, 2009 Description: 438 380 336 594 540 645 757 736 602 987 508 662 897 918 934 842 644 777 868 713 ... Date Added: 2009-04-17 20:58:30 |
| a8_sp05.pdf Path: Midwestern State University >> ASTR >> 138 Fall, 2009 Description: Astr 138 Assignment #8 - due Fri Apr 15, 2005 Wiens Law and the temperatures of planets We discussed the blackbody radiation laws in class, using proportional relationships. Wiens Law relates the wavelength of the brightest emission, peak , to the ob... Date Added: 2009-04-17 21:00:27 |
| assgt09.pdf Path: Midwestern State University >> MATH >> 503 Fall, 2009 Description: Math 503 Assignment 9 due Friday, November 7 1. Show that if p is a polynomial of degree n with zeros c1 , c2 , . . . , cn , not necessarily distinct, then p (z) = p(z) n k=1 1 . z - ck Use this result to get a second proof (valid only for poly... Date Added: 2009-04-17 21:01:10 |
| Lecture_1.pdf Path: Midwestern State University >> SOC >> 3203 Fall, 2009 Description: 1 Research Methods 1. Introduction 2. Social sciences 3. Social research 2 Instructor Name: Arina Gertseva Office: Wilson-Short, room # 214 Office Hours: M & W 9:00 -11:00 a.m. or by appointment E-mail: garina@wsu.edu 3 Course Website http:/cool... Date Added: 2009-04-17 21:02:01 |
| ivy.pdf Path: Cornell >> PROJ >> 00 Fall, 2009 Description: Putting IPM to Work in Schools and Institutions February 13, 2001 - Plattsburgh, NY The Need There is increasing awareness of and interest in reducing pesticide use in schools, institutions and public places. Most of the schools in the Clinton, Esse... Date Added: 2009-04-17 21:02:57 |
| l13079.pdf Path: Midwestern State University >> MATH >> 273 Fall, 2009 Description: SURFACES INTEGRALS, STOKES\' and DIVERGENCE THEOREMS Surface Integrals, given parametric surface S defined by r(u, v) =< x(u, v), y(u, v), z(u, v) > for (u, v) D. given f (x, y, z) = f (r(u, v) defined for (u, v) D, f (x, y, z) dS = S D f (r(u, v)... Date Added: 2009-04-17 21:04:30 |
| sohn.pdf Path: Midwestern State University >> ANNUALCONF >> 07 Fall, 2009 Description: Washington Economic Outlook Prepared for: School of Economic Sciences 2007 Annual Conference December 6, 2007 ChangMook Sohn, Ph.D Executive Director, Economic and Revenue Forecast Council Key Washington Economic Variables November 2007 2004 Nonf... Date Added: 2009-04-17 21:05:03 |
| schedule.doc Path: Wisc Whitewater >> MATH >> 141 Fall, 2008 Description: Algebra 141 - Summer, 2008 Tentative Assignment & Quiz Schedule for Intermediate Algebra, Sullivan /Struve Class discussion of each section will generally be started the class period before it is due. (Occasional extensions on due dates will be dealt... Date Added: 2009-04-17 21:06:18 |
| Stand2.pdf Path: Wisc Whitewater >> STAND >> 2 Fall, 2009 Description: Standard 2: Assessment System and Unit Evaluation The unit has an assessment system that collects and analyzes data on the applicant qualifications, the candidate and graduate performance, and unit operations to evaluate and improve the unit and its ... Date Added: 2009-04-17 21:07:43 |
| cmake.pdf Path: Cornell >> JMH >> 263 Fall, 2009 Description: MarlinTPC and CMake Jim Hunt Cornell University September 6, 2007 Jim Hunt (Cornell University) MarlinTPC and CMake September 6, 2007 1 / 24 What is CMake? CMake is a program that generates Makefiles. Instead of > tar -zxf program.tar.gz > mkdi... Date Added: 2009-04-17 21:09:01 |
| BE-ITBE.pdf Path: Wisc Whitewater >> SOC >> 2091 Fall, 2009 Description: Class# Section (Units) General Education Designation (if any) Consent Start/End Dates Meeting Days Meeting Times Location Instructor Course Topic (if applicable) THE FOLLOWING REQUIREMENTS APPLY TO STUDENTS ENROLLED IN THE BBA CURRICULUM: Stu... Date Added: 2009-04-17 21:09:04 |
| inherit9.txt Path: Cornell >> CS >> 100 Fall, 2008 Description: / INHERIT9: more about method calls. What\'s the rule? / Each method \"sends\" information back to the object that called the / method. Even when calling methods from a superclass, the subclass / will treat any methods or instance variables inside the /... Date Added: 2009-04-17 21:09:26 |
| t2.pdf Path: UNL >> MATH >> 04 Fall, 2009 Description: Math 107-Sec 510, Summer \'04 Exam 2 Score: Name: TA\'s Name: Instructions: You must show supporting work to receive full and partial credits. No text book, notes, formula sheets allowed. 1(20pts) Evaluate the integrals by the method of integration ... Date Added: 2009-04-17 21:10:36 |
| t2.pdf Path: UNL >> MATH >> 107 Spring, 2008 Description: Math 107-Sec 510, Summer \'04 Exam 2 Score: Name: TA\'s Name: Instructions: You must show supporting work to receive full and partial credits. No text book, notes, formula sheets allowed. 1(20pts) Evaluate the integrals by the method of integration ... Date Added: 2009-04-17 21:10:36 |
| 1994.pdf Path: UNL >> A >> 7 Fall, 2009 Description: The 55th William Lowell Putnam Mathematical Competition Saturday, December 3, 1994 A1 Suppose that a sequence a1 , a2 , a3 , . . . satisfies 0 < an a2n + a2n+1 for all n 1. Prove that the se ries n=1 an diverges. A2 Let A be the area of the region... Date Added: 2009-04-17 21:12:42 |
| smashstack.txt Path: UNL >> CSCE >> 351 Fall, 2008 Description: .oO Phrack 49 Oo. Volume Seven, Issue Forty-Nine File 14 of 16 BugTraq, r00t, and Underground.O... Date Added: 2009-04-17 21:15:23 |
| cls04--circle1.pdf Path: UNL >> MBRITTENHA >> 2 Fall, 2009 Description: 1 (S 1 ) Z : A proof in two parts = Show Z surjects onto 1 (S 1 ), and show that the surjection is injective. U = {(x, y) S 1 : y < }, U+ = {(x, y) S 1 : y > } open cover of S 1 R2 = C j : (I, I) (S 1 , 1) , 1/n a Lebesgue number for 1 (U ), ... Date Added: 2009-04-17 21:15:56 |
| hw4-solutions.pdf Path: UNL >> AST >> 204 Fall, 2009 Description: Astronomy 204: Homework #4 - Solutions 1. Astronomers talk of declination zones when describing what stars can be seen from each latitude on the earth. They typically identify three zones: Circumpolar stars that are always visible from a particular... Date Added: 2009-04-17 21:16:07 |
| ATOM.pdf Path: UNL >> DWB >> 4 Fall, 2009 Description: A SourceBook Module Version 1.0 1993 Funded in part under National Science Foundation Grant No. TPE 88-50632 ChemSource Project Principal Investigator: Mary Virginia Orna, OSU Department of Chemistry College of New Rochelle New Rochelle, NY 10805 Pho... Date Added: 2009-04-17 21:16:48 |
| msrintro.ppt Path: UNL >> PSYCH >> 971 Fall, 2009 Description: Introduction to Psychological Measurement Psychometrics & some vocabulary Kinds of scale construction Desirable properties of a psychometric instrument Psychometric sampling Kinds of items Scaling models Psychometrics (Psychological measuremen... Date Added: 2009-04-17 21:17:28 |
| Moeller.pdf Path: UNL >> DWB >> 4 Fall, 2009 Description: 1 Reading Recovery: A Scientifically Based Analysis Aleidine J. Moeller, Director Teachers College Institute University of Nebraska-Lincoln July 2002 Introduction Reading Recovery (RR) was designed by Marie Clay in 1979 for the purpose of intervenin... Date Added: 2009-04-17 21:18:28 |
| lesson6_handouts2.pdf Path: UNL >> MODULE >> 882 Fall, 2009 Description: ... Date Added: 2009-04-17 21:20:49 |
| effect.pdf Path: UNL >> MODULE >> 882 Fall, 2009 Description: ... Date Added: 2009-04-17 21:20:51 |
| effect.pdf Path: UNL >> MODULE >> 2 Fall, 2009 Description: ... Date Added: 2009-04-17 21:20:51 |
| exam2.pdf Path: UNL >> MATH >> 107 Spring, 2008 Description: Math107 Calculus II Spring 2008 University of Nebraska-Lincoln Name: Section #: (print legibly) Exam 2 Instructions Turn o all communication devices. If you do not do so, then you will not receive any credit for your exam. There are 7 pages in... Date Added: 2009-04-17 21:22:18 |
| ec2507.pdf Path: UNL >> EC >> 2507 Fall, 2009 Description: EXTENSION Know how. Know now. EC2507 S A F E Transport, Storage and Disposal of Pesticides Clyde L. Ogg, Extension Educator Larry D. Schulze, Extension Pesticide Education Specialist Shripat T. Kamble, Extension Household Structural Specialist Ex... Date Added: 2009-04-17 21:24:49 |
| page5.pdf Path: UNL >> MAR >> 01 Fall, 2009 Description: March 2001 The NEBLINE Page 5 Advertising a Pick-Your-Own Farm or Farm Stand Just as farmers need to condition the soil to grow crops, they also need advertising to condition customers to buy their crops. Advertising is a tool, one which you can ... Date Added: 2009-04-17 21:24:58 |
| exam2B.pdf Path: UNL >> MATH >> 101 Fall, 2008 Description: College Algebra 101 Exam II: March 4, 2008 Name: (B) Question: Points: Score: 1 20 2 12 3 12 4 8 5 9 6 9 7 14 8 8 9 8 Total 100 The maintenance of academic honesty and integrity is a vital concern of the University community. Any student... Date Added: 2009-04-17 21:26:32 |
| ledbetter.pdf Path: UNL >> LAW >> 2 Fall, 2009 Description: LEDBETTER v. GOODYEAR TIRE & RUBBER CO., INC. 127 S. Ct. 2162 (2007) Justice ALITO delivered the opinion of the Court. This case calls upon us to apply established precedent in a slightly different context. We have previously held that the time for f... Date Added: 2009-04-17 21:26:47 |
| final.pdf Path: Cornell >> MATH >> 122 Fall, 2008 Description: Mathematics 122 Final Exam December 6, 2007 No books, notes, or calculators may be used. SHOW ALL OF YOUR WORK. There is a table of formulas on the back. 1 (15 points). Let C be one arch of the cycloid x = t - sin t y = 1 - cos t (a) Find the area... Date Added: 2009-04-17 21:27:26 |
| WRAPUPSUMMARY.pdf Path: Cornell >> INGNW >> 01 Fall, 2009 Description: Charles Tu, 11/4/01 Summary of the Wrap-up Session of InGNW 01 on October 11, 2001 A few topics were not discussed, namely solar cells, transport properties, minority carrier lifetime, incorporation of Bi or B. Possible new materials to look into... Date Added: 2009-04-17 21:27:46 |
| lecture05.pdf Path: Cornell >> CS >> 612 Fall, 2009 Description: \' $ ILP Formulation of Loop Transformations 2 % \' $ Two problems: Given a system of linear... Date Added: 2009-04-17 21:29:39 |
| Mossbauer00.ppt Path: UNL >> PHYS >> 462 Fall, 2008 Description: Resonance fluorescence absorption (& re-emission) of s emitted by nuclei of the same type Radiation from a sample of excited atoms illuminates a collection of identical (ground state) atoms which can absorb them to become excited themselves. When a... Date Added: 2009-04-17 21:33:08 |
| Mossbauer00.ppt - Part 2 Path: UNL >> PHYS >> 462 Fall, 2008 Description: rd paths gives a predicted difference 2(3.5 10 eV ) E E -15 = 4.9 10 - = 14.4keV E down E up -11 The meas... Date Added: 2009-04-17 21:33:08 |
| MoreProjects.doc Path: TCNJ >> CMSC >> 410 Fall, 2009 Description: ADDITIONAL PROJECTS : a. Provide an implementation for digraphs and with it, implementation of depth-first and breadth-first search algorithms. Provide an implementation for digraphs and with it, an implementation of the topological sort algorithm. P... Date Added: 2009-04-17 21:34:38 |
| proof_of_quadratic_formula.doc Path: TCNJ >> CANIK >> 2 Fall, 2009 Description: Algebra III Day _ Name: Date: The Quadratic Formula Given the standard form ax 2 + bx + c = 0 for a quadratic equation, prove x = ax 2 + bx + c = -c -c - b b 2 - 4ac . 2a 0 Standard form -c -c -c+ 1 b - c + a 2 a b - c + a 2a b - c ... Date Added: 2009-04-17 21:34:53 |
| L03.pdf Path: Kent State >> OSF >> 99 Fall, 2009 Description: Input / Output (I/O) n Input / Output (I/O) (cont.) Terminology q CPU Di sk Cont ro ller Pr in t er Cont r oller Tape Drive Co nt ro ller Memory Cont r oller Synchronous I/O CPU execution waits while I/O proceeds Asynchronous I/O I/O proceed... Date Added: 2009-04-17 21:40:15 |
| PS1sum2001.doc Path: Kent State >> ECON >> 22061 Fall, 2008 Description: Principles of Macroeconomics Problem Set 1 Chapter 4 1. Economic growth refers to a. b. c. d. 2. a short run increase in real GDP. fluctuations in real GDP. a long run increase in nominal GDP. a long run upward trend in real GDP. The trend growth ra... Date Added: 2009-04-17 21:42:43 |
| hw5s06sol.pdf Path: Kent State >> CH >> 06 Fall, 2009 Description: Classical Electrodynamics 8 points, Due: February 8, 2006 Printed: December 28, 2006 1. Problem 1, chapter 2 of Jackson. A point charge q is located at z = d above a grounded conducting plane coincident with the x-y plane. a Find the surface charge d... Date Added: 2009-04-17 21:43:43 |
| hw5s06sol.pdf Path: Kent State >> CH >> 2 Fall, 2009 Description: Classical Electrodynamics 8 points, Due: February 8, 2006 Printed: December 28, 2006 1. Problem 1, chapter 2 of Jackson. A point charge q is located at z = d above a grounded conducting plane coincident with the x-y plane. a Find the surface charge d... Date Added: 2009-04-17 21:43:43 |
| lecture1-r1.pdf Path: Kent State >> LECTURE >> 1 Fall, 2009 Description: 1 Basic Concepts and Tools Scientic computing relies on tools from many branches of mathematics, engineering, and computer science. Linear algebra, in particular, stands out as the central idea underlying almost all problems in scientic computing. ... Date Added: 2009-04-17 21:44:15 |
| Chpt6.ppt Path: Kent State >> CS >> 10051 Fall, 2008 Description: CHAPTER 6 INTRODUCTION TO SYSTEM SOFTWARE AND VIRTUAL MACHINES VIRTUAL MACHINES The machine we \"built\" is not the machine you \"see\" when you sit and start typing on the keyboard. The hardware at the lowest level consists of: binary representations: ... Date Added: 2009-04-17 21:45:21 |
| corrected.cqww.cw.2007_Mul.Txt Path: Kent State >> CQWWCW >> 2007 Fall, 2009 Description: Sheet1 160M 3DA 3V 3X 4J 4L 4U1I 4X 5B 5H 6W 6Y 8P 9A 9G 9H 9K 9M2 9M6 9V 9Y A3 A4 A7 C3 C6 CE CM CN CP CT CT3 CU CX D2 D4 DL EA EA6 EA8 EA9 EI ER ES EU EY F FG FJ FM FO 1 1 80M 1 1 1 3 3 1 1 3 2 1 2 9 1 1 1 1 1 1 3 40M 1 1 20M 1 1 1 15M 2 5 6 10M To... Date Added: 2009-04-17 21:45:47 |
| S05_CS303_chap5.pdf Path: Kent State >> CS >> 303 Fall, 2009 Description: Decrease and Conquer Decrease and Conquer Exploring the relationship between a solution to a given instance of (e.g., P(n) )a problem and a solution to a smaller instance (e.g., P(n/2) or P(n-1) )of the same problem. Use top down(recursive) or botto... Date Added: 2009-04-17 21:47:02 |
| rtas04.pdf Path: Washington University in St. Louis >> RTAS >> 04 Fall, 2009 Description: Glue Code Generation: Closing the Loophole in Model-based Development Dionisio de Niz and Raj Rajkumar dionisio@cs.cmu.edu, raj@ece.cmu.edu Abstract Embedded real-time systems are tightly coupled with the physical world. This tight coupling imposes ... Date Added: 2009-04-17 21:48:52 |
| verify-drm.pdf Path: Washington University in St. Louis >> RTAS >> 04 Fall, 2009 Description: Toward Model-Based Verication of Adaptive Allocation Managers William Leal, Frank Drews, Chang Liu, Lonnie Welch Ohio University { leal@cs.ohiou.edu, drews@ohiou.edu, changliu@cs.ohiou.edu, welch@ohio.edu } 1 Introduction Embedded computer systems... Date Added: 2009-04-17 21:49:01 |
| jan8.txt Path: Washington University in St. Louis >> CS >> 514 Fall, 2009 Description: January 8, 2002 - Before we begin - Who should be here? - MS SNCD students who have taken 504 or received permission for 514 due to preexisting Java/C+ experience - Students from other disciplines with Java/C+ computing experience (such as 50... Date Added: 2009-04-17 21:50:00 |
| quiz2.doc Path: Washington University in St. Louis >> CS >> 514 Fall, 2009 Description: CS514 Fundamentals of Computer Science, Fall 2000 Quiz 2: September 27, 2000 You have 20 minutes to complete this quiz. You may not use any books or notes. You must show your work to receive any credit, even if your answer is correct. You may leave ... Date Added: 2009-04-17 21:50:11 |
| hw1.pdf Path: Washington University in St. Louis >> CS >> 514 Fall, 2009 Description: CS514 Fundamentals of Computer Science, Fall 2001 Homework Assignment 1 Assigned: August 28 Due: September 5 Administrivia: All homework assignments are due at the start of class on the due date. After that, they will not be accepted for credit. Hom... Date Added: 2009-04-17 21:50:26 |
| lecture01_intro.ppt Path: Washington University in St. Louis >> CS >> 559 Fall, 2009 Description: C pute Vision, C E 559 om r S : rt ss Me Robe Ple Officehours, TBD ss\" Also \"profple YahooI M, AI M. bsite du/~ple ss/559 We : http:/www.cs.wustl.e xtbook. Assigne re d adings and outsideinform ation will beon No te thewe . bsite Computer Visi... Date Added: 2009-04-17 21:51:10 |
| faq.txt Path: Washington University in St. Louis >> CSE >> 4 Spring, 2009 Description: HOMEWORK 4 FAQ Last Revision: 1000 AM, Apr 13, 2004 ERRATA - Problem 5: \"not counting the header\" should read \"not counting the link-layer header\". Problem 8: The point value for this problem should be 8 instead of 6. \"EI\" stands for Ethern... Date Added: 2009-04-17 21:52:10 |
| faq.txt Path: Washington University in St. Louis >> CSE >> 573 Fall, 2009 Description: HOMEWORK 4 FAQ Last Revision: 1000 AM, Apr 13, 2004 ERRATA - Problem 5: \"not counting the header\" should read \"not counting the link-layer header\". Problem 8: The point value for this problem should be 8 instead of 6. \"EI\" stands for Ethern... Date Added: 2009-04-17 21:52:10 |
| questions.txt Path: Washington University in St. Louis >> CSE >> 332 Fall, 2009 Description: Laboratory Assignment 2 Questions Preliminaries steps: A) make sure you have successfully compiled the lab, the executable is named main. > main B) Open the pointers.cc file in an editor of your choice. C) Start the ddd debugg... Date Added: 2009-04-17 21:53:19 |
| bool.doc Path: Washington University in St. Louis >> CSE >> 361 Fall, 2009 Description: CSE361: Introduction to Systems Software Boolean/Binary Notes Boolean Algebra: Operator ~ | 0 1 0 0 0 1 0 1 And Operator ^ 0 1 0 0 1 1 1 0 Xor Operator ~ 0 1 1 0 Not Operator Example ~a a | b a & b a ^ b Descriptio... Date Added: 2009-04-17 21:53:28 |
| a_l06b01.pdf Path: Washington University in St. Louis >> LPSC >> 37 Fall, 2009 Description: DATABASE OF RAMAN MINERAL SPECTRA FOR PLANETARY SURFACE EXPLORATION. K. Kuebler, A. Wang, J.J. Freeman, and B. L. Jolliff, Dept. of Earth the McDonnell Center for Space Sciences, Washington University, One Brookings Drive, St. ... Date Added: 2009-04-17 21:54:49 |
| Presentation.ppt Path: Washington University in St. Louis >> BME >> 401 Fall, 2009 Description: Advanced Geo-Tracker System for Wheelchairs Stephen Benz, Glenn Flora, Christine Dao Mentor: Dr. David Gray Group 16 Accessibility Americans with Disabilities Act (1990) \"prohibits discrimination on the basis of disability in employment, State and... Date Added: 2009-04-17 21:55:31 |
| Presentation.ppt Path: Washington University in St. Louis >> BME >> 16 Fall, 2009 Description: Advanced Geo-Tracker System for Wheelchairs Stephen Benz, Glenn Flora, Christine Dao Mentor: Dr. David Gray Group 16 Accessibility Americans with Disabilities Act (1990) \"prohibits discrimination on the basis of disability in employment, State and... Date Added: 2009-04-17 21:55:31 |
| Presentation.ppt Path: Washington University in St. Louis >> BME >> 2005 Fall, 2009 Description: Advanced Geo-Tracker System for Wheelchairs Stephen Benz, Glenn Flora, Christine Dao Mentor: Dr. David Gray Group 16 Accessibility Americans with Disabilities Act (1990) \"prohibits discrimination on the basis of disability in employment, State and... Date Added: 2009-04-17 21:55:31 |
| Helling_additional_excerpt.pdf Path: Washington University in St. Louis >> PRISONS >> 2006 Fall, 2009 Description: Constitutional Law of Incarceration Wash. U. in St. Louis, Spring 2006 Professor Margo Schlanger Additional excerpt Helling v. McKinney, 509 U.S. 25 (1993) (Casebook p. 801-802) Thomas, J., dissenting: The Eighth Amendment provides that \"[e]xcessive ... Date Added: 2009-04-17 21:57:26 |
| 20010510112918_ips_proc.txt Path: Washington University in St. Louis >> MAY >> 01 Fall, 2009 Description: 1.3285 62.2830 2142.8931 972.6757 2142.8931 972.6757 1595.4315 375.9238 0.2356 0.0041 1.3295 62.0580 2154.1809 975.9349 2154.1809 975.9349 1606.7194 ... Date Added: 2009-04-17 21:59:19 |
| hw7_sol.txt Path: Washington University in St. Louis >> CSE >> 240 Fall, 2009 Description: 1.i. (x + 1)(x + 3) = x^2 + 4x + 3 The characteristic polynomial is x^2 - (-4)x - (-3). Since we have (x + 1)(x + 3) = x^2 + 4x + 3, the roots are -1 and -3. By the theorem we saw in class, all solutions are then functions described by a(n) = alph... Date Added: 2009-04-17 22:00:38 |
| MinerMCB07Lecture2.pdf Path: Washington University in St. Louis >> BIO >> 5068 Fall, 2008 Description: Cell-Matrix Interactions Dr. Jeff Miner 7717 Wohl Clinic 362-8235 minerj@wustl.edu Suggested Reading *Overview: Lodish, Molecular Cell Biology (2008), Chapter 19, pp 801-841. Lecture 1: The Extracellular Matrix *Review: A Aszodi, KR Legate, I Nakch... Date Added: 2009-04-17 22:02:03 |
| MinerMCB07Lecture2.pdf - Part 2 Path: Washington University in St. Louis >> BIO >> 5068 Fall, 2008 Description: Integrins Dystroglycan Ig-superfamily transmembrane receptor (Lutheran) Syndecans--transmembrane receptors with HSPG sid... Date Added: 2009-04-17 22:02:03 |
| MinerMCB07Lecture2.pdf - Part 3 Path: Washington University in St. Louis >> BIO >> 5068 Fall, 2008 Description: eins Regulate Mammary Cell Gene Expression: Got ECM? Streuli et al, J. Cell Biol. 1991 21 What is the Mechanism? (Wh... Date Added: 2009-04-17 22:02:03 |
| hoti05.pdf Path: Washington University in St. Louis >> MEA >> 1 Fall, 2009 Description: SIFT: Snort Intrusion Filter for TCP, by Michael Attig and John W. Lockwood, IEEE Symposium on High Performance Interconnects (Hot Interconnects-13), August 17-19, 2005, Stanford, CA. SIFT: Snort Intrusion Filter for TCP Michael Attig and John Lock... Date Added: 2009-04-17 22:02:32 |
| file.pdf Path: Washington University in St. Louis >> CS >> 422 Fall, 2009 Description: The Unix File System File Systems (CSE 422S) usr vmunix Powerful, elegant file system from a small number of mechanisms mnt mount points bin tmp dev Washington University kenw@wustl.edu www.arl.wustl.edu/~kenw Ken Wong . arl sd0g tty0 sd0a . ... Date Added: 2009-04-17 22:02:44 |
| lecture1.pdf Path: Washington University in St. Louis >> CSE >> 502 Fall, 2009 Description: Computer Science is no more about computers than astronomy is about telescopes. Edsger W. Dijkstra CSE 502N Fundamentals of Computer Science Fall 2004 Lecture 1: Introduction Closest-pair problem Course Overview We will focus on three core classes ... Date Added: 2009-04-17 22:03:22 |
| r-eg-20.txt Path: Washington University in St. Louis >> MA >> 322 Fall, 2009 Description: Example R programs and commands 20. Chi-squared tests for independence in contingency tables # All lines preceded by the \"#\" character are my comments. # All other left-justified lines are my input. # All other indented lines are the R pr... Date Added: 2009-04-17 22:03:55 |
| monte_carlo_method.ppt Path: Washington University in St. Louis >> BME >> 540 Fall, 2009 Description: The Monte Carlo method Nathan Baker (baker@biochem.wustl.edu) BME 540 What is Monte Carlo? A method to evaluate integrals Popular in all areas of science, economics, sociology, etc. Involves: Random sampling of domain Evaluation of function Ac... Date Added: 2009-04-17 22:04:07 |
| 70_FR_746.pdf Path: Washington University in St. Louis >> PROBLEM >> 3 Fall, 2009 Description: Page 1 LEXSEE 70 FR 746 FEDERAL REGISTER Vol. 70, No. 003 Proposed Rules DEPARTMENT OF THE TREASURY Internal Revenue Service (IRS) 26 CFR Part 1 [REG-117969-00] RIN 1545-BD76 Statutory Mergers and Consolidations 70 FR 746 DATE: Wednesday, January 5,... Date Added: 2009-04-17 22:05:34 |
| me265ch3.pdf Path: Washington University in St. Louis >> ME >> 265 Fall, 2009 Description: 26 Chapter 3 Data Input/Output 3.1 Input Entering a scalar: Example 3.1 InputData = input(\'Enter a number:\') Entering a string: Example 3.2 s1 = input(\'Enter a string with single quote:\') s2 = input(\'Enter a string without single quote:\',\'s\') \'s\': ... Date Added: 2009-04-17 22:05:51 |
| ie466.fmea.dqs.pdf Path: Penn State >> IE >> 466 Fall, 2009 Description: THE PENNSYLVANIA STATE UNIVERSITY Department of Industrial EFFECTS ANALYSIS Read the FMEA handout distributed in class and be prepared to discuss the following questions. FMEA D... Date Added: 2009-04-17 22:06:22 |
| lecture20.ppt Path: Penn State >> STAT >> 100 Fall, 2008 Description: Statistic for the day: The average number of new words added to English per year: 350 Source: OED Assignment: Read Chapter 16 Exercises pp. 291-294: 2, 4, 6, 13, 18 These slides were created by Tom Hettmansperger and in some cases modified by David H... Date Added: 2009-04-17 22:07:08 |
| Hwk4.doc Path: Penn State >> STAT >> 511 Fall, 2008 Description: Statistics 511 Homework 4 Due: Friday Oct. 13, 2 p.m. Fall 2006 1 1. Employees of a large company took a special training program to improve production output. The output of each employee was measured before the program (X) and after the program... Date Added: 2009-04-17 22:10:07 |
| Activity_13.doc Path: Penn State >> STAT >> 200 Fall, 2008 Description: ACTIVITY 13 Activity 13.1 Use Table A.3 to estimate the p-value for each of the following hypothesis testing situations. Then use the p-value to make a conclusion about the hypotheses. (Note: The value given for t is the calculated value of the test ... Date Added: 2009-04-17 22:12:39 |
| Activity_13.doc Path: Penn State >> STAT >> 13 Fall, 2009 Description: ACTIVITY 13 Activity 13.1 Use Table A.3 to estimate the p-value for each of the following hypothesis testing situations. Then use the p-value to make a conclusion about the hypotheses. (Note: The value given for t is the calculated value of the test ... Date Added: 2009-04-17 22:12:39 |
| tut1gregoryl3.pdf Path: Penn State >> SAMSI >> 06 Fall, 2009 Description: SAMSI Astrostatistics Tutorial More Markov chain Monte Carlo & Demo of Mathematica software Phil Gregory University of British Columbia 2006 Bayesian Logical Data Analysis for the Physical Sciences 1. Role of probability theory in science 2. Probabi... Date Added: 2009-04-17 22:23:08 |
| TiffanyMemo.pdf Path: Penn State >> DAH >> 1000 Fall, 2009 Description: TO: FROM: DATE: SUBJECT: Kristian, Matt, Dave, and Heather Tiffany Collier, Team 1 Member January 25, 2006 Introducing Myself to the Team Let me first introduce myself as an Information Systems Major here at Pennsylvania State University. I am curr... Date Added: 2009-04-17 22:25:17 |
| resume.pdf Path: Penn State >> RJS >> 5194 Fall, 2009 Description: Ryan JAMES Shaughnessy (302)-545-0114 rjs5194@psu.edu 321 East Fairmount State College, PA 16801 OBJECTIVE 826 Waverly Road Kennett Square, PA 19348 f To obtain an internship with a well-established corporation to gain real world experience and a bet... Date Added: 2009-04-17 22:26:24 |
| WAN.ppt Path: Penn State >> RXE >> 7 Fall, 2009 Description: Wide Area Networks Networking BASICS 1 Wide Area Network It connects computers and LANs over a larger geographical area. It crosses public thorough-fares such as roads, railroads, and water. Networking BASICS 2 WAN vs. LAN Geography Ownership Ma... Date Added: 2009-04-17 22:26:59 |
| CapstoneProjectProposal.doc Path: Penn State >> RWS >> 213 Winter, 2009 Description: Capstone project proposal: I am going to use the data from the National Oceanographic and Atmospheric Administration\'s Office of Response and Restoration. The specific data set is a Environmental Sensitivity Index data for the Central California coas... Date Added: 2009-04-17 22:27:28 |
| political_change.ppt Path: Penn State >> FRB >> 1 Fall, 2009 Description: Political Change in a Globalizing World The Transformation of the national political space in six Western European Countries Box 1: Political space in Britain Theoretical fundament: The project starts from the assumption that the current process of g... Date Added: 2009-04-17 22:31:16 |
| obstaclethree.pdf Path: Penn State >> MMO >> 5000 Fall, 2009 Description: Ozimok 1 Megan Ozimok Dr. Julie Kearney English 15 19 October 2004 Dmft-tt: 3 Overcoming Obstacles Throughout a persons life, they are faced with different obstacles, and different challenges of all different types. My life in particular has been... Date Added: 2009-04-17 22:33:47 |
| audit20.txt Path: Penn State >> MMT >> 143 Fall, 2009 Description: Your Degree Audit is shown below. For readability, please set your E-mail Reader and Print fonts to COURIER or some other non-proportional font. Refer to <http:/www.psu.edu/registrar/degree_audit/guidelines.html> for additional information to assi... Date Added: 2009-04-17 22:33:56 |
| StaigerReview.pdf Path: Penn State >> MPM >> 15 Fall, 2009 Description: ... Date Added: 2009-04-17 22:34:21 |
| Request8.doc Path: Penn State >> MTM >> 5142 Fall, 2009 Description: Request For A New Application Date Submitted: November 28, 2007 Submitted by: Michelle Mack Purpose: To develop an application for the paint department to convert liters to pints and gallons. Application Title: Algorithms: Metric conversion Gallons= ... Date Added: 2009-04-17 22:34:37 |
| Melissa_Melnick_Project_5.ppt Path: Penn State >> MSM >> 5003 Spring, 2009 Description: OnlineDating MelissaMelnick CAS283Section3 Project5 Overview Benefits Easy Convenient Fun Disadvantages Falsification Distance FacetofaceIncompatibility ADVANTAGES Easyas123! Lotsofchoices Stepbystepinstruction Lackofintimidation Bro... Date Added: 2009-04-17 22:34:44 |
| JULIE.txt Path: Penn State >> MIS >> 120 Fall, 2009 Description: JULIE ALLSHOUSE... Date Added: 2009-04-17 22:42:05 |
| JULIE.txt Path: Penn State >> MIS >> 251 Fall, 2009 Description: JULIE ALLSHOUSE... Date Added: 2009-04-17 22:42:06 |
| 07-05-ind-events.pdf Path: Penn State >> DJH >> 300 Fall, 2009 Description: Independent Events Discrete Math - Section 7.5 I. Warm-Up Problem Scenario A: One card is chosen from a standard deck of 52 cards. Define events as follows: J: \"The card is a jack\" F: \"The card is a face card.\" Determine the following probabilitie... Date Added: 2009-04-17 22:42:47 |
| resume.pdf Path: Penn State >> BMB >> 235 Fall, 2009 Description: BrianMichaelBrophy 111WhistlingSwanLn Downingtown,PA19335 (484)8321018 brianbrophy@email.com Objective ToobtaingainfulemploymentasanEnterpriseArchitectintheinformationsystemsandtechnologyfield. Education PennStateUniversity IndianaUniversity Comple... Date Added: 2009-04-17 22:43:16 |
| M1_GUI.doc Path: Penn State >> BGK >> 111 Fall, 2009 Description: % % % % VVV Satellite Image Manipulator Code written by the Voracious Vorticity Vanguard The Pennsylvania State University Department of Meteorology METEO 473 Milestone 1 % CREDITS: % Some code courtesy of GUIfft % Created April 10, 2001 by Bill Mi... Date Added: 2009-04-17 22:45:08 |
| Kingfisher4.q.txt Path: Penn State >> SGP >> 97 Fall, 2009 Description: H M S Lat Lon Alt FltQ GroundQ 15.0000 30.0000 57.4141 35.9945 -97.8607 930.458 15.7452 16.9073 15.0000 30.0000 58.4141 ... Date Added: 2009-04-17 22:47:30 |
| handout10.pdf Path: Penn State >> STAT >> 250 Fall, 2008 Description: Assessing Normality If we assume that a random variable follows a normal distribution, when in fact it does not, our probability calculations can be very inaccurate. Therefore, before blindly calculating normal probabilities, we should always check t... Date Added: 2009-04-17 22:50:09 |
| normality.ppt Path: Penn State >> STAT >> 250 Fall, 2008 Description: Assessing Normality Are my data normally distributed? Evidence for Normality Mean and median should not be too different. Histogram or stem-and-leaf plot should look symmetric. Box plot should look symmetric. Normal probability plot should rough... Date Added: 2009-04-17 22:50:29 |
| DC.doc Path: Penn State >> HPA >> 332 Fall, 2009 Description: A PRODUCT OF THE PUBLIC SERVICE CURRICULUM EXCHANGE THE ELECTRONIC HALLWAYTM NETWORK ALL POLITICS ARE LOCAL: DISTRICT OF COLUMBIA GENERAL HOSPITAL This case is about a hospital and its institutional environment. More specifically, it is about the ... Date Added: 2009-04-17 22:51:33 |
| 318-11 Path: Texas >> CH >> 318N Spring, 2009 Description: CH 318 N Textbook Assignment: Chapter 16 Homework (for credit): POW 6 posted Todays Topics: Additions; LECTURE 11 Wittig and related reactions Notice & Announcements: Exam 1-Wednesday, 2/25 7-9 PM WEL 3.502 Organic Lecture Series Aldehydes And ... Date Added: 2009-04-20 02:49:01 |
| 318-20 Path: Texas >> CH >> 318N Spring, 2009 Description: CH 318 N LECTURE 20 Textbook Assignment: Chapter 21 (Begin) Homework (for credit): POW 10 posted Todays Topics: Conjugated Systems; Benzene and Aromaticity Notice & Announcements: Exam Papers: pick up @ Chem Office Organic Lecture Series Conjuga... Date Added: 2009-04-20 02:49:04 |
| 8.pdf Path: Penn State >> BMMB >> 597 Fall, 2009 Description: PROCHECK Main-chain bond angles 2_bindividual (except Gly,Pro) 70 60 70 60 Page 1 CA-C-N CA-C-N (Gly) 70 60 CA-C-N (Pro) Frequency Frequency 40 30 20 10 101 106 111 116 121 126 131 40 30 20 10 101 106 111 116 121 126 131 Frequency 50 50 ... Date Added: 2009-04-20 18:38:14 |
| BASO.pdf Path: Penn State >> EARTH >> 106 Fall, 2008 Description: Geology around Station BASO BASO Scale: 2km Tanzania Geology Schist Granites Gneiss Soil Basalts Granites ... Date Added: 2009-04-20 18:38:49 |
| CSE_126_Syllabus.pdf Path: Washington University in St. Louis >> CS >> 126 Fall, 2009 Description: CSE 126 Introduction to Computer Programming Instructor: Ezekiel Maier Email: zmaier@cse.wustl.edu Office: Jolley 526 Office Hours: MWF 10-11 AM or by appointment Lecture Time: MWF 9-10 AM Class Room: Lopata 101 Lab Hours: W 1-2:30, 2:30-4, 4-5:30 P... Date Added: 2009-04-20 18:41:50 |
| samplethesis.doc Path: Penn State >> AXA >> 24 Fall, 2009 Description: SAMPLE: SINGLE AREA OF HONORS THESIS TITLE PAGE (Annotated Copy) Check ALL Spelling (SCHREYER, peoples names, etc.) No page number can appear on this page THE PENNSYLVANIA STATE UNIVERSITY SCHREYER HONORS COLLEGE Official designation of department/s... Date Added: 2009-04-20 18:48:28 |
| Chelsey.doc Path: Penn State >> CAH >> 321 Fall, 2009 Description: Chelsey ... Date Added: 2009-04-20 18:51:28 |
| Lesson3.pdf Path: Penn State >> P >> 435 Fall, 2009 Description: E E E ILL NV Bald Eagle High School Central Intermediate Unit Bald Eagle School ST AT ER Wingate Elementary School Bald Eagle Area Head Start Schools Hospital E. M. S. Firemen Police GAST ARMA RD E GL EA RD H UT EY SO ALL V NI U ON BO GS G ... Date Added: 2009-04-20 18:53:03 |
| Aliquippa_final_Presentation.ppt Path: Penn State >> GEOG >> 420 Fall, 2009 Description: Expanding Horizons A li quippa Towards Regional Supply Based Microenterprise Development in the Aliquippa Area Sean Ayers Robert Martin Josh Lederman Elizabeth Yost Jeff Lasitter Chris Dorney Our Goals Provide you with projections on which indust... Date Added: 2009-04-20 18:54:33 |
| 5_1_4_Oxygen.pdf Path: Penn State >> GEOSC >> 5 Fall, 2009 Description: 5.1.4 -15.1.4. Oxygen Isotope Reference Samples Print this Section Save Zoom In the case of oxygen, the use of isotope reference samples can be confusing. This is due to the fact that a large number of different oxygen containing compounds have been... Date Added: 2009-04-20 18:55:09 |
| 5_1_4_Oxygen.pdf Path: Penn State >> GEOSC >> 518 Fall, 2008 Description: 5.1.4 -15.1.4. Oxygen Isotope Reference Samples Print this Section Save Zoom In the case of oxygen, the use of isotope reference samples can be confusing. This is due to the fact that a large number of different oxygen containing compounds have been... Date Added: 2009-04-20 18:55:09 |
| Dumke_et_al_NGS1_2_3_1989.pdf Path: Penn State >> GEOSC >> 518 Fall, 2008 Description: Anal. Chem. 1989, 6 1 , 2149-2154 (11) Klntanar, A.; Jellnskl, L. W.; Gancarz, I.; Kobersteln, J. T. Macromolecules 1988. 19, 1876. (12) Dyer, E.; Newborn, G. E. J . Am. Chem. Soc. 1958, 80, 5495. (13) Thorne, M. P. Can. J . Chem. 1967, 4 5 , 2537. (... Date Added: 2009-04-20 18:55:13 |
| 6_1_Definition_and_Examples.pdf Path: Penn State >> GEOSC >> 518 Fall, 2008 Description: 6.1 -1- 6.1 Definition and Some Examples of Isotope Effects Save Zoom Print this Section Differences in physical and chemical properties of substances arising from the presence of different isotopes in their constituent molecules or atoms are cal... Date Added: 2009-04-20 18:56:01 |
| 6_1_Definition_and_Examples.pdf Path: Penn State >> GEOSC >> 6 Fall, 2009 Description: 6.1 -1- 6.1 Definition and Some Examples of Isotope Effects Save Zoom Print this Section Differences in physical and chemical properties of substances arising from the presence of different isotopes in their constituent molecules or atoms are cal... Date Added: 2009-04-20 18:56:02 |
| CleanEnergyExpo2006.ppt Path: Penn State >> DWJ >> 123 Winter, 2009 Description: Welcome to the Kappe Environmental Engineering Labs at Penn State University! We are developing new methods of producing Clean Energy Such as biological generation of hydrogen and microbial fuel cells producing electricity from waste We develop many ... Date Added: 2009-04-20 18:56:43 |
| dp.pdf Path: Penn State >> KDN >> 5003 Fall, 2009 Description: ... Date Added: 2009-04-20 18:59:35 |
| 20081105PARVIN.pdf Path: Washington University in St. Louis >> K >> 30 Fall, 2009 Description: Logistic Regression DOCR Course November 5, 2008 Curtis A. Parvin, Ph.D. Department of Pathology & Immunology Phone: 454-8699 email: parvin@wustl.edu Regression Relate one or more independent (predictor) variables to a dependent (outcome) variable ... Date Added: 2009-04-20 19:05:55 |
| specialCharAndVerbatimEnv.pdf Path: Penn State >> PXT >> 156 Fall, 2009 Description: 1 LaTex quick start Oct 29, 2005: While trying to create a short document about Riemann\'s sum, I think I should establish a way to create a new document shortly. The following is the LaTex code that is suitable for short and simple document. Copy a... Date Added: 2009-04-20 19:07:20 |
| revised_handout.pdf Path: Penn State >> PLC >> 103 Fall, 2009 Description: ST PENN STATE INSTITUTES INSTITUTES ENVIRONMENT OF T HE ENVIRONMENT Leading Penn States environmental initiative through interdisciplinary research, education, and outreach. MISSION The mission of the Penn State Institutes of the Environment (PSIE) i... Date Added: 2009-04-20 19:07:40 |
| hw6.pdf Path: Penn State >> MATH >> 536 Spring, 2008 Description: Math 536 Homework 6 Spring 2008 Due: Friday, February 29 In all of the following problems R will denote a commutative ring with identity. 1. Let S be a multiplicative subset of R not containing 0. Let p be a maximal element in the set of ideals of R ... Date Added: 2009-04-20 19:10:11 |
| chap7.pdf Path: Washington University in St. Louis >> CSE >> 260 Fall, 2009 Description: Improving Processor Performance Memory latency and performance Expanded register sets Instruction set Caches Pipelining Making Computers Faster Large DRAM. gate delays now less than 50 ps can take 100 ns to retrie... Date Added: 2009-04-20 19:11:52 |
| APIEMS07_849.pdf Path: Penn State >> MZC >> 148 Fall, 2009 Description: An Investigation of the Applicability of DfX Tools during Design Concept Evolution Ming-Chuan Chiu1 , Chun-Yu Lin1, and Gl Okudan1,2 1 Department of Industrial and Manufacturing Engineering The Pennsylvania state University 310 Leonhard Building Uni... Date Added: 2009-04-20 19:13:42 |
| lec9.pdf Path: Penn State >> STAT >> 504 Spring, 2008 Description: \' Stat 504, Lecture 9 $ 1 Review example, in-class excercise: Problem 2.3, page 60 (Agresti): These data are based on records of accidents in 1988 complied by the Department of Highway Safety and Motor Vehicles in Florida. Identify the response va... Date Added: 2009-04-20 19:14:34 |
| donleyreview.pdf Path: Penn State >> SXS >> 62 Fall, 2009 Description: This article was downloaded by:[Squier, Susan M.] [Squier, Susan M.] On: 8 April 2007 Access Details: [subscription number 776770145] Publisher: Routledge Informa Ltd Registered in England and Wales Registered Number: 1072954 Registered office: Morti... Date Added: 2009-04-20 19:16:20 |
| Seafloorspreadinglesson9.pdf Path: Penn State >> LEC >> 10 Fall, 2009 Description: Chapter 22: Seafloor Spreading, Lesson 9 Leslie Coleman 2/13/04 Introduction: Seafloor Spreading 8th Grade Lab Science 408- 10th & 11th Periods Bald Eagle Area High School, Room 41 This is the second lesson of plate tectonics. This lesson follows ... Date Added: 2009-04-20 19:18:03 |
| lab1.pdf Path: Penn State >> ME >> 560 Fall, 2009 Description: ME 560, SPRING 2003, RAHN LAB 1: Modeling and Parameter Identification Introduction In this lab, you are to use either the Torsion or Industrial Servo ECP experiment in the Control Laboratory (243 Reber). The group assignments with lab times are on t... Date Added: 2009-04-20 19:23:20 |
| ICC2007_paper_Brewer_Buttenfield_Frye_Acosta_May31_07.pdf Path: Penn State >> CAB >> 38 Fall, 2009 Description: SCALEMASTER: MULTI-SCALE MAPMAKING FROM MULTIPLE DATABASE RESOLUTIONS AND FOR MULTIPLE MAP PURPOSES Cynthia A. Brewer1, Barbara P. Buttenfield2, Charlie Frye3, and Jessica Acosta1 1 - Pennsylvania State University, Dept. of Geography, University Park... Date Added: 2009-04-20 19:25:44 |
| APSA_2006_ESF.pdf Path: Penn State >> FRB >> 2006 Fall, 2009 Description: Aarhus, August 22, 2006 Memo on ESF application 2007. Everybody, As I cannot come to Philadelphia, I have been trying to put together some thoughts on how we could proceed with a common ESF application, drawing upon our meeting in Nicosia and email... Date Added: 2009-04-20 19:27:25 |
| PLSC_541_Fall_06_syl.pdf Path: Penn State >> PLSC >> 541 Fall, 2009 Description: PLSC 541, Public Policy and Agenda-Setting Penn State University Fall Term, 2006, Thursdays 2:305:30 Room 236 Pond Building Prof. Frank Baumgartner Office: 227 Pond Building Phone: 863 8978 Email: Frankb@psu.edu Web site: http:/polisci.la.psu.edu/fac... Date Added: 2009-04-20 19:27:27 |
| PerCom07_panel_CB_01.pdf Path: Penn State >> PERCOM >> 07 Fall, 2009 Description: How Much is Too Much On the Explosion in Sensor Network Research & Applications A Panel Session at PerCom07 Chatschik Bisdikian(*) IBM T. J. Watson Research Center (*) Opinions expressed in this discussion are strictly mine and do not reflect in any... Date Added: 2009-04-20 19:28:57 |
| PerCom07_panel_CB_01.pdf Path: Penn State >> PERCOM >> 2007 Fall, 2009 Description: How Much is Too Much On the Explosion in Sensor Network Research & Applications A Panel Session at PerCom07 Chatschik Bisdikian(*) IBM T. J. Watson Research Center (*) Opinions expressed in this discussion are strictly mine and do not reflect in any... Date Added: 2009-04-20 19:28:57 |
| REI.11.8.07.pdf Path: Washington University in St. Louis >> FY >> 07 Fall, 2009 Description: Office of the Vice Chancellor for RESEARCH REI Research Education and Information UPDATES Medical School - November 2008 Samantha Schlesinger Manager Research Education and Information ANNOUNCEMENT HR Leadership Breakfast * Rescheduled beginning Ja... Date Added: 2009-04-20 19:36:45 |
| REI.11.8.07.pdf Path: Washington University in St. Louis >> FY >> 08 Fall, 2009 Description: Office of the Vice Chancellor for RESEARCH REI Research Education and Information UPDATES Medical School - November 2008 Samantha Schlesinger Manager Research Education and Information ANNOUNCEMENT HR Leadership Breakfast * Rescheduled beginning Ja... Date Added: 2009-04-20 19:36:45 |
| Ch10AlchemyAtom.ppt Path: Penn State >> STS >> 15 Fall, 2009 Description: Chapter 10 From Alchemy to Atom Aluminum, Mining, Nuclear 26 = 64 years ago => 1942 \"The meeting of two personalities is like the contact of two chemical substances. If there is any reaction, both are transformed.\" Carl G. Jung The World about 1941 ... Date Added: 2009-04-20 19:39:25 |
| Ch10AlchemyAtom.ppt Path: Penn State >> STS >> 150 Fall, 2009 Description: Chapter 10 From Alchemy to Atom Aluminum, Mining, Nuclear 26 = 64 years ago => 1942 \"The meeting of two personalities is like the contact of two chemical substances. If there is any reaction, both are transformed.\" Carl G. Jung The World about 1941 ... Date Added: 2009-04-20 19:39:25 |
| 11-3-2005-Jon_Turner.pdf Path: Washington University in St. Louis >> CSE >> 770 Fall, 2009 Description: A DoS-limiting Network Architecture by Xiaowei Yang, David Wetherall and Thomas Anderson appears in Proceedings of SIGCOMM 2005 Jon Turner presented by Introduction Problem: protecting against Denial of Service attacks Internet is intrinsically... Date Added: 2009-04-20 19:41:04 |
| PGY-IV_ANSWER_KEY_BIS_Be_Aware_RCT_Lancet_2004.pdf Path: Washington University in St. Louis >> AUGUST >> 2005 Fall, 2009 Description: Critical Review Form Therapy Myles PS, et. al, Bispectral Index monitoring to prevent awareness during anesthesia: the B-Aware randomized controlled trial, Lancet 2004; 363:1757-1763 Objectives: \"To assess whether bispectral index (BIS) monitoring de... Date Added: 2009-04-20 19:44:14 |
| indxinfo.txt Path: Washington University in St. Louis >> MROCR >> 3001 Fall, 2009 Description: PDS_VERSION_ID = PDS3 RECORD_TYPE = STREAM OBJECT = TEXT PUBLICATION_DATE = 2006-06-09 NOTE = \"Description of contents of INDEX directory\" END_OBJECT = TEXT END The INDEX directory co... Date Added: 2009-04-20 19:47:53 |
| syllabus.pdf Path: Penn State >> RXM >> 111 Fall, 2009 Description: METBD 111 , Section 001: SOLIDS MODELING II INSTRUCTOR: Office Hours: Robert Michael 8 Prischak Building 898-6192 rxm61@psu.edu Web Site: http:/engr.bd.psu.edu/rxm61 Tuesday: 2:00 3:00 pm Thursday: 2:00 3:00 pm Friday: 11:00 12:00 pm (others by ... Date Added: 2009-04-20 19:48:59 |
| syllabus.pdf Path: Penn State >> RXM >> 61 Fall, 2009 Description: METBD 111 , Section 001: SOLIDS MODELING II INSTRUCTOR: Office Hours: Robert Michael 8 Prischak Building 898-6192 rxm61@psu.edu Web Site: http:/engr.bd.psu.edu/rxm61 Tuesday: 2:00 3:00 pm Thursday: 2:00 3:00 pm Friday: 11:00 12:00 pm (others by ... Date Added: 2009-04-20 19:48:59 |
| 107_Trapezoid_Rule.pdf Path: Penn State >> METBD >> 050 Fall, 2009 Description: MET 107 Trapezoid Method: The trapezoid method is a method for finding the area under the graph of a function f(x) between two values of x. While there are several other methods available to do this, we will discuss the simplest method which is known... Date Added: 2009-04-20 19:49:36 |
| p81-toda.pdf Path: Penn State >> WIDM >> 05 Fall, 2009 Description: A Search Result Clustering Method using Informatively Named Entities Hiroyuki Toda NTT Cyber Solutions Laboratories, NTT Corporation 1-1 Hikarinooka Yokosuka-Shi Kanagawa, 239-0847 Japan Ryoji Kataoka NTT Cyber Solutions Laboratories, NTT Corporatio... Date Added: 2009-04-20 19:51:00 |
| Gr6MathPI.pdf Path: Penn State >> JLG >> 18 Fall, 2009 Description: Planned Instruction for Math- Grade 6 Donegal School District Initially Posted July 2000, Revised January 2002 Code 2.1 Standard A. Represent and use numbers in equivalent forms (e.g., integers, fractions, decimals, percents, exponents, scientific n... Date Added: 2009-04-20 19:51:26 |
| PowerPointHandout.doc Path: Penn State >> CHL >> 121 Fall, 2009 Description: Christopher H. Laird Jr. PowerPoint Assignment Handout April 29, 2008 PowerPoint Presentation (40 points) 10-12 slides detailing the following: 1. history of the career 2. nature / description of work 3. training / requirements 4. employment oppor... Date Added: 2009-04-20 19:52:28 |
| ika_rubric.pdf Path: Penn State >> KDB >> 163 Fall, 2009 Description: IST 302 Section 3 (IT Project Management) Individual Knowledge Activity Rubric Individual Knowledge Activity Rubric Topic Area Organization and Structure Description of Achievement A definite introduction, body, and conclusion were present. Essa... Date Added: 2009-04-20 19:56:43 |
| ika_rubric.pdf Path: Penn State >> KDB >> 302 Fall, 2009 Description: IST 302 Section 3 (IT Project Management) Individual Knowledge Activity Rubric Individual Knowledge Activity Rubric Topic Area Organization and Structure Description of Achievement A definite introduction, body, and conclusion were present. Essa... Date Added: 2009-04-20 19:56:43 |
| Meteo535.Problem20.Solution.pdf Path: Penn State >> METEO >> 535 Fall, 2008 Description: ... Date Added: 2009-04-20 20:00:39 |
| Chem6.pdf Path: Penn State >> CSR >> 4 Fall, 2009 Description: Chemistry 6: Problem Solving In Chemistry 1 Credit Dr. Carey S. Reed C-127 Smith csr4@psu.edu Office: C-127 Smith, Office hours will be announced Telephone: ext. 5752 General information: Chem 6 is an introductory chemistry problem solving course whi... Date Added: 2009-04-20 20:07:00 |
| intro1.ppt Path: Penn State >> BIOL >> 110 Fall, 2008 Description: Welcome to Biology 110 Fall 2005 Dr. Denise Woodward/Dr. Richard Cyr 111B Mueller Lab/367 N. Frear Email through Angel FIRST RULE LEARN YOUR STUDENT ID # SECOND RULE READ THE SYLLABUS Lab Begins The Week of 9/12 in Mueller Lab Recitation Room (o... Date Added: 2009-04-20 20:08:47 |
| SOWGlistSol11.doc Path: Washington University in St. Louis >> MAY >> 01 Fall, 2009 Description: MER-FIDO Rover Field Test SOWG Chair Checklist Pre-Downlink Meeting 1 Roll Call Position SOWG Chair SOWG Documentarian STLs GEO MIN LTP STG Documentarians GEO MIN LTP WITS Operators GEO MIN LTP Rover Uplink Leads RUL1 RUL2 Mission Planner Mission Man... Date Added: 2009-04-20 20:10:08 |
| dooley1.pdf Path: Washington University in St. Louis >> V >> 9 Fall, 2009 Description: The Journal of Geometric Analysis Volume 9, Number 2, 1999 Spherical Functions on Harmonic Extensions of H -Type Groups By Anthony H. Dooley and Genkai Zhang ABSTRACT. We consider the harmonic extension AN of an H -type group N with Lie algebra n =... Date Added: 2009-04-20 20:13:36 |
| MaheshSrinivasanVitae.pdf Path: Penn State >> MUS >> 10 Fall, 2009 Description: Mahesh Srinivasan Work Address Home Address 463A Business Bldg, Dept. of SC&IS, Penn State University, University Park, PA 16802 Phone: 814-321-2706 EDUCATION 801 West Aaron Drive, Apt. # D-14, State College, PA 16803 E-mail: maheshs@psu.edu The P... Date Added: 2009-04-20 20:17:18 |
| RGPart1.pdf Path: Penn State >> MED >> 275 Fall, 2009 Description: Chapter 6: Momentum Reading Guide Part 1 Name: _ Period: _ Date: _ Read pages 86 to 92 and answer the following questions in complete sentences. 1. Momentum combines what two ideas? Momentum 1. Define momentum. What is the formula for momentum? 2... Date Added: 2009-04-20 20:17:32 |
| RGPart1.pdf Path: Penn State >> MED >> 6 Fall, 2009 Description: Chapter 6: Momentum Reading Guide Part 1 Name: _ Period: _ Date: _ Read pages 86 to 92 and answer the following questions in complete sentences. 1. Momentum combines what two ideas? Momentum 1. Define momentum. What is the formula for momentum? 2... Date Added: 2009-04-20 20:17:32 |
| 0809ac1.pdf Path: Penn State >> MS >> 1 Fall, 2009 Description: 2008-2009 Academic Calendar: First Year 2008 Registration Dates: Semester Begins Semester Ends August 11 December 18 August 1 - 8 September 1 All Students September 12, 4 p.m. Hospital Auditorium November 27-30 December 19-January 2 Semester Begins S... Date Added: 2009-04-20 20:18:38 |
| Final_PaperCG.pdf Path: Dallas >> SCE >> 5308 Spring, 2008 Description: THE EFFECT OF TEACHER ATTITUDE, EXPERIENCE, AND BACKGROUND KNOWLEDGE ON THE USE OF INQUIRY METHOD TEACHING IN THE ELEMENTARY CLASSROOM April 2003 By CATHLEEN GARCIA In partial fulfillment of the requirements in SCE 5308 THE EFFECT OF TEACHER ATTIT... Date Added: 2009-04-20 20:35:10 |
| Prob2336_S09.pdf Path: Dallas >> CS >> 017200 Fall, 2009 Description: PROGRAMMING ASSIGNMENTS CS2336 Computer Science II Check your WebCT account for updates, changes, hints, etc. before starting an assignment. Please assume any of the following assignments may be modified or replaced. Additional information or requir... Date Added: 2009-04-20 20:35:44 |
| Prob2336_S09.pdf Path: Dallas >> CS >> 2336 Fall, 2008 Description: PROGRAMMING ASSIGNMENTS CS2336 Computer Science II Check your WebCT account for updates, changes, hints, etc. before starting an assignment. Please assume any of the following assignments may be modified or replaced. Additional information or requir... Date Added: 2009-04-20 20:35:45 |
| vita.pdf Path: Penn State >> TXP >> 14 Fall, 2009 Description: TIMOTHY G. POLLOCK WORK: The Pennsylvania State University Smeal College of Business 417 Business Building University Park, PA 16802 Phone: (814) 863-0740 Fax: (814) 863-7261 e-mail: tpollock@psu.edu http:/www.personal.psu.edu/txp14 EDUCATION Ph.D. U... Date Added: 2009-04-20 20:42:16 |
| CV.doc Path: Dallas >> BAJ >> 034000 Fall, 2009 Description: 1 Curriculum Vitae BRUCE A. JACOBS, Ph.D. Contact Information: Bruce A. Jacobs 9728834557 (phone) 9723901939 (fax) bruce.jacobs@utdallas.edu EMPLOYMENT University of TexasDallas, Program in Criminology, 2003present University of MissouriSt. Louis, D... Date Added: 2009-04-20 20:45:14 |
| syllabus.pdf Path: Penn State >> ASTRO >> 534 Spring, 2008 Description: ASTRO 534: STELLAR STRUCTURE AND EVOLUTION Spring 2009 Graduate class in stellar astrophysics. Prerequisites: Astro 501 and 502. The rst part of the course will deal with understanding the equations of stellar structure and the physics that is applic... Date Added: 2009-04-20 20:45:39 |
| LITBA-2006.pdf Path: Dallas >> ARK >> 1 Fall, 2009 Description: The School of Arts and Humanities 2006-2008 Transfer Guide for Texas Common Course Numbering System Major: LITERARY STUDIES UTD Courses I. UTD CORE CURRICULUM REQUIREMENTS (42 Semester Hours) A. Communication (6 Hours) RHET 1302 Composition & Rhetori... Date Added: 2009-04-20 20:55:35 |
| ExtraProblem4.pdf Path: CofC >> MATH >> 323 Fall, 2008 Description: MATH 323 Extra Problem for Homework 13 Find the indicial equation and the exponents for the singularity x = 0: 2x2 y + 3x y + (2 x2 - 1) y = 0 x2 y - x(x + 3) y + (x + 3) y = 0 ... Date Added: 2009-04-20 21:07:51 |
| February06_manninpress.pdf Path: Penn State >> MANNJCLIM >> 05 Fall, 2009 Description: Testing the Fidelity of Climate Reconstruction Methods Two distinct methods have been used for reconstructing past climate histories from so-called proxy climate data: The Climate Field Reconstruction (\'CFR\') method, which assimilates proxy records i... Date Added: 2009-04-20 21:09:00 |
| quiz10.pdf Path: CSU Long Beach >> QUIZ >> 10 Fall, 2009 Description: CECS 228 Quiz 10, Fall 2008, Dr. Ebert 1. Write the expansion of (x + y)6 . Express each coecient as an integer. (15 points) 2. We want to prove that if x is irrational, then so is its reciprocal 1/x. If we were to use the indirect-proof technique,... Date Added: 2009-04-20 21:11:29 |
| quiz10.pdf Path: CSU Long Beach >> QUIZ >> 228 Fall, 2009 Description: CECS 228 Quiz 10, Fall 2008, Dr. Ebert 1. Write the expansion of (x + y)6 . Express each coecient as an integer. (15 points) 2. We want to prove that if x is irrational, then so is its reciprocal 1/x. If we were to use the indirect-proof technique,... Date Added: 2009-04-20 21:11:29 |
| ABSTRACT.TXT Path: CSU Long Beach >> C >> 347 Fall, 2009 Description: The SAMPL517 program uses the additional features of the 517 to simulate a Hewlett Packard calculator. The following calculator features are supported: + SIN LOG EXP COS ASIN LOG10 * TAN ACOS / SQRT ATAN The following source files provide useful 517... Date Added: 2009-04-20 21:12:08 |
| ABSTRACT.TXT Path: CSU Long Beach >> C >> 517 Fall, 2009 Description: The SAMPL517 program uses the additional features of the 517 to simulate a Hewlett Packard calculator. The following calculator features are supported: + SIN LOG EXP COS ASIN LOG10 * TAN ACOS / SQRT ATAN The following source files provide useful 517... Date Added: 2009-04-20 21:12:08 |
| cidPM.pdf Path: UConn >> CSE >> 230 Spring, 2008 Description: ID 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 Task_Name Insurance Department Migration Licensing Classify Dev Classify Test Ind Appls Dev Ind Appls Test Viatical Broker Dev Viatical Broker Test... Date Added: 2009-04-20 21:13:54 |
| StudyGuide4.ppt Path: UConn >> MATH >> 242 Fall, 2009 Description: StudyGuide StateFermatsLastTheorem. WhenandwheredidFermatlive andwork?Whatdidheactually proveabouthisclaim? WheredidFermatsLastTheorem getitsnamefrom? Whatisthemethodofinfinite descent? Whoiscreditedwiththeproofof FermatsLastTheorem?Whenand wher... Date Added: 2009-04-20 21:15:01 |
| FinalExamEmail.pdf Path: UConn >> CSE >> 298300 Fall, 2009 Description: Final Exam Email - Fall 2005 - December 7, 2005 Hi All, While I will answer questions regarding the final exam in class today, I wanted to make sure that I gave everyone the same advise regarding the exam in case there are any absences today. As of a... Date Added: 2009-04-20 21:15:34 |
| aap2.doc Path: UConn >> WEB >> 2 Fall, 2009 Description: UNIVERSITY OF CONNECTICUT Department of Human Resources CLASSIFIED STAFF RECRUITMENT AAP2 CARD Position Information: Department: Refill PC #: Part-Time Years Proposed Start Date: Permanent Months Durational/Temporary Position Title: Work Lo... Date Added: 2009-04-20 21:16:15 |
| 1_9.pdf Path: UConn >> MATH >> 112 Fall, 2009 Description: Solutions to Homework, Section 1.9 1) Sine is positive, Cosine is zero, Tangent is undened. 6) Sine is negative, Cosine is negative, Tangent is positive. 9) Sine is negative, Cosine is positive, Tangent is negative. 10) 0.809. 12) 0.588. 15) Between... Date Added: 2009-04-20 21:17:04 |
| GIS-SpatialAnalysis-and-Modeling.pdf Path: UConn >> NRME >> 277 Fall, 2008 Description: ... Date Added: 2009-04-20 21:19:30 |
| quiz04.pdf Path: UConn >> EC >> 230 Summer, 2009 Description: Name: _ Date: _ Instructions: Circle the letter that corresponds to the best answer. 1. In the aggregate-demand/aggregate-supply model, an increase in taxes causes _ to _ in the long run. A) output; increase B) output; decline C) output; be unchanged... Date Added: 2009-04-20 21:22:58 |
| letter10.pdf Path: UConn >> WEB >> 2 Fall, 2009 Description: Letter from the editor Dear readers, Days of summer are upon us, and as you put on your rosy, root-beer, or spruce-colored glasses, once again here is my nagging reminder to protect yourself by tossing sunscreen or sunblock into your beach bag or tac... Date Added: 2009-04-20 21:23:05 |
| letter10.pdf Path: UConn >> WEB >> 07 Fall, 2009 Description: Letter from the editor Dear readers, Days of summer are upon us, and as you put on your rosy, root-beer, or spruce-colored glasses, once again here is my nagging reminder to protect yourself by tossing sunscreen or sunblock into your beach bag or tac... Date Added: 2009-04-20 21:23:05 |
| 261W6.pdf Path: UConn >> WALK >> 6 Fall, 2009 Description: Taxodium distichum Taxodium distichum Common Baldcypress Taxodiaceae Located on North side of Swan Lake. q q q q q q q q q q leaves deciduous, thin, feathery, 2-ranked on branchlets leaves light green in summer, orange/brown in autumn leaves ... Date Added: 2009-04-20 21:24:57 |
| adimg.37831.15-DPF3DD41.1963.s8.ascs.1.s.sid.txt Path: UConn >> LIB >> 37831 Fall, 2009 Description: Identification_Information: Citation: Citation_Information: Originator: United States. Agricultural Stabilization and Conservation Service. Publication_Date: October 06, 1963 Title: Windham County Connecticut - aerial photogr... Date Added: 2009-04-20 21:25:21 |
| testseq5.txt Path: UConn >> MCB >> 372 Spring, 2008 Description: >A1Gallus mdfsklpkirdedreafvgyvqgvsgpvvtacnmagaamyelvr vghselvgeiirlegdlatvqvyeetsgvsvgdpvlrtgkplsvelgpgimgaifdgiqr plsdistltksiyiprgvnvsalsrdvkwdftpsknlrvgshitggdiygvvnen slikhkimlpprnrgtvtyiappgnydtsdvvlelefegvkekf tmvqvwpvrqvrpvteklpanhplltgqrvlda... Date Added: 2009-04-20 21:26:01 |
| phoenixproposal.pdf Path: CSU Long Beach >> PROG >> 2009 Fall, 2009 Description: CALL FOR PRESENTATION PROPOSALS FOR: 54th Annual IRA Convention West, Phoenix, Arizona (Feb 21-25, 2009) Would you like to attend IRA and present at next year\'s conference? IRA\'s Literacy and Social Responsibility Special Interest Group (SIG) invites... Date Added: 2009-04-20 21:27:04 |
| readme.txt Path: Kennesaw >> STAT >> 3120 Fall, 2008 Description: Installation of Datasets for Jessica Utts & Robert Heckard, Mind on Statistics, third edition. ISBN 0-534-99864-X Copyright (c) 2006, Thomson Brooks/Cole, a part of The Thomson Corporation. For Technical Support, call 1-800-423-0563. This insta... Date Added: 2009-04-20 21:28:02 |
| adimg.37800.00-33CT81.1995.s1.STCT.1.s.sid.txt Path: UConn >> LIB >> 37800 Fall, 2009 Description: Identification_Information: Citation: Citation_Information: Originator: United States. Dept. of Environmental Protection Publication_Date: April 18, 1995 Title: State of Connecticut - aerial photographs: Image ID 00-33CT81 ... Date Added: 2009-04-20 21:29:01 |
| pracfinalsolns.pdf Path: UConn >> MATH >> 1131 Fall, 2009 Description: ... Date Added: 2009-04-20 21:29:29 |
| quiz6.pdf Path: UConn >> MATH >> 115 Fall, 2009 Description: Name: Fall 2005, Math 115Q-Section 10 Quiz 6 Clearly show your work and follow the directions carefully. No calculators are permitted on this quiz. Useful Calculus Tip #1: Always look to simplify the problem before you start it. 1. Differentiate the ... Date Added: 2009-04-20 21:29:33 |
| notes.ch.1.2.pdf Path: Kennesaw >> MATH >> 1107 Fall, 2008 Description: KENNESAW STATE UNIVERSITY Department of Mathematics and Statistics MATH 1107 ELEM STAT 3-0-3 YANOSKY Page 1 of 2 MATH 1107 Class Notes: Chapters 1 & 2 Chapter 1 Statistics is: (2) about how to think clearly with data a way of reasoning and a col... Date Added: 2009-04-20 21:31:09 |
| fundtheoremlineintegrals.pdf Path: Kennesaw >> MATH >> 2203 Fall, 2008 Description: The Fundamental Theorem of Line Integrals (A Version of) The Fundamental Theorem of Calculus The Fundamental Theorem for Line Integrals Example 1 Independence of Path Theorem Conservative Vector Fields Theorem Theorem Theorem (a partial conv... Date Added: 2009-04-20 21:32:19 |
| econweb.pdf Path: UConn >> ANTH >> 220 Fall, 2008 Description: Adaptation and Economic Systems What is an Adaptive Strategy? - A set of physiological characteristics and behaviors that a given organism uses to survive and reproduce in a given environment. Adaptation and Economic Systems Any given environment ha... Date Added: 2009-04-20 21:35:00 |
| math107q_syllabus.pdf Path: UConn >> MATH >> 107 Fall, 2009 Description: MATH 107Q - Fall 2004 Mathematical Modelling Instructor: Marc Corluy Oce: MSB 335 E-mail: corluy@math.uconn.edu Oce Phone: 486.12.88 Class: MWF 9:00-9:50 in Arjona 407 Oce Hours: MWF 10:15-11:15 and by appointment Textbook Elementary Mathematical Mo... Date Added: 2009-04-20 21:37:09 |
| aqua-assess.pdf Path: UConn >> WEB >> 2 Fall, 2009 Description: Publication Number CTSG-05-02 An Assessment of the Needs of Connecticut\'s Shellfish Aquaculture Industry AQUACULTURE BULLETIN No. 1 Tessa S. Getchis Connecticut Sea Grant Extension Educator Department of Extension University of Connecticut Sea Gran... Date Added: 2009-04-20 21:37:34 |
| adv3200_proj3rubric.doc Path: Miami Dade >> ADV >> 3200 Fall, 2009 Description: Name_ ADV3200-Creative Concepts, Florida Intl. University Project 3, Magazine Advertising for Apple iPhone Development: Explored a wide variety of ideas by drawing the required 20 sketches. Maintained focus on the goal by writing an objectives statem... Date Added: 2009-04-20 21:40:15 |
| assignments-s08.pdf Path: Southern Utah >> ECD >> 3800 Fall, 2009 Description: FLHD 3800 Assignment Instructions Spring 2008 Most of the assignments are required to be submitted in webct. Do not hand in or send by email when webct submission is specified. A grade cannot be entered unless submitted in webct assignment tool! A... Date Added: 2009-04-20 21:40:26 |
| syllabus-f08.pdf Path: Southern Utah >> ENGL >> 2040 Fall, 2008 Description: ENGL 2040: PROFESSIONAL BUSINESS WRITING Fall 2008 Course Syllabus COURSE DESCRIPTION: This course is designed to help students write business and professional documents (letters, memorandums, e-mails, and reports). Report writing will emphasize orga... Date Added: 2009-04-20 21:42:18 |
| solutions_nss_nc_7.doc Path: W. Florida >> GEB >> 11 Fall, 2009 Description: Bonds and Their Valuation Learning Objectives Chapter 7 After reading this chapter, students should be able to: List the four main classifications of bonds and differentiate among them. Identify the key characteristics common to all bonds. Calc... Date Added: 2009-04-20 21:43:16 |
| solutions_nss_nc_7.doc Path: W. Florida >> GEB >> 5874 Fall, 2008 Description: Bonds and Their Valuation Learning Objectives Chapter 7 After reading this chapter, students should be able to: List the four main classifications of bonds and differentiate among them. Identify the key characteristics common to all bonds. Calc... Date Added: 2009-04-20 21:43:16 |
| hw3solf20051.pdf Path: UT Arlington >> EE >> 5368 Fall, 2008 Description: 2-9 Consider the average fade duration equation (2-39). Take the case of a vehicle moving at a speed of 100 km/hr. The system frequency of operation is 1 GHz. Say the ratio = 1. Show the average fade duration is 8 msec, as noted in the text. Now let... Date Added: 2009-04-20 21:48:07 |
| ++MedImSp06HW3.pdf Path: UT Arlington >> EE >> 5359 Fall, 2008 Description: EE5349 Medical Imaging: Homework #3 (Due. March 7, 2006) 1. More often, Maxwells equations are expressed in the SI (Standard International) unit or in the rationalized MKSA system, as follows: D= x E = - B/t B=0 x H = j +D/t. Using the identity: ... Date Added: 2009-04-20 21:48:15 |
| ChoCh10.pdf Path: UT Arlington >> EE >> 5359 Fall, 2008 Description: ... Date Added: 2009-04-20 21:48:20 |
| Lecture07.pdf Path: UT Arlington >> DSP >> 05 Fall, 2009 Description: EE5350: Digital Signal Processing Lecture 07 Digital Processing of Analog Signals Zhou Wang Dept. of Electrical Engineering The Univ. of Texas at Arlington Fall 2005 Notations Time- and frequency-domain indices: t : continuous time n : discrete ti... Date Added: 2009-04-20 21:50:01 |
| ch05.ppt Path: UT Arlington >> OPMA >> 5364 Fall, 2008 Description: Ch. 5: Project Planning Good Quote: Lame excuses for not planning: Plans are only good intentions unless they immediately degenerate into hard work Takes too much time Customers don\'t know what they want If we commit, we will be held accou... Date Added: 2009-04-20 21:50:07 |
| grid-proxy-init.txt Path: UT Arlington >> CSE >> 6350 Fall, 2008 Description: Syntax: grid-proxy-init-bin [-help][-pwstdin][-limited][-valid H:M] . Options -help, -usage Displays usage -version Displays version -debug Enables extra debug output -q ... Date Added: 2009-04-20 21:53:17 |
| PrelabS08.pdf Path: UT Arlington >> CSE >> 1310 Fall, 2008 Description: PRELAB #8 (Summer 2006) CSE 1310 Objectives: The purpose of this PRELAB is to help you in: Functions Questions 1, 2, 3, 4, 5, 6, 7, 8 and 9 are based on code below: void foo { int c = y = x = } (int x, int x + y; 2 * c; 2 * x; 1. x and y ar... Date Added: 2009-04-20 21:53:28 |
| HW1.pdf Path: UT Arlington >> EE >> 5340 Fall, 2008 Description: ... Date Added: 2009-04-20 21:55:53 |
| solutions_nss_nc_7.doc Path: W. Florida >> FIN >> 11 Fall, 2009 Description: Bonds and Their Valuation Learning Objectives Chapter 7 After reading this chapter, students should be able to: List the four main classifications of bonds and differentiate among them. Identify the key characteristics common to all bonds. Calc... Date Added: 2009-04-20 21:57:38 |
| solutions_nss_nc_7.doc Path: W. Florida >> FIN >> 3403 Fall, 2008 Description: Bonds and Their Valuation Learning Objectives Chapter 7 After reading this chapter, students should be able to: List the four main classifications of bonds and differentiate among them. Identify the key characteristics common to all bonds. Calc... Date Added: 2009-04-20 21:57:38 |
| AdaptRob2.pdf Path: UT Arlington >> EE >> 5325 Fall, 2008 Description: ... Date Added: 2009-04-20 21:57:46 |
| CSE6366_01.ppt Path: UT Arlington >> CSE >> 6366 Fall, 2008 Description: CSE6366 Digital Image Processing Dr. Hua-mei Chen NH248A hchen@cse.uta.edu http:/ranger.uta.edu/~hchen/CSE6366_2005.htm Textbook: Rafel C. Gonzalez and Richard E. Woods,\"Digital Image Processing, second edition\". Publisher: Prentice Hall. Website... Date Added: 2009-04-20 21:58:08 |
| Test2Summary(ch.15,16,19).pdf Path: UT Arlington >> CHEM >> 2322 Fall, 2008 Description: Test 2 Topic Summary Chapters 15, 16, 19 Chapter 15: Benzene and Aromaticity Structure and stability of benzene (resonance and molecular orbital explanations) Aromaticity rules (Hckel 4n+2 rule) Chapter 16: Chemistry of Benzene: Electrophilic Aro... Date Added: 2009-04-20 21:59:03 |
| LING3330_Spr2009_AffricatesNasalsApproximant_Feb11.ppt Path: UT Arlington >> WEEK >> 3330 Fall, 2009 Description: Affricates, Nasals, Complex Articulation\" combination of stop and a fricative release Feb 11, 2009 LING 3330 ... Date Added: 2009-04-20 21:59:12 |
| LING3330_Spr2009_AffricatesNasalsApproximant_Feb11.ppt Path: UT Arlington >> WEEK >> 4 Fall, 2009 Description: Affricates, Nasals, Complex Articulation\" combination of stop and a fricative release Feb 11, 2009 LING 3330 ... Date Added: 2009-04-20 21:59:12 |
| Sekine.ppt Path: NYU >> FRP >> 08 Fall, 2009 Description: Semantic Knowledge Discovery, Organization and Use Semantic Knowledge is crucial to understand human language Prof. Satoshi Sekine http:/nlp.cs.nyu.edu/sekine Russian Senator Mikhail Slonimsky was kidnapped on 3 May. The Moscow politician had left h... Date Added: 2009-04-20 22:03:19 |
| stopwords.txt Path: NYU >> G >> 22 Fall, 2008 Description: a all also although among an and anyone anything are around as at be because been before being both but by can did do does each else for from had has have he her here hers him his how if in into is it like may me next no not of on or our out that sa... Date Added: 2009-04-20 22:07:01 |
| Bechara1.pdf Path: NYU >> ECON >> 8917 Fall, 2009 Description: doi:10.1093/brain/awn066 Brain (2008), 131, 1311^1322 Differential effects of insular and ventromedial prefrontal cortex lesions on risky decision-making L. Clark,1,2 A. Bechara,3,4 H. Damasio,3 M. R. F. Aitken,1,2 B. J. Sahakian1,5 and T W. Robbin... Date Added: 2009-04-20 22:11:47 |
| mapfor9sept.pdf Path: NYU >> GC >> 1 Fall, 2009 Description: Address 7 E 7th St New York, NY 10003 ... Date Added: 2009-04-20 22:15:50 |
| l9.pdf Path: NYU >> G >> 22 Fall, 2008 Description: Inter-machine communication Datagram sockets: Unreliable message delivery - User Datagram Protocol (UDP/IP) - Send atomic messages, which may be reordered or lost Stream sockets: Bi-directional pipes - Transmission Control Protocol (TCP/IP) - Byte... Date Added: 2009-04-20 22:16:13 |
| urbaneco.pdf Path: NYU >> AS >> 6218 Fall, 2009 Description: NEW YORK UNIVERSITY Faculty of Arts & Sciences Department of Economics URBAN ECONOMICS (V31.0227.001) Spring 2008 Dr. Thomas Conoscenti E-mail: thomas.conoscenti@nyu.edu Office Hours Room 704, Wednesday 3:00 - 3:30 and after 6:10 PM Office Telephone... Date Added: 2009-04-20 22:18:28 |
| lect3.pdf Path: NYU >> G >> 22 Fall, 2008 Description: Kernel Data Structures Information about each process. Process table: contains an entry for every process in the system. Open-file table: contains at least one entry for every open file in the system. User Space Lecture 3 Processes and Filters C... Date Added: 2009-04-20 22:19:42 |
| ans02p2.pdf Path: NYU >> GRDEV >> 02 Fall, 2009 Description: Answers to Problem Set 2 [1] (a) Let (i) denote the discount factor of person i. Conditional on some trade occuring today, i can deviate. If he does so, his return is D+ (i) (1 s)M, 1 (i) because he is in the market from tomorrow on where the expe... Date Added: 2009-04-20 22:21:23 |
| 2003omp3_2.pdf Path: NYU >> GYC >> 206 Fall, 2009 Description: ... Date Added: 2009-04-20 22:21:45 |
| RR85-35.pdf Path: NYU >> ECON >> 1985 Fall, 2009 Description: ... Date Added: 2009-04-20 22:22:07 |
| lect4.ppt Path: NYU >> G >> 22 Fall, 2008 Description: Lecture 4 Regular Expressions grep and sed intro Previously Basic UNIX Commands Files: rm, cp, mv, ls, ln Processes: ps, kill Unix Filters cat, head, tail, tee, wc cut, paste find sort, uniq comm, diff, cmp tr Subtleties of commands ... Date Added: 2009-04-20 22:23:41 |
| homework2.pdf Path: NYU >> DERIVSEC >> 2006 Fall, 2009 Description: Derivative Securities, Courant Institute, Fall 2006 Assignment 2, due September 27 [Update: typos fixed Sept. 21, 22] Important: Always check the class bboard on the blackboard site from home.nyu.edu (click on academics, then on Derivative Securities... Date Added: 2009-04-20 22:27:27 |
| h2.pdf Path: NYU >> TS >> 510 Fall, 2009 Description: Math Logic Homework #2, Turing Machines A. For each of the following tasks, if there is a Turing machine that performs the task, give a flow diagram of such a machine. If there is no such Turing machine, explain why. The machine creates a \"negative... Date Added: 2009-04-20 22:28:18 |
| h2.pdf Path: NYU >> TS >> 65 Fall, 2009 Description: Math Logic Homework #2, Turing Machines A. For each of the following tasks, if there is a Turing machine that performs the task, give a flow diagram of such a machine. If there is no such Turing machine, explain why. The machine creates a \"negative... Date Added: 2009-04-20 22:28:18 |
| Hume_on_empirical_reasoning.pdf Path: NYU >> MODERN >> 05 Fall, 2009 Description: Probable reasoning has no rational basis The uniformity of nature is the principle that the course of nature continues uniformly the same, e.g. if X is the cause Y, then Y will necessarily exist whenever X exists. In particular, the uniformities obs... Date Added: 2009-04-20 22:32:35 |
| sugita.pdf Path: NYU >> MINICO >> 02 Fall, 2009 Description: Set-Theoretic Commutativity of Noun Phrases in Predicate Inversion Constructions This paper argues for set-theoretic commutativity of Noun Phrases in a Small Clause as a requirement for Predicate Inversion. Den Dikken (1998) claims that both the cop... Date Added: 2009-04-20 22:34:03 |
| ch15.pdf Path: NYU >> VALN >> 2 Fall, 2009 Description: 0 CHAPTER 15 FIRM VALUATION: COST OF CAPITAL AND APV APPROACHES In the last two chapters, we examined two approaches to valuing the equity in the firm - the dividend discount model and the FCFE valuation model. This chapter develops another approach... Date Added: 2009-04-20 22:38:29 |
| ZhangSG.pdf Path: NYU >> JL >> 17 Fall, 2009 Description: ... Date Added: 2009-04-20 22:39:36 |
| vxostruct.pdf Path: NYU >> ATM >> 262 Fall, 2009 Description: 0.08 0.07 eta(lag) var(log(x(t+dt)x(t) 0.06 estimated vs actual structure fn for VXO params a: 0.00732, bsigma: 0.04160, K: 0.02169 actual 0.05 0.04 0.03 0.02 0.01 0 estimator 0 10 20 30 40 50 60 lag in days 70 80 90 100 ... Date Added: 2009-04-20 22:41:02 |
| cohan.pdf Path: NYU >> NELS >> 32 Fall, 2009 Description: Heavy constituent extraposition: experimental evidence for parallel processing Jocelyn Cohan, Ren Kager, Hugo Quen, Sieb Nooteboom, UiL-OTS, Utrecht University Dominant models of speech production have employed linguistic components with a high degre... Date Added: 2009-04-20 22:42:55 |
| DelTorto.pdf Path: NYU >> NWAV >> 34 Fall, 2009 Description: Oh, were not making fun of you: An investigation of stylization and ideologies in Italian-English bilingual family interaction Several sociolinguistic studies have examined stylization of non-native English accents or mocking of languages other than ... Date Added: 2009-04-20 22:43:57 |
| mt1soln.pdf Path: NYU >> M >> 126 Fall, 2009 Description: 1. Evaluate the integrals. Show your work. R = a 8 points Solution: 0 2 cos d Integrate by parts with u = and dv = cos d, so du = d and v = sin . The integral is equal to sin 0 b 8 points Solution: R j=2 , Z =2 0 sin d = + cos =2 , ... Date Added: 2009-04-20 22:48:00 |
| interHumaCybernetics.pdf Path: NYU >> TJL >> 293 Fall, 2009 Description: interaction the cybernetic loop what it means? what it looks like? illustrated through art as innovation in class presentation by Taylor Levy November 8, 2007 ITP What you draw here will be seen by this class for a period of 1 minute. After that mi... Date Added: 2009-04-20 22:49:07 |
| pearson.pdf Path: NYU >> AS >> 4744 Fall, 2009 Description: Party Discipline in the Contemporary Congress: Rewarding Loyalty in Theory and in Practice Kathryn Pearson Chapter 3 Do Leaders Reward Loyalty on the Legislative Calendar? When describing how party leaders determined whose legislation to bring to the... Date Added: 2009-04-20 22:50:33 |
| pearson.pdf Path: NYU >> POLITICS >> 4744 Fall, 2009 Description: Party Discipline in the Contemporary Congress: Rewarding Loyalty in Theory and in Practice Kathryn Pearson Chapter 3 Do Leaders Reward Loyalty on the Legislative Calendar? When describing how party leaders determined whose legislation to bring to the... Date Added: 2009-04-20 22:50:33 |
| Science_2004_Stem_Cells.pdf Path: San Diego State >> BIO >> 610 Fall, 2009 Description: N e w s Fo c u s Scientists and ethicists are taking a closer look at ways to create pluripotent human stem cells without involving embryos. But how close are such ideas to reality? A Technical Fix For an Ethical Bind? There are a lot of ways to sk... Date Added: 2009-04-20 22:52:41 |
| reading2.pdf Path: San Diego State >> ASTRO >> 101 Fall, 2009 Description: Week #2 Handout, 2008.09.09 Astronomy 101, Professor Douglas Leonard Announcements My oce hours. As discussed last week, my oce hours are Friday 2:30 PM 4:30 PM, Rm. P238 (physics building). I strongly encourage you to use these. Remember, no appoi... Date Added: 2009-04-20 22:56:25 |
| bib-Wed-Feb-14.pdf Path: San Diego State >> LING >> 682 Fall, 2008 Description: Bibliography for Wed-Feb-14 Lecture Jean Mark Gawron SDSU February 14, 2007 References Herskovits, Annette. 1985. Semantics and pragmatics of locative expressions. Cognitive Science 9(3):341378. Herskovits, Annette. 1986. Language and Spatial Cognit... Date Added: 2009-04-20 23:03:41 |
| lecture13-static-04.pdf Path: San Diego State >> MATH >> 13 Fall, 2009 Description: mahaffy@math.sdsu.edu http:/www-rohan.sdsu.edu/jmahaffy ... Date Added: 2009-04-20 23:06:23 |
| lecture13-static-04.pdf Path: San Diego State >> MATH >> 541 Fall, 2008 Description: mahaffy@math.sdsu.edu http:/www-rohan.sdsu.edu/jmahaffy ... Date Added: 2009-04-20 23:06:23 |
| AXIS.pdf Path: San Diego State >> CS >> 683 Fall, 2008 Description: 3/25/03 Doc 17 Axis Soap Contents AXIS & WSDL . 2 WSDL for Axis Soap Service .. 2 Java From WSDL. 5 Server Side Code Generation. 16 How to generate WSDL without an E... Date Added: 2009-04-20 23:09:45 |
| cv.pdf Path: NYU >> PR >> 244 Fall, 2009 Description: PAU RABANAL Research Department International Monetary Fund 700 19th St. NW Washington, DC 20431, USA prabanal@imf.org EDUCATION Ph.D. in Economics, New York University, New York, NY, September 2002. Concentration: Monetary Economics, Macroeconomics... Date Added: 2009-04-20 23:16:21 |
| potts.pdf Path: NYU >> NELS >> 32 Fall, 2009 Description: No Vacuous Quantification Constraints In Syntax Christopher Potts UC Santa Cruz potts@ling.ucsc.edu Much recent work appeals to a ban on vacuous quantification (henceforth NVQ) that operates not merely as a criterion of non-redundancy in an informal ... Date Added: 2009-04-20 23:21:55 |
| hchen_2008.pdf Path: NYU >> W >> 2008 Fall, 2009 Description: Macroeconomic Conditions, Corporate Financing Decisions, and Credit Risk Hui Chen MIT Sloan May 14, 2008 Summary The Puzzles \"credit spread puzzle\" 10-year Baa-Treasury 10-year Baa-Aaa data 148 bp 101 bp existing models 3965 bp 3352 bp Summary T... Date Added: 2009-04-20 23:25:08 |
| mccarthy_fig.pdf Path: NYU >> AS >> 4600 Fall, 2009 Description: Figures Employment at the Bethlehem Plant, 1940-1998 35000 30000 25000 20000 Workers Workers 15000 10000 5000 0 1940 1943 1945 1950 1955 1960 1965 1970 1975 1980 1985 1990 1995 1996 1997 1998 Years Figure 1: Employment at the ... Date Added: 2009-04-20 23:25:28 |
| mccarthy_fig.pdf Path: NYU >> POLITICS >> 4600 Fall, 2009 Description: Figures Employment at the Bethlehem Plant, 1940-1998 35000 30000 25000 20000 Workers Workers 15000 10000 5000 0 1940 1943 1945 1950 1955 1960 1965 1970 1975 1980 1985 1990 1995 1996 1997 1998 Years Figure 1: Employment at the ... Date Added: 2009-04-20 23:25:29 |
| Day15.pdf Path: NYU >> MA >> 401 Spring, 2009 Description: 21 March 2007 Paul E. Hand hand@cooper.edu MA 401 Day 15 Linearity and Heat Equation with Dirichlet BCs Objectives: As a result of this day of class, you should be able to: I.) Identify if a given PDE is linear. II.) Write the solution to the heat a... Date Added: 2009-04-20 23:29:25 |
| 11-27.ppt Path: Central Mich. >> BIO >> 326 Fall, 2009 Description: Announcements 1. Pick up study guide today - some time in lab for questions 2. Pick up problem set 8 - first 2 questions graded, due start of lab next week. 3. Please let me know if you have a final exam scheduling conflict; we need to reschedule you... Date Added: 2009-04-20 23:31:14 |
| climate.doc Path: Central Mich. >> FRANC >> 1 Fall, 2009 Description: CLIMATE This section focuses on global climates and their relationship to the global distribution of soils and biomes. Two different methods of climatic classification are examined and the rationale for each is presented. The influence of climate on ... Date Added: 2009-04-20 23:31:43 |
| how_experts_differ.pdf Path: Central Mich. >> EDU >> 493 Fall, 2009 Description: Dr. Zhang EDU 493 Learning and Evaluation Chapter Two How Experts Differ From Novices Chapter Two - How Experts Differ From Novices Please refer to the Reading Guidelines to prepare for class discussion. Areas of Discussion for Chapter Two: 1. Ex... Date Added: 2009-04-20 23:31:58 |
| ICTCM1999.pdf Path: Central Mich. >> LAPP >> 1 Fall, 2009 Description: Calculator-Based Laboratory Technology: What Does Research Suggest? Douglas A. Lapp, Ph.D. moenk1sj@mail.cmich.edu The Curriculum and Evaluation Standards for School Ma... Date Added: 2009-04-20 23:32:33 |
| resume_nitinSingla.doc Path: NYU >> NS >> 1370 Fall, 2009 Description: Nitin Singla 2854, JFK Blvd, Apt 907 Jersey City, NJ 07306 Tel: (708)5028560 Email: nitinsingla0999@yahoo.com Homepage: http:/homepages.nyu.edu/~ns1370 PROFESSIONAL TRANING 6 months internship at IT Dept., National Fertilizers Ltd., Bathinda, India... Date Added: 2009-04-20 23:34:30 |
| queinnec-webcont.pdf Path: Grinnell >> CS >> 302 Spring, 2006 Description: Programming Languages (CS302 2007S) Christian Queinnec - In Influence of Browsers on Evaluators or, Continatuions to Program Web Servers Comments on: Queinnec, Christian (2000). The Influence of Browsers on Evaluators or, Continuations to Program We... Date Added: 2009-04-20 23:35:46 |
| a2.pdf Path: Grinnell >> CSC >> 152 Fall, 2009 Description: CSC152 Assignment 2 Fall 2006 Due: Wednesday, September 13 at 11:00 am. NOTE: Please put the classes you write for this assignment in a package called username.hw2. 1. [5 points]: A group of poor undergraduate students have pooled their pennies, h... Date Added: 2009-04-20 23:36:09 |
| a4.pdf Path: Grinnell >> CSC >> 152 Fall, 2009 Description: CSC152 Assignment 4 Spring 2007 Due: Thursday, March 15 at 11:00 am. NOTE: Please put the class you write for this assignment in a package named username.hw4. Total points: 20 Write a public class named Date that implements the methods described b... Date Added: 2009-04-20 23:36:10 |
| lecture4.pdf Path: Grinnell >> PHY >> 117 Spring, 2009 Description: ... Date Added: 2009-04-20 23:36:28 |
| Mechanics-Syllabus.pdf Path: Westminster PA >> MECHANICSS >> 252 Spring, 2009 Description: Mechanics of Systems Physics 252 Westminster College 1 Pertinent Information Instructor: Doug Armstead Oce: 124 Hoyt (724) 946-7201 Oce Hours: WF 2-3. These are just the times I guarantee. I am available other times so feel free to drop by or to ... Date Added: 2009-04-20 23:39:04 |
| exam.02.pdf Path: Grinnell >> CS >> 151 Fall, 2003 Description: Fundamentals of Computer Science I: Media Computing (CS151.01 2008S) Exam 2: Control: Conditionals, Iteration, and Recursion Assigned: Wednesday, 5 March 2008 Due: Beginning of class, Wednesday, 12 March 2008 Preliminaries Exam format This is a tak... Date Added: 2009-04-20 23:39:53 |
| couzin.pdf Path: Swarthmore >> PHYS >> 120 Fall, 2009 Description: Received 15 July 2002 Accepted 18 September 2002 Published online 9 December 2002 Self-organized lane formation and optimized traffic flow in army ants I. D. Couzin1* and N. R. Franks2 1 2 Department of Ecology and Evolutionary Biology, Princeton U... Date Added: 2009-04-20 23:42:00 |
| 0402023.pdf Path: Swarthmore >> SOC >> 26 Fall, 2009 Description: How can we think the complex? Carlos Gershenson and Francis Heylighen Centrum Leo Apostel, Vrije Universiteit Brussel Krijgskundestraat 33. B-1160 Brussels, Belgium http:/www.vub.ac.be/CLEA , {cgershen,fheyligh}@vub.ac.be Intended for Section 1: Phi... Date Added: 2009-04-20 23:42:22 |
| 21_Pots.pdf Path: Swarthmore >> PHYS >> 6 Fall, 2009 Description: Watching the Quantum Pot Consider a \"pot\" consisting of a few thousand Be ions (removed electrons). Such charged ions can be corralled by an electric-field into ion trap = the quantum pot. This model is just like water molecules in pot on stove. Now ... Date Added: 2009-04-20 23:42:29 |
| Harrison-GLOW-1999.pdf Path: Swarthmore >> DHARRIS >> 2 Fall, 2009 Description: VOWEL HARMONY AND DISHARMONY IN TUVAN AND TOFA K. David Harrison1 Yale University 1. Introduction Harmony systems are often described in the linguistic literature in a highly schematic and somewhat idealized fashion. Further, instances of disharmon... Date Added: 2009-04-20 23:43:21 |
| hwk6.pdf Path: Knox >> CS >> 262 Fall, 2009 Description: CS262 Info Mgmt Blaheta Homework 6 Due: 19 Oct 2007 Problem 6.1 (4) In this project youre going to write a route nder. The applet you write should be able to read in map les, and using a variety of dierent heuristics to shape the search, display ... Date Added: 2009-04-20 23:44:46 |
| Ch1Sec2.pdf Path: Marietta >> MATH >> 302 Fall, 2009 Description: Section 1.2 - Analytic Technique: Separations of Variables 1. Standard form for a rst-order dierential equation: dy = f (t, y) dt ( Recall independent variable (t), dependent variable (function) ) A solution of the dierential equation is a function o... Date Added: 2009-04-20 23:48:25 |
| Lab02_Kinematics.pdf Path: Concordia NE >> PHYS >> 110 Fall, 2009 Description: Lab 2: Kinematics Objective: Procedure Part I: Hardware/Software Orientation The instructor will talk you through a brief orientation about how to set up and use a photogate and motion sensor. Part II: Position versus Time Graphs 1. 2. Now you will b... Date Added: 2009-04-20 23:49:04 |
| Chapter2.pdf Path: Concordia NE >> PHYS >> 111 Fall, 2009 Description: Displacement Chapter 2: Kinematics Brent Royuk Phys-111 Concordia University The Cartesian axis One dimension: the number line Mathematical definition of displacement: delta means change \"x = xv # x i Whats the difference between distance a... Date Added: 2009-04-20 23:49:09 |
| Phys242LabsS2005.pdf Path: Oklahoma Baptist >> PHYS >> 242 Spring, 2009 Description: PHYSL 242, College Physics II Lab, Spring 2005 Instructor: Michael R. Jordan Textbook: none, lab notebook required Office: 202B Wood Science Phone: 878-2044 e-mail: obujordan@mac.com website and course forums: http:/www.okbu.net Tentative office Hour... Date Added: 2009-04-20 23:49:13 |
| matsum.pdf Path: Whitman >> M >> 250 Fall, 2009 Description: MATLAB Quick Summary, Part I General Commands exit Exit Matlab whos List all variables and info ls List the directory dir List the directory help command Type the help for command helpdesk Invoke the browser help lookfor keyword Search help for keywo... Date Added: 2009-04-20 23:51:18 |
| Exercise_01.doc Path: Coker >> CS >> 110 Fall, 2009 Description: CS110 Computer Science Exercise 01 - Basic Computer Skills - Exercises a) Can you create a folder on the \"C\" drive and name it \"Exercise_01\"? Show the instructor you can to that. b) What is a \"path\" in the computer file systems context? c) How ... Date Added: 2009-04-20 23:52:31 |
| homeostasisenvt.pdf Path: Davidson >> BIO >> 112 Fall, 2009 Description: How is homeostasis maintained in the context of the environment? Does Physiological and Behavioral Ecology The study of physiology and responses of organisms to specific environmental factors acting as selective agents. The study of behavioral de... Date Added: 2009-04-20 23:54:36 |
| Writing%20-%20%20Nuclear%20Spring%202006.pdf Path: Eastern Nazarene >> CH >> 104 Fall, 2009 Description: CH104 Spring 2006 Literature Review Paper It is very easy to publish web based material on any topic. That ease has led to abuse. There is no governing body monitoring the validity of information available on the WEB. As a result it is common for u... Date Added: 2009-04-20 23:55:39 |
| JEMSS_Tables_(7.7.01).pdf Path: Davidson >> RICEETAL >> 00 Fall, 2009 Description: Table 1. Number of amphibian species recorded per 5-year interval in Mecklenburg and Iredell Counties (NC). The \"Localities\" column indicates the number of sites during 1998-2000 at which each species was verified. Amphibia: Caudata Ambystoma maculat... Date Added: 2009-04-20 23:56:41 |
| P61-84.pdf Path: Kalamazoo >> CAT >> 0102 Fall, 2009 Description: ACADEMIC PROGRAMS Degree Requirements Academic Policies and Procedures Divisions and Departments Majors and Minors Courses of Instruction Honors, Awards, and Prizes ACADEMIC PROGRAMS V Degree Requirements The Kalamazoo College Curriculum The philo... Date Added: 2009-04-20 23:57:56 |
| review1solns.pdf Path: Kalamazoo >> MATH >> 214 Fall, 2009 Description: Calculus III, Exam 1: Review Solutions 1 1 Calculus III Exam 1 Practice Problems - Solutions 1. Compute the following: (a) limt1 (1 t2 ) + (tet ) + (sin t)k = limt1 1 t2 , tet , sin t = limt1 1 t2 , limt1 tet , limt1 sin t = 0, e, 0 (b) 1 0 (c... Date Added: 2009-04-20 23:58:06 |
| preface_Ch1.pdf Path: Davidson >> MERLOT >> 02 Fall, 2009 Description: Physlet Workbook: Interactive Exercises for Introductory Physics Wolfgang Christian Mario Belloni 2002 by Wolfgang Christian and Mario Belloni Text in Progress for Prentice Hall, Inc. 2002 by Wolfgang Christian and Mario Belloni Text in Progress ... Date Added: 2009-04-20 23:58:11 |
| shortstory.doc Path: Ferrum >> ENG >> 206 Fall, 2009 Description: SHORT STORY STUDY SHEET Title of Story: Author: Author\'s dates: Characters: Point of view: Setting (Place and date): Summary: Tone: Style: Irony: Theme: Symbols: About the author: Other notes: ... Date Added: 2009-04-20 23:58:17 |
| study1.pdf Path: Earlham >> CS >> 480 Fall, 2008 Description: 2 z }i j n{i ju j p { j p{ f i m i }if n p u n 7~BqiBoo|eBoxVqjS uddhoUBx)qBhSoego p {u } pz } p p } ji i n p i Bhdfjo|n~PcBdu{B~i~ioVqjuo~odjU~odjoqgen$ugy qBhi7hdfoqjo|nBPqxuuq{~BqiBqio~eifugjo|n~PBoBeufdoqjBoujengoBoqjeprggoenugy } f ... Date Added: 2009-04-20 23:59:23 |
| beekman6_ppt_05.ppt Path: St. Francis IL >> CPSC >> 101 Fall, 2009 Description: Computer Confluence 6/e 2005 Prentice-Hall, Inc. Slide 1 Computer Confluence 6/e Chapter 5 Basic Office Applications 2005 Prentice-Hall, Inc. Slide 2 Computer Confluence 6/e Chapter 5 Objectives Describe how computers can make the writing ... Date Added: 2009-04-21 00:00:14 |
| beekman6_ppt_05.ppt Path: St. Francis IL >> CPSC >> 5 Fall, 2009 Description: Computer Confluence 6/e 2005 Prentice-Hall, Inc. Slide 1 Computer Confluence 6/e Chapter 5 Basic Office Applications 2005 Prentice-Hall, Inc. Slide 2 Computer Confluence 6/e Chapter 5 Objectives Describe how computers can make the writing ... Date Added: 2009-04-21 00:00:14 |
| bosch_cultural.pdf Path: Earlham >> ART >> 282 Fall, 2009 Description: The Cultural Background Behind the Garden of Earthly Delights Skylar Thompson December 1, 2005 1 Hieronymous Bosch was a controversial figure in his own time, and remains one today. Some contemporaries accused him of being an \"inventor of monsters... Date Added: 2009-04-21 00:00:44 |
| T01_f2002_A.pdf Path: Sewanee >> PHYSICS >> 104 Fall, 2009 Description: PY208 section 012 Test 1, Monday 2002 Sep. 16 Name_ Group _ Read all problems carefully before attempting to solve them. Your work must be legible, and the organization must be clear. Correct answers without adequate explanation will be counted w... Date Added: 2009-04-21 00:03:57 |
| Chapter2.doc Path: Minnesota >> STAT >> 2601 Fall, 2009 Description: 2. Methods for Describing Sets of Data 2.1 Describing Qualitative Data Definition 2.1 A class is one of the categories into which qualitative data can be classified. Definition 2.2 A class frequency is the number of observations in the data set falli... Date Added: 2009-04-21 00:04:14 |
| exam.pdf Path: St. Vincent >> PH >> 111 Fall, 2001 Description: St. Vincent College PH 111: General Physics I 10/17/2003 Exam 2 The exam consists of 5 questions. There will be 50 minutes to complete the exam. The questions may not be worth the same number of points, read the entire exam before beginning work. P... Date Added: 2009-04-21 00:05:37 |
| s1.pdf Path: St. Vincent >> PH >> 241 Fall, 2009 Description: 1. Given Maxwell\'s Equations for electromagnetic fields in vacuum, E = 0 B E = - t B =0 B = 0 0 E t show that the electric field satisfies a wave equation. From this wave equation, obtain the speed of the electric field wave and show that it is n... Date Added: 2009-04-21 00:06:01 |
| Verification%20Worksheet,%20Dep.pdf Path: Lake Forest >> PAGE >> 4555 Fall, 2009 Description: Office of Financial Aid 555 North Sheridan Road Lake Forest Illinois 60045-2399 Phone: 847-735-5015 or 847-735-5010 Fax: 847-735-6271 2008-2009 VERIFICATION FORM Your financial aid application has been selected for a process called verification - a ... Date Added: 2009-04-21 00:07:00 |
| Collison-FacilitatingOnlineLearning.pdf Path: Loras >> RA >> 062578 Fall, 2009 Description: ... Date Added: 2009-04-21 00:07:46 |
| EDMcri1.doc Path: Loras >> LIB >> 305 Fall, 2009 Description: Brian DeMoss Ethical Decision Making 2-27-08 A Loras College education is based upon the core values of the Catholic faith and being an ethical decision maker. decision maker means multiple things. Being an ethical First and for most it means that... Date Added: 2009-04-21 00:08:40 |
| EDMcri1.doc Path: Loras >> LIB >> 378594 Fall, 2009 Description: Brian DeMoss Ethical Decision Making 2-27-08 A Loras College education is based upon the core values of the Catholic faith and being an ethical decision maker. decision maker means multiple things. Being an ethical First and for most it means that... Date Added: 2009-04-21 00:08:40 |
| ORG101Pr8ans.pdf Path: Westmont >> ORGA >> 04 Fall, 2009 Description: Organic Chemistry 101 Problems #8 Due Thursday, October 21 at 10am Solutions Give the proper name or structure for each of the following. (note change in problem d to nonyne) 1. a) H3 C C C Cl b) c) 6-chloro-5-ethyl-6-methyl-2-heptyne d) 5-Isobutyl-... Date Added: 2009-04-21 00:09:28 |
| Problems06Ans04.pdf Path: Westmont >> ORGA >> 06 Fall, 2009 Description: Organic Chemistry 101 1. Problems #4 Due Friday, September 22, 2006 this bond CH2 CH3 CH CH2 CH3 Draw a curve similar to Figure 4.5, page 106, of your text for rotating about the C2-C3 bond in 3-methylpentane. Draw out the Newman projections for t... Date Added: 2009-04-21 00:09:32 |
| Ch04.pdf Path: Westmont >> CS >> 105 Fall, 2007 Description: Language Systems Chapter Four M odern Programming Languages 1 Outline The classical sequence s Variations on the classical sequence s Binding times s Debuggers s Runtime support s Chapter Four M odern Programming Languages 2 The Classical Seq... Date Added: 2009-04-21 00:09:35 |
| 060130.pdf Path: NMT >> EE >> 308 Fall, 2009 Description: EE 308 Spring 2006 The HCS12 has 6 addressing modes Most of the HC12s instructions access data in memory There are several ways for the HC12 to determine which address to access Effective Address: Memory address used by instruction ADDRESSING MOD... Date Added: 2009-04-21 00:10:25 |
| S12VREGV1.pdf Path: NMT >> EE >> 308 Fall, 2009 Description: DOCUMENT NUMBER S12VREGV1/D VREG Block User Guide V01.01 Original Release Date: 21 FEB 2001 Revised: 4 MAR 2002 Motorola, Inc Motorola reserves the right to make changes without further notice to any products herein to improve reliability, functi... Date Added: 2009-04-21 00:15:08 |
| CNmtAsl.txt Path: NMT >> R >> 94 Fall, 2009 Description: No. yy mm dd hh mm ss lat latm long longm nmt asl Difference 1. 76 4 1 14 4 27.63 33 51.59 105 58.30 1.6 1.3 0.3 2. 76 4 1 14 4 58.54 33 56.30 105 55.54 2.7 2.2 0.5 3. 76 4 1 14 4 16.71 33 54.... Date Added: 2009-04-21 00:17:00 |
| MemHierarchy.pdf Path: UCLA >> CSM >> 151 Fall, 2009 Description: Average Access Time in a Memory Hierarchy Let t i = Access time for memory level i : e.g., t1 = primary cache access time t2 = secondary cache access time t3 = main memory tave = h1t1 + (1-h1)(h2)(t2 + t1) + (1-h1)(1-h2)h3(t3 + t2 + t1) + . N i=1 E... Date Added: 2009-04-21 00:19:31 |
| process_u.pdf Path: UCLA >> CS >> 111 Spring, 2005 Description: User view of processes overview processes as viewed by the user The state of a computation recall the shared chess board analogy what makes two different games different? a game is characterized by the positions of 32 pieces process stat... Date Added: 2009-04-21 00:21:04 |
| chp14.pdf Path: UCLA >> CS >> 143 Fall, 2009 Description: 166 Chapter 14 Query Optimization Changes from 3rd edition: The major change from the previous edition is that the 3rd edition chapter on query processing has been split into two chapters. Coverage of size estimation for different operations, whic... Date Added: 2009-04-21 00:21:33 |
| ProjectGuidelines.pdf Path: UCLA >> PS >> 203 Fall, 2009 Description: Project Guidelines Your team will report the results of two projects (one during the first half of class, the other during the second half). Please include any relevant data you collect for the project as an appendix to your report. Present all data ... Date Added: 2009-04-21 00:22:37 |
| ProblemSet6.pdf Path: UCLA >> PS >> 203 Fall, 2009 Description: Problem Set 6- Due Monday, December 4 1. Use the GSS data to pose and test a hypothesis about the relationship between two categorical variables. Do the Chi-Squared calculation first by hand (or in Excel). Please show your work. Then check your work... Date Added: 2009-04-21 00:22:39 |
| Prescription.pdf Path: UCLA >> N >> 239 Fall, 2009 Description: Writing a Prescription Types of Drugs Prescription Regular/non-addictive Schedule I substances with no accepted medical use in the United States (heroin, LSD, etc.) Schedule II high abuse potential, with severe psych or physical dependence Sch... Date Added: 2009-04-21 00:22:55 |
| N295ASyllabusrev2.pdf Path: UCLA >> N >> 295 Fall, 2009 Description: School of Nursing UCLA Center for the Health Sciences Los Angeles COURSE DESCRIPTION COURSE NUMBER AND TITLE: N295A: Nursing Science Seminar NUMBER OF CREDITS: 1 Credit. Seminar. COURSE DESCRIPTION: Introduces student to nursing research methods, act... Date Added: 2009-04-21 00:22:57 |
| 4_Cardiovascular_II.pdf Path: UCLA >> N >> 225 Winter, 2009 Description: Cardiovascular Pharmacology II Dr. Aaron J Strehlow Leftovers. Antiarrhythmics Antilipemics 1 http:/www.tammisworld.com/archives/acute%20angina-thumb.jpg www.samplant.com Foxglove Digitalis purpurea (Scrophulariaceae) www.eeb.uconn.edu/./digita... Date Added: 2009-04-21 00:23:09 |
| HW8_sol.pdf Path: UCLA >> STAT >> 110 Spring, 2002 Description: 475.101 / 102 / 107 / 108 Semester 2, 2000 Assignment 3 Solutions Question 1. (a) ( i ) pr(X 17) = 0.3694 (ii) pr(X < 17) = pr(X 17) = 0.3694 (iii) pr(X > 21) = 1 pr(X 21) = 1 0.8413 = 0.1587 (iv) pr(12 X 16) = pr(X 16) pr(X 12) = 0.2525 0... Date Added: 2009-04-21 00:24:09 |
| HW08_Sol.pdf Path: UCLA >> STAT >> 13 Fall, 2008 Description: HW # 8 Stat 13.1 8.4 (a) The explanatory variable is coffee consumption rate. (b) The response variable is coronary heart disease (present or absent). (c) The observational units are subjects (ie., the 1,040 persons). 8.9 People eating the potato chi... Date Added: 2009-04-21 00:24:10 |
| lab06.pdf Path: NMT >> EE >> 443 Fall, 2009 Description: EE443L Lab 6: DC Motor Trajectory Tracking Introduction: Many applications require a motor to accurately track a position profile that varies smoothly over time rather than a sharp transition from one fixed value to another. This type of control obje... Date Added: 2009-04-21 00:24:55 |
| CourseManagementSystemProjectAssessmentWorksheet.pdf Path: UCLA >> FEB >> 052003 Fall, 2009 Description: Project Name: Sub-Project Name: IT Strategic Area(s) of Emphasis: Development Costs: (total in Maintenance Costs: (total in Annual Costs: (permanent, starting FY Date/Time: 1/3/03 Course Management System Stage 1, web services architecture and tool ... Date Added: 2009-04-21 00:25:09 |
| Willms-Tritium_Supply_Considerations.pdf Path: UCLA >> FNST >> 12 Fall, 2009 Description: Tritium Supply From non-Fusion Sources Scott Willms Los Alamos National Laboratory Fusion Nuclear Science and Technology Meeting UCLA August 12-14, 2008 Credits Contributors P. Rutherford, D.-K. Sze, J. Anderson, M. Abdou References Rutherfor... Date Added: 2009-04-21 00:25:49 |
| integration.ppt Path: UCLA >> CS >> 246 Fall, 2009 Description: CS246 Dynamic Integration Framework Where We Are Data Extraction Dynamic Integration General Framework Junghoo \"John\" Cho (UCLA Computer Science) 2 Today\'s Topic Planning to gather information Was it easy to understand? Relatively easy ... Date Added: 2009-04-21 00:26:13 |
| Response_OPENSEES.doc Path: UCLA >> PEER >> 2 Fall, 2009 Description: Code Developer\'s Response to Report on Code Usage Exercise for OpenSeesTP Note: (a) The following responses are made by the code developer, Dr. Yang, which corresponds to the comments (1 to 14) made by the UCLA team in the section \"Notes regarding ob... Date Added: 2009-04-21 00:26:27 |
| ee206a_prj.pdf Path: UCLA >> EE >> 0305231705 Spring, 2009 Description: EE206A Project Proposal 4/18/03 Heemin Park 1. Background Y Communicating wirelessly is much expensive than computing inside a node. Y In many cases, nodes are heterogeneous and network has tiered architecture. This means nodes may have different com... Date Added: 2009-04-21 00:28:00 |
| ee206a_prj.pdf Path: UCLA >> EE >> 206 Fall, 2009 Description: EE206A Project Proposal 4/18/03 Heemin Park 1. Background Y Communicating wirelessly is much expensive than computing inside a node. Y In many cases, nodes are heterogeneous and network has tiered architecture. This means nodes may have different com... Date Added: 2009-04-21 00:28:00 |
| hw0.pdf Path: UCLA >> CS >> 181 Fall, 2009 Description: CS 181 - Winter 2007 Formal Languages and Automata Theory Problem Set #0 Optional Problem 0.1. (30 points) The power set P (X) of a set X is the set containing all subsets of X. For example, the power set of {a, b} is {, a, b, {a, b}. It is well kn... Date Added: 2009-04-21 00:30:02 |
| Exercise1B.pdf Path: UCLA >> CHAPTER >> 1 Fall, 2009 Description: Name_ Chapter 1, exercise B B Describe the consonants in the word skinflint using the chart below Fill in all five columns, and put parentheses around the terms that may be left out, as shown for the first consonant. 1 voiced or voiceless s k n f l t... Date Added: 2009-04-21 00:30:24 |
| some_remarks_on_domain_widening.pdf Path: UCLA >> WCCFL >> 27 Fall, 2009 Description: Remarks on domain widening Keywords: domains of quantification, NPIs, domain widening Some remarks on domain widening 1. Introduction. Many influential accounts of NPI any build on the proposal in [3] that any widens the domain of quantification wi... Date Added: 2009-04-21 00:30:56 |
| p314-li.pdf Path: UCLA >> SENSYS >> 03 Fall, 2009 Description: Poster Abstract: Using Adaptive Range Control to Optimize 1-Hop Broadcast Coverage in Dense Wireless Networks Xiaoyan Li, Thu D. Nguyen, Richard P. Martin Department of Computer Science, Rutgers University 110 Frelinghuysen Rd, Piscataway, NJ 08854... Date Added: 2009-04-21 00:34:03 |
| 213-Localization-2004.ppt Path: UCLA >> CS >> 213 Fall, 2008 Description: LOCALIZATION Distributed Embedded Systems CS 213/Estrin/Winter 2004 Speaker: Lewis Girod What is Localization A mechanism for discovering spatial relationships between objects 17 Feb 2004 CS 213: Localization Systems 2 Why is Localization Imp... Date Added: 2009-04-21 00:34:03 |
| 103t3s00.pdf Path: Manchester IN >> MATH >> 103 Fall, 2009 Description: MATH 103 - Test #3 - 4/28/00 Show all work for maximum credit. You may use the following formulas as needed. z = X- s 1. 2. m = z /2% & n n = (z /2m)2 The following histogram represents the number of hours that M.C. students spend studying in a ty... Date Added: 2009-04-21 00:34:18 |
| INFO.TXT Path: UCLA >> EARTH >> 0001 Fall, 2009 Description: Sheet1 PDS_VERSION_ID = PDS3 RECORD_TYPE = STREAM OBJECT = TEXT PUBLICATION_DATE = 2000-06-01 NOTE = \"INFO.TXT contains descriptive information relevant to the files in this directory.\" END_OBJECT = TEXT END This file contains a brief description of ... Date Added: 2009-04-21 00:36:33 |
| INFO.TXT Path: UCLA >> EARTH >> 2 Fall, 2009 Description: Sheet1 PDS_VERSION_ID = PDS3 RECORD_TYPE = STREAM OBJECT = TEXT PUBLICATION_DATE = 2000-06-01 NOTE = \"INFO.TXT contains descriptive information relevant to the files in this directory.\" END_OBJECT = TEXT END This file contains a brief description of ... Date Added: 2009-04-21 00:36:33 |
| History.pdf Path: UCLA >> ESS >> 7 Fall, 2009 Description: ESS 7 Lecture 2 September 29, 2008 A Little History Terrestrial Weather and Space Weather Space weather is interested in the space environment around the Earth all of the way to the Sun. Space physics is concerned with the physics of gases of char... Date Added: 2009-04-21 00:38:20 |
| L02_1pp.pdf Path: UCLA >> EE >> 233 Spring, 2009 Description: EE233C Lecture #2 The Wireless Channel: Impairments and Models Mani Srivastava mbs@ee.ucla.edu University of California at Los Angeles Electrical Engineering Department R E NIV SI T Y O F C A A LIF ORN EU L IG H T LE T H 1868 Copyright 20... Date Added: 2009-04-21 00:38:27 |
| 210-ListsAndIterators.pdf Path: Bowdoin >> CS >> 210 Fall, 2009 Description: csci 210: Data Structures Lists and Iterators Summary Topics Java Vector, ArrayList, Stack, LinkedList, Collections extendable arrays analysis Iterators READING: GT textbook chapter 6 (6.1 through 6.4) ArrayLists and Vectors classes provi... Date Added: 2009-04-21 00:40:42 |
| glspec15.pdf Path: Bowdoin >> CS >> 350 Spring, 2009 Description: The OpenGL Graphics System: A Specication (Version 1.5) Mark Segal Kurt Akeley Editor (version 1.1): Chris Frazier Editor (versions 1.2, 1.2.1, 1.3, 1.4, 1.5): Jon Leech R Copyright c 1992-2003 Silicon Graphics, Inc. This document contains unpubli... Date Added: 2009-04-21 00:40:54 |
| glspec15.pdf - Part 2 Path: Bowdoin >> CS >> 350 Spring, 2009 Description: . . . . . . . . . . . . . 3.8.11 Texture State and Proxy State . . . . . . . . . . . 3.8.12 Texture Objects . . . . . .... Date Added: 2009-04-21 00:40:54 |
| glspec15.pdf - Part 3 Path: Bowdoin >> CS >> 350 Spring, 2009 Description: ent Mode F.7 Texture Dot3 Environment Mode . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .... Date Added: 2009-04-21 00:40:54 |
| glspec15.pdf - Part 4 Path: Bowdoin >> CS >> 350 Spring, 2009 Description: (values per vertex) and data types . . . Variables that direct the execution of InterleavedArrays. Buffer object paramet... Date Added: 2009-04-21 00:40:54 |
| glspec15.pdf - Part 5 Path: Bowdoin >> CS >> 350 Spring, 2009 Description: ystem? OpenGL (for Open Graphics Library ) is a software interface to graphics hardware. The interface consists of... Date Added: 2009-04-21 00:40:54 |
| glspec15.pdf - Part 6 Path: Bowdoin >> CS >> 350 Spring, 2009 Description: ay maintain a number of GL contexts, each of which is an encapsulation of current GL state. A client may choose to conne... Date Added: 2009-04-21 00:40:54 |
| glspec15.pdf - Part 7 Path: Bowdoin >> CS >> 350 Spring, 2009 Description: en N is given by the digit 1, 2, 3, or 4 (if there is no digit, then the number of arguments is xed). If the nal c... Date Added: 2009-04-21 00:40:54 |
| glspec15.pdf - Part 8 Path: Bowdoin >> CS >> 350 Spring, 2009 Description: e a stack under ow Not enough memory left to execute command The speci ed table is too large Offending command ignor... Date Added: 2009-04-21 00:40:54 |
| glspec15.pdf - Part 9 Path: Bowdoin >> CS >> 350 Spring, 2009 Description: ument to Begin is LINES. In this case, the rst two vertices between a Version 1.5 - October 30, 2003 16 CHAPTER 2.... Date Added: 2009-04-21 00:40:54 |
| glspec15.pdf - Part 10 Path: Bowdoin >> CS >> 350 Spring, 2009 Description: s agged as boundary. If the bit is FALSE, then induced edges are agged as non-boundary. The state required for edg... Date Added: 2009-04-21 00:40:54 |
| glspec15.pdf - Part 11 Path: Bowdoin >> CS >> 350 Spring, 2009 Description: no state is devoted to vertex coordinates. The initial values of s, t, and r of the current texture coordinates are zero... Date Added: 2009-04-21 00:40:54 |
| glspec15.pdf - Part 12 Path: Bowdoin >> CS >> 350 Spring, 2009 Description: t ; i++) ArrayElement(f irst+ i); End(); } with one exception: the current edge ag, texture coordinates, color, color... Date Added: 2009-04-21 00:40:54 |
| glspec15.pdf - Part 13 Path: Bowdoin >> CS >> 350 Spring, 2009 Description: nder from such memory. The name space for buffer objects is the unsigned integers, with zero reserved for the GL. A buff... Date Added: 2009-04-21 00:40:54 |
| glspec15.pdf - Part 14 Path: Bowdoin >> CS >> 350 Spring, 2009 Description: ted. access is speci ed as one of READ ONLY, WRITE ONLY, or READ WRITE, indicating the operations that the client may... Date Added: 2009-04-21 00:40:54 |
| glspec15.pdf - Part 15 Path: Bowdoin >> CS >> 350 Spring, 2009 Description: cutive pairs of (x, y) coordinates, or two pointers to arrays each of which contains an x value followed by a y value. T... Date Added: 2009-04-21 00:40:54 |
| glspec15.pdf - Part 16 Path: Bowdoin >> CS >> 350 Spring, 2009 Description: HAPTER 2. OPENGL OPERATION gives an angle of rotation in degrees; the coordinates of a vector v are given by v = (x... Date Added: 2009-04-21 00:40:54 |
| glspec15.pdf - Part 17 Path: Bowdoin >> CS >> 350 Spring, 2009 Description: and the model-view matrix uniformly scales space, then rescale makes the transformed normals unit length. Alternatively,... Date Added: 2009-04-21 00:40:54 |
| glspec15.pdf - Part 18 Path: Bowdoin >> CS >> 350 Spring, 2009 Description: where i is an integer between 0 and n 1, indicating one of n client-de ned clip planes. eqn is an array of four do... Date Added: 2009-04-21 00:40:54 |
| glspec15.pdf - Part 19 Path: Bowdoin >> CS >> 350 Spring, 2009 Description: osition Current Normal Current Color & Materials Lighting Raster Distance Current Texture Coord Set 0 Texgen Text... Date Added: 2009-04-21 00:40:54 |
| glspec15.pdf - Part 20 Path: Bowdoin >> CS >> 350 Spring, 2009 Description: s speci ed that is outside the range given for that parameter in the table. There are n light sources, indexed by i =... Date Added: 2009-04-21 00:40:54 |
| glspec15.pdf - Part 21 Path: Bowdoin >> CS >> 350 Spring, 2009 Description: num pname, T param ); Material{if}v( enum face, enum pname, T params ); Light{if}( enum light, enum pname, T param ); Li... Date Added: 2009-04-21 00:40:54 |
| glspec15.pdf - Part 22 Path: Bowdoin >> CS >> 350 Spring, 2009 Description: ighting and COLOR MATERIAL are disabled. 2.14.5 Color Index Lighting A simpli ed lighting computation applies in co... Date Added: 2009-04-21 00:40:54 |
| glspec15.pdf - Part 23 Path: Bowdoin >> CS >> 350 Spring, 2009 Description: to determine which squares of an integer grid in window coordinates are occupied by the primitive. The second is assigni... Date Added: 2009-04-21 00:40:54 |
| glspec15.pdf - Part 24 Path: Bowdoin >> CS >> 350 Spring, 2009 Description: imitives is changed, and is referred to as multisample rasterization. Otherwise, primitive rasterization is referred to... Date Added: 2009-04-21 00:40:54 |
| glspec15.pdf - Part 25 Path: Bowdoin >> CS >> 350 Spring, 2009 Description: ment centers are the half-integer window coordinate values within the square of the even width centered on (x, y). See... Date Added: 2009-04-21 00:40:54 |
| glspec15.pdf - Part 26 Path: Bowdoin >> CS >> 350 Spring, 2009 Description: orithm). Because the initial and nal conditions of the diamond-exit rule may be dif cult to implement, other line s... Date Added: 2009-04-21 00:40:54 |
| glspec15.pdf - Part 27 Path: Bowdoin >> CS >> 350 Spring, 2009 Description: nded to the nearest integer (if w = 0, then it is as if w = 1). If the line segment has endpoints given by (x0 , y0 ) an... Date Added: 2009-04-21 00:40:54 |
| glspec15.pdf - Part 28 Path: Bowdoin >> CS >> 350 Spring, 2009 Description: ng the possible reversal of this sign as indicated by the last call to FrontFace). If this sign is positive, the polygon... Date Added: 2009-04-21 00:40:54 |
| glspec15.pdf - Part 29 Path: Bowdoin >> CS >> 350 Spring, 2009 Description: f a polygon to be treated, for rasterization purposes, just as if they were enclosed within a Begin(POINT) and End pair.... Date Added: 2009-04-21 00:40:54 |
| glspec15.pdf - Part 30 Path: Bowdoin >> CS >> 350 Spring, 2009 Description: ). These parameters are set with three commands: PixelStore, PixelTransfer, and PixelMap. 3.6.1 Pixel Storage Modes P... Date Added: 2009-04-21 00:40:54 |
| glspec15.pdf - Part 31 Path: Bowdoin >> CS >> 350 Spring, 2009 Description: or less than one, is given to PixelMap. Color Table Speci cation Color lookup tables are speci ed with void ColorTab... Date Added: 2009-04-21 00:40:54 |
| glspec15.pdf - Part 32 Path: Bowdoin >> CS >> 350 Spring, 2009 Description: to the color lookup tables, partially instantiated proxy color lookup tables are maintained. Each proxy table includes w... Date Added: 2009-04-21 00:40:54 |
| glspec15.pdf - Part 33 Path: Bowdoin >> CS >> 350 Spring, 2009 Description: by CONVOLUTION FILTER SCALE. Parameters target, internalformat, width, and height are speci ed using the same values,... Date Added: 2009-04-21 00:40:54 |
| glspec15.pdf - Part 34 Path: Bowdoin >> CS >> 350 Spring, 2009 Description: in gure 3.7. We describe the stages of this process in the order in which they occur. Pixels are drawn using void Dra... Date Added: 2009-04-21 00:40:54 |
| glspec15.pdf - Part 35 Path: Bowdoin >> CS >> 350 Spring, 2009 Description: one of COLOR INDEX, STENCIL INDEX, or DEPTH COMPONENT, then the error INVALID OPERATION occurs. If type is BITMAP and fo... Date Added: 2009-04-21 00:40:54 |
| glspec15.pdf - Part 36 Path: Bowdoin >> CS >> 350 Spring, 2009 Description: 09 UNSIGNED SHORT 5 6 5: 15 14 13 12 11 10 9 8 2nd 7 6 5 4 3 2 3rd 1 0 1st Component UNSIGNED SHORT 5 6 5 REV: 15 14... Date Added: 2009-04-21 00:40:54 |
| glspec15.pdf - Part 37 Path: Bowdoin >> CS >> 350 Spring, 2009 Description: oth cases, the fog coordinate is taken from the current raster position s associated raster distance, and texture coor... Date Added: 2009-04-21 00:40:54 |
| glspec15.pdf - Part 38 Path: Bowdoin >> CS >> 350 Spring, 2009 Description: one of ve formats, with 1, 2, 3, or 4 components. These components are denoted as Rf , Gf , Bf , Af , Lf , and If in... Date Added: 2009-04-21 00:40:54 |
|
|
Get Started With Course Hero Today!
Get study guides, join study groups, and more!
Sign up in seconds with your Facebook account!
Course Hero is a Facebook Application Partner.
Click below to sign-up for FREE.
Our Social Learning Network was built to provide students and key learning partners like professors a platform to share, meet and collaborate while accelerating their comprehension of course-related theories and concepts. We are committed to providing you immediate access to a growing wealth of study materials and an unparalleled academic network of students, professors and other key partners. Why do you care? Because you want the best grade possible and at times need a 24/7 resource that’s responsive to your needs. |
|
What People Are Saying About Course Hero
|
|||
|
|||
|
Explore the benefits of joining Course Hero's social learning network.
|
|||
![]() |
Get millions of study materials now!Need lecture notes for a missed class or want insightful explanation of the theories and concepts you learn in class? Look no further, Course Hero’s Study Materials empowers you to find a broad and deep set of materials that can help you right now!
Click below to sign-up for FREE.
|
||
![]() |
Get over 200,000 textbook solutions now!Having difficulty with your homework and need documents that are relevant for your Textbook? Don't be frustrated. Course Hero's Textbook Help presents you study materials from many college courses.
Click below to sign-up for FREE.
|
||
![]() |
Meet over 300,000 students and your fellow classmates now!Want to meet your current classmates or those that took the class last year? Don’t worry or have anxiety. Course Hero’s Study Groups gives you the seamless opportunity to develop both anonymous or direct relationships with those classmates whom you want to meet and get help from right now!
Click below to sign-up for FREE.
|
||


