Course Solutions And Notes - DC2_J1659m4209Log 41
| log.txt Path: Washington >> V >> 11929 Fall, 2009 Description: 000 (26474.000.000) 12/03 13:19:58 Job submitted from host: <128.95.94.28:4757> . 001 (26474.000.000) 12/03 19:07:29 Job executing on host: <172.25.101.166:1062> . 006 (26474.000.000) 12/03 19:27:37 Image size of job updated: 459068 . 005 (26474.000.... Date Added: 2009-06-16 17:54:03 |
| solarfacts.pdf Path: UVA >> ASTR >> 124 Summer, 2008 Description: ... Date Added: 2009-06-16 17:54:21 |
| Week 9 Errata.pdf Path: Redlands >> PHYS >> 310 Fall, 2009 Description: Errata for the Reading: p. 349: In the description of the successive-approximation ADC, the output of the DAC should be compared to the analog input (not the reference voltage for the DAC). p. 350: In Table 14.5, the rightmost column should be labele... Date Added: 2009-06-16 17:56:59 |
| Bucket_out_dryrun.txt Path: Western Washington >> CSCI >> 241 Fall, 2008 Description: I 0.000000611 I 0.000000531 I 0.000000522 I 0.000000527 I 0.000000529 I 0.000000527 I 0.000000519 I 0.000000521 I 0.000000524 I 0.000000526 I 0.000000519 I 0.000000522 I 0.000000519 I 0.000000521 I 0.000000523 I 0.000000519 I 0.00000... Date Added: 2009-06-16 17:57:22 |
| labels-level.doc Path: UT Chattanooga >> ENGR >> 435 Fall, 2009 Description: vti_encoding:SR|utf8-nl vti_timelastmodified:TR|05 Aug 1998 17:29:21 -0000 vti_extenderversion:SR|5.0.2.6738 vti_cacheddtm:TX|05 Aug 1998 17:29:21 -0000 vti_filesize:IR|19456 vti_cachedtitle:SR|Solenoid Valve Control Relays vti_title:SR|Solenoid Valv... Date Added: 2009-06-16 17:59:21 |
| xrt.txt Path: Berkeley >> ASTRO >> 00295779 Fall, 2009 Description: 3528.64 90337.5 0.0016386 0.000273346 ... Date Added: 2009-06-16 18:01:30 |
| lect5.ppt Path: Duke >> X >> 001 Fall, 2009 Description: vti_encoding:SR|utf8-nl vti_timelastmodified:TR|16 Sep 2001 02:52:30 -0000 vti_extenderversion:SR|4.0.2.3406 vti_filesize:IR|38400 vti_title:SR|Designing Classes and Programs vti_backlinkinfo:VX| vti_cacheddtm:TX|16 Sep 2001 02:52:30 -0000 vti_cached... Date Added: 2009-06-16 18:01:50 |
| 7-11-07.pdf Path: UCSC >> CMPS >> 201 Fall, 2008 Description: ... Date Added: 2009-06-16 18:03:33 |
| InductionProofs.doc Path: UCSC >> CMPS >> 101 Spring, 2008 Description: CMPS 101 Algorithms and Abstract Data Types Induction Proofs Let P (n) be a propositional function, i.e. P is a function whose domain is (some subset of) the set of integers and whose codomain is the set {True, False}. Informally, this means P (n) i... Date Added: 2009-06-16 18:03:37 |
| Maturity Request.doc Path: Penn State >> JMS >> 5860 Fall, 2009 Description: Request For A New Application Date Submitted: 4-17-08 Submitted by: Jillian Snoznik Purpose: Aid the user in determining how much they would like to invest. Application Title: Algorithms: Maturity Calculator Maturity Value = Investment * (1 + Interes... Date Added: 2009-06-16 18:04:04 |
| chapter5.pdf Path: Colorado State >> AT >> 540 Fall, 2009 Description: Chapter 5 Cloud Types 5.1 Classification 5.2 Basic cloud types 5.3 Other cloud types and features 5.4 Use in the interpretation of local weather 5.5 Stability and cloud types 5.1 Classification Recognition of cloud type is useful indicator of the... Date Added: 2009-06-16 18:05:27 |
| day29.pdf Path: Cal Poly >> STAT >> 301 Fall, 2009 Description: STAT 301 Winter 2009 Day 29: Randomization Tests for Quantitative Response Example: Age Discrimination? Robert Martin turned 55 in 1991. Earlier in that same year, the Westvaco Corporation, which makes paper products, decided to downsize. They ende... Date Added: 2009-06-16 18:06:47 |
| Quiz Solutions - Ch 9 and 10.doc Path: Tulane >> BREESE >> 654 Fall, 2009 Description: Solutions to Quiz Problems Chapters 9 and 10 1. X = (.11 + .06 - .08 + .28 + .13) = .1 = 10% 5 Y = (.36 - .07 + .21 - .12 + .43) = .1620 = 16.2% 5 sX2 = (.11 - .1)2 + (.06 - .1)2 + (-.08 - .1)2 + (.28 - .1)2 + (.13 - .1)2 = .01685 5-1 sY2 = (.36 - .... Date Added: 2009-06-16 18:07:24 |
| 267t2m.pdf Path: ASU >> M >> 267 Fall, 2009 Description: Test 2 and quiz 3 Mat 267 Summer 2008 Quiz 3 1. Find the domain of f ( x, y ) = 2. Evaluate ( x , y ) (0,0) Students name: Awad Abdullazzez, ASU ID 1000898190 x + y +1 x- y 2 2 2 lim ( x + y ) ln( x + y 2 ) 2 3. Given M = xe y - z , x = 2uv, y = ... Date Added: 2009-06-16 18:08:11 |
| METRO_FORECAST MM.doc Path: Penn State >> MDM >> 5005 Fall, 2009 Description: WASHINGTON FORECAST MM THURSDAY . Thickening Clouds High 52. After a sunny start, clouds will thicken across the area as a strong disturbance approaches from the Midwest. Showers may reach the western suburbs by evening. Winds will be light. TONIGHT ... Date Added: 2009-06-16 18:09:32 |
| q7sol.nb.pdf Path: Hudson VCC >> MATH >> 121 Fall, 2009 Description: Math 121 B Quiz # 7 Solutions 1) average value 2) (a) 3 x2 2 y 1 0 x 12 R f x,y R A R 60 A R A A 3 3 x 1 60 12 5. So answer is E. x4 x 3 4 x 1 81 1 4 y x 3 y2 y x2 1 x y 0 x 3 x4 0 1 x x x 20. 8 6 4 2 0.5 1.0 1.5 2.0 2.5 3.0... Date Added: 2009-06-16 18:11:29 |
| homework_2.doc Path: ASU >> CSE >> 591 Fall, 2008 Description: Wireless Networks Homework #2: Date Assigned: 9/28/2004 Due Date: 10/4/2004 Part A. (CSE 591) Solve the following Chapter 5 problems from the textbook (Stallings\' book). 5.2, 5.4, 5.5, 5.7, 5.10, and 5.12. Note 1: The effective area of half-wave di... Date Added: 2009-06-16 18:11:38 |
| homework_2.doc Path: ASU >> CSE >> 423 Spring, 2008 Description: Wireless Networks Homework #2: Date Assigned: 9/28/2004 Due Date: 10/4/2004 Part A. (CSE 591) Solve the following Chapter 5 problems from the textbook (Stallings\' book). 5.2, 5.4, 5.5, 5.7, 5.10, and 5.12. Note 1: The effective area of half-wave di... Date Added: 2009-06-16 18:11:41 |
| Proteinase K.pdf Path: CofC >> RM >> 209 Fall, 2009 Description: SIGMA-ALDRICH Material Safety Data Sheet Version 3.1 Revision Date 11/03/2007 Print Date 11/13/2007 1. PRODUCT AND COMPANY IDENTIFICATION Product name Product Number Brand Company : : : : Proteinase K P5056 Sigma-Aldrich Sigma-Aldrich 3050 Spruce S... Date Added: 2009-06-16 18:13:12 |
| P142_110107.pdf Path: Rochester >> P >> 142 Fall, 2009 Description: ... Date Added: 2009-06-16 18:13:16 |
| ResolutionWhatisit.pdf Path: Santa Barbara City >> USERS >> 111 Fall, 2009 Description: Res ol u ti o n: what is it? When preparing images for print, one of the most important and probably the most difficult concept to grasp for the new designer is resolution. Simply put, resolution is the amount of information that makes up an image, t... Date Added: 2009-06-16 18:13:19 |
| hwk3pt1.pdf Path: UNC Charlotte >> COE >> 1202 Fall, 2009 Description: PROBLEMS the of 2/1 Calculat-e e- and y-eomponents tle force P acting on the sttuctural memberif the magnitudeof the force i. P l4f, L .a _ t = p x tL-L= ?5 2/3 When ttre load L is 7 m from the pivot at C, the tensionT in the cable has a magnitude ... Date Added: 2009-06-16 18:13:25 |
| Homework3.pdf Path: Allan Hancock College >> CSCI >> 319 Fall, 2009 Description: Week 3 (4 tasks) Task 1: Propose an algorithm which finds the shortest path from a given peer to the peer which hosts a requested resource in a CAN. Task 2: Explain how partial views are propagated in an unstructured P2P system. How much redundancy ... Date Added: 2009-06-16 18:15:12 |
| puccinibio.txt Path: Cal Poly Pomona >> CIS >> 311 Fall, 2009 Description: Giacomo Puccini (1858 - 1924) = Giacomo Puccini was born on December 22, 1858, to a family of church musicians in Lucca. He first studied with his uncle at the Instituto Pacini in Lucca, but a performance of Verdi\'s \"Aida\" brought forth a love for ... Date Added: 2009-06-16 18:15:14 |
| a2.pdf Path: Toledo >> DGP >> 180 Fall, 2009 Description: CSC 180F Assignment 2 due October 13, 2000, at 9:00 a.m.; no late assignments without written explanation. Prime numbers A factor of an integer is a number which divides it evenly. So d is a factor of p exactly when p%d = 0 (recall the remainder oper... Date Added: 2009-06-16 18:15:34 |
| Paired with Lecture 20 - E3.ppt Path: Washington >> MSE >> 170 Fall, 2008 Description: Fracture This is BIG topic Underlines all of Failure Analysis One of the big fields that metallurgists/ material scientists get involved in There are several fields that are specific to fracture including: Fracture mechanics calculation of frac... Date Added: 2009-06-16 18:16:50 |
| lecture.ps Path: Allan Hancock College >> COMP >> 284 Fall, 2009 Description: %!PS-Adobe-2.0 %Creator: dvips(k) 5.92b Copyright 2002 Radical Eye Software %Title: slides.dvi %Pages: 57 %PageOrder: Ascend %Orientation: Landscape %BoundingBox: 0 0 596 842 %DocumentFonts: CMBX12 CMR12 CMR5 CMR10 CMTI10 CMBX9 CMSY10 CMBX10 %+ CMTI1... Date Added: 2009-06-16 18:17:43 |
| Homework-13-Phase4Testing.pdf Path: BYU >> CS >> 340 Fall, 2009 Description: Homework 13 Phase 4 Testing Do a black-box, system test of another teams Phase 4 Test Tracker implementation. Download the implementation assigned to you. Try to find as many bugs as you can and write a report describing the bugs you find. Each bug ... Date Added: 2009-06-16 18:18:07 |
| hacking.ppt Path: Santa Clara >> COEN >> 350 Fall, 2009 Description: COEN 252 Security Threats Network Based Exploits Phases of an Attack Reconnaissance Scanning Gaining Access Expanding Access Covering Tracks Reconnaissance Social Engineering Search the Web \"I cannot access my email. What... Date Added: 2009-06-16 18:19:02 |
| submit.txt Path: Washington >> V >> 26500 Fall, 2009 Description: executable = allgamma_26711.bat universe = vanilla error = error.txt output = output.txt log = log.txt # set by submitting script Requirements= (OpSys = \"WINNT51\" ) initialdir = F:\\condor\\allgamma\\v13r5p8\\jobs26500-26999/... Date Added: 2009-06-16 18:19:40 |
| log.txt Path: Washington >> V >> 26500 Fall, 2009 Description: 000 (38476.000.000) 12/26 07:42:11 Job submitted from host: <128.95.94.28:1084> . 001 (38476.000.000) 12/26 08:22:19 Job executing on host: <172.25.101.164:1059> . 006 (38476.000.000) 12/26 08:42:27 Image size of job updated: 388676 . 005 (38476.000.... Date Added: 2009-06-16 18:19:56 |
| submit.txt Path: Washington >> V >> 26500 Fall, 2009 Description: executable = allgamma_26869.bat universe = vanilla error = error.txt output = output.txt log = log.txt # set by submitting script Requirements= (OpSys = \"WINNT51\" ) initialdir = F:\\condor\\allgamma\\v13r5p8\\jobs26500-26999/... Date Added: 2009-06-16 18:20:43 |
| submit.txt Path: Washington >> V >> 26500 Fall, 2009 Description: executable = allgamma_26944.bat universe = vanilla error = error.txt output = output.txt log = log.txt # set by submitting script Requirements= (OpSys = \"WINNT51\" ) initialdir = F:\\condor\\allgamma\\v13r5p8\\jobs26500-26999/... Date Added: 2009-06-16 18:21:07 |
| log.txt Path: Washington >> V >> 26500 Fall, 2009 Description: 000 (38515.000.000) 12/26 07:42:17 Job submitted from host: <128.95.94.28:1084> . 001 (38515.000.000) 12/26 08:41:02 Job executing on host: <172.25.101.93:1057> . 006 (38515.000.000) 12/26 09:01:10 Image size of job updated: 459032 . 005 (38515.000.0... Date Added: 2009-06-16 18:21:13 |
| output.txt Path: Washington >> V >> 26500 Fall, 2009 Description: = running on = COMPUTERNAME=PHYSLAB-50WSNB1 - local directory - Volume in drive C has no label. Volume Serial Number is 9843-D647 Directory of C:\\condor\\execute\\dir_3260 12/26/2007 12:03 PM <DIR> . 12/26/2007 12:03 ... Date Added: 2009-06-16 18:22:54 |
| submit.txt Path: Washington >> V >> 26500 Fall, 2009 Description: executable = allgamma_26978.bat universe = vanilla error = error.txt output = output.txt log = log.txt # set by submitting script Requirements= (OpSys = \"WINNT51\" ) initialdir = F:\\condor\\allgamma\\v13r5p8\\jobs26500-26999/... Date Added: 2009-06-16 18:23:02 |
| output.txt Path: Washington >> V >> 26500 Fall, 2009 Description: = running on = COMPUTERNAME=B280WS2 - local directory - Volume in drive C has no label. Volume Serial Number is EE42-0B89 Directory of C:\\condor\\execute\\dir_2328 12/26/2007 08:40 AM <DIR> . 12/26/2007 08:40 AM <D... Date Added: 2009-06-16 18:23:10 |
| 102.7.4 Abbreviated Truth Tables.pdf Path: Western Washington >> PHIL >> 102 Fall, 2008 Description: ABBREVIATED TRUTH TABLES The gut idea for showing invalidity: if there is one row in which all the premises are true and the conclusion is false, then the argument is invalid. The gut idea for showing validity: if each assignment that makes the concl... Date Added: 2009-06-16 18:24:12 |
| Exam_3_PRACTICE_and_KEY_4-06.pdf Path: UCF >> BUS >> 3411 Fall, 2009 Description: REMINDER FOR EACH EXAM: A few students have been using electronic devices to cheat during exams. This is very unfair to the vast majority of honest students. In order to keep those few from gaining an unfair advantage, the following rule must be obey... Date Added: 2009-06-16 18:24:13 |
| FoundationsCh1Sect3.pdf Path: Willamette >> FOUNDATION >> 251 Fall, 2008 Description: HINTS & SOLUTIONS TO SELECTED PROBLEMS FROM SECTION 1.3 Note: The following are brief solutions or proofs for selected problems. Remember, the answer is the least important part. It\'s understanding how to get the answer and how to explain your proce... Date Added: 2009-06-16 18:25:47 |
| 7 Mulvey.doc Path: UMBC >> ENGL >> 401 Fall, 2008 Description: Jeeves Murphy English 401 6/7/2009 #7 Examine another film using Mulvey\'s terminology and \"scopophilia\" and \"voyeurism\" in particular. How does the film either support or refute Mulvey\'s claims? You might consider choosing another film that IS NOT th... Date Added: 2009-06-16 18:25:54 |
| hw5.pdf Path: Delaware >> PHYS >> 333 Fall, 2008 Description: PHYS-333: Problem set #5 Please write neatly and show your work. Unless stated otherwise, answers correct to two decimal places will receive full credit, and so you should be able to do most computations by hand. Also, big magnitude answers should be... Date Added: 2009-06-16 18:26:38 |
| tablea-01-c.xls Path: Cornell >> ERS >> 89022 Fall, 2009 Description: Table A-1-U.S. per capita use of selected, commercially produced, fresh, and processing fruits and tree nuts, 1976 to date1/-Continued Crop 1996 1997 1998 1999 2000 2001 - Pounds, farm-weight -Apples, all Fresh Canning Freezing Juice Dried Other proc... Date Added: 2009-06-16 18:26:58 |
| 2009-02-18-a.ppt Path: Duke >> ECON >> 201 Spring, 2009 Description: Formulating a Research Topic Abhinay Sawant February 18, 2009 Economics 201FS Update from Last Time Fixed programs: Z-Scores Tri-Power Quarticity Realized Volatility Signature Plots Still Coarse Sampling: Currently, sampling frequency = ... Date Added: 2009-06-16 18:29:03 |
| Gradebookpdf.pdf Path: Auburn >> ZMT >> 0002 Fall, 2009 Description: ZacharyM.Thornton EDMD3300 Section2 Homework 5 5 5 Gradebook ExpressionWeb MovieMaker 5 5 5 5 5 5 3 4 5 5 4 3 Student Thornton,Zachary Mayer,John Jordan,Steve Palladino,Pino 5 5 5 Resume Floorplan Philosophy 4 5 1 5 5 5 5 5 4 4 3 2 30 Total 25 30 ... Date Added: 2009-06-16 18:31:57 |
| Joseph_Cate.doc Path: Mississippi State >> ECE >> 4542 Fall, 2009 Description: vti_encoding:SR|utf8-nl vti_timelastmodified:TR|15 Apr 2005 01:39:24 -0000 vti_extenderversion:SR|5.0.2.2623 vti_backlinkinfo:VX|team_2.htm vti_author:SR|MONALISA\\Allison vti_modifiedby:SR|MONALISA\\Allison vti_timecreated:TR|22 Sep 2004 22:35:00 -000... Date Added: 2009-06-16 18:34:21 |
| hw5_s01.pdf Path: U. Houston >> ECE >> 3317 Fall, 2008 Description: ECE 3317 Spring 2001 Homework No. 5 Due March 1, 2001 Problem 4.1 Problem 4.2 Problem 4.3 Problem 4.4 Problem 4.5 ... Date Added: 2009-06-16 18:35:03 |
| Lecture13.ppt Path: Canisius >> CSC >> 107 Fall, 2009 Description: CSC 107 Programming for Science Lecture 13: for Loops Todays Goal After today, should know how to use for loops and when they are best used while Loop while (expression) { statement; . } Evaluates the boolean expression If true, execute entire ... Date Added: 2009-06-16 18:35:38 |
| RevF_116.doc Path: Embry-Riddle FL/AZ >> SC >> 135 Fall, 2009 Description: RTCA SC-135 and EUROCAE WG-14 Change Proposal Form (One major comment per form. Shaded blocks for committee use only.) SC-135/WG-14 Paper Number: Date: 9/26/2006 DO-160E Section: Rev F #116 8, Vibration Author\'s Name, Affiliation, and E-mail: Paragra... Date Added: 2009-06-16 18:36:31 |
| Effective Communication.ppt Path: Auburn >> ELEC >> 4000 Fall, 2008 Description: vti_encoding:SR|utf8-nl vti_timelastmodified:TR|25 Jan 2006 21:01:48 -0000 vti_extenderversion:SR|5.0.2.6738 vti_backlinkinfo:VX| ... Date Added: 2009-06-16 18:37:08 |
| Math 121 Chapter6 Section2 Handout.doc Path: University of South Dakota >> MATH >> 121 Fall, 2008 Description: Chapter 6, Section 2 Handout Many of the indefinite integral formulas introduced in the preceding section are based on corresponding derivative formulas studied earlier. We now consider indefinite integral formulas and procedures based on the chain r... Date Added: 2009-06-16 18:37:14 |
| hw5s.ps Path: California State University, Monterey Bay >> CS >> 420 Fall, 2009 Description: %!PS-Adobe-2.0 %Creator: dvipsk 5.66a Copyright 1986-97 Radical Eye Software (www.radicaleye.com) %Title: hw5s.dvi %Pages: 7 %PageOrder: Ascend %BoundingBox: 0 0 612 792 %EndComments %DVIPSCommandLine: dvips -o hw5s.ps hw5s.dvi %DVIPSParameters: dpi=... Date Added: 2009-06-16 18:37:49 |
| Model4Treat3RepsF08.xls Path: Allegheny >> FSBIO >> 201 Fall, 2009 Description: 7 6 Effective Number of Species 5 4 3 2 1 0 INOC Treatment1 Treatment2 Treatment3 Treatment4 Treatment 100 80 60 DCA Axis 2 40 20 0 -20 -40 -40 -20 0 20 40 60 80 100 DCA Axis 1 140 120 100 0 Treatment1 Treatment2 Treatmen... Date Added: 2009-06-16 18:38:38 |
| 06_indecency_pornography.pdf Path: Norwich >> CJ >> 341 Fall, 2009 Description: CJ341 Class Notes Indecency Cybercrime Lecture #6 M. E. Kabay, PhD, CISSP-ISSMP mailto:mkabay@norwich.edu V: 802.479.7937 Program Director, MSIA, School of Graduate Studies Topics Freedom of Speech First Amendm... Date Added: 2009-06-16 18:40:02 |
| 460ps1.pdf Path: Illinois State >> CHE >> 460 Fall, 2009 Description: Chemistry 460 Spring 2009 Dr. Jean M. Standard January 14, 2009 Problem Set 1 1. ^ ^ The translation operator, T h , is defined by the rule: T h f (x) = f (x + h) , where h represents the distance of translation. ^ a.) Show whether or not T h is a l... Date Added: 2009-06-16 18:41:48 |
| Answers to worksheet 1.doc Path: East Los Angeles College >> LEVEL >> 0809 Fall, 2009 Description: Answers to worksheet 1 Introduction to personality and individual differences 1. The main approaches to personality are psychodynamic, biological, Trait approaches, Learning theories, cognitive and socio cognitive, humanistic/existential and interact... Date Added: 2009-06-16 18:43:01 |
| HW Chapter 12 Solution Set.doc Path: VMI >> CH >> 132 Fall, 2009 Description: HW Chapter 12 Solution Set 1. How does the ozone layer protect the inhabitants of Earth\'s surface? It helps filter out harmful UV radiation. 2. What is an atmospheric (thermal) inversion? How is it related to air pollution? Warm air is normally found... Date Added: 2009-06-16 18:43:11 |
| workPlanYanMa&YangLiu.doc Path: Utah State >> INST >> 5245 Fall, 2008 Description: <?xml version=\"1.0\" encoding=\"UTF-8\"?> <Error><Code>NoSuchKey</Code><Message>The specified key does not exist.</Message><Key>41db8b7e2d04ad989517f4739ae9400c163fe01a.doc</Key><RequestId>2 40A453F3CFFCB7A</RequestId><HostId>RfS/IPnSgcEhPUEzfVgxpl8Nixj... Date Added: 2009-06-16 18:43:28 |
| Indexing.ppt Path: CSU Channel Islands >> CS >> 222 Fall, 2009 Description: ICS 222: Principles of Data Management Indexing 1 Roadmap Access plan optimizer SQL statements Query Processor Indices Read write records, scan relations Get page containing tuples Buffer manager We are here! Record-oriented file system Basic f... Date Added: 2009-06-16 18:43:37 |
| Questions for Friday Sept 15th.doc Path: Arizona >> BIOC >> 462 Fall, 2008 Description: For Friday Sept 15th, Pannifer et al. (2001) \"Crystal structure of the anthrax lethal factor\" Nature, 414, 229-233 Please answer the written questions with a complete sentence. 1) What primary kinds of interactions are seen between domain I and domai... Date Added: 2009-06-16 18:44:27 |
| earnedValue.ppt Path: Harvey Mudd College >> CS >> 121 Fall, 2000 Description: Tracking How We areWeDoing ll Earne d-ValueTracking Me thod/C hart q Oneway to track how closeto \"done theproje is: \" ct q As ke parts of a product arecompleted, the product y \"earns value\". Express earned value in % of total value or $ (= % x bud... Date Added: 2009-06-16 18:44:31 |
| leininger miller education of modernist part 2.pdf Path: Delaware >> ARTH >> 231 Fall, 2008 Description: ... Date Added: 2009-06-16 18:45:18 |
| Partner Evaluation - max 5 members.doc Path: UMBC >> HMGT >> 182 Fall, 2009 Description: Partner Evaluation HMGT 182 Bev Ops Partner 1 Name Partner 2 Name Partner 3 Name Partner 4 Name Your Name _ Partner Names _ _ _ _ / 8 _ _/8 _ / 8 _ / 8 Availabilty The group member was able to make and attend group meetings when they were r... Date Added: 2009-06-16 18:46:02 |
| Payroll.ppt Path: North Texas >> PPT >> 2610 Fall, 2009 Description: Payroll Partners Sara Ostergaard Overview Twelve-year-old company Proven niche in the region Proprietary software for transmitting payroll information Proven track record of profitability Client base of 740 companies Our Company Niche Our Sof... Date Added: 2009-06-16 18:46:46 |
| T0383.t06.bys-logo.pdf Path: UCSC >> T >> 0383 Fall, 2009 Description: T0383.t06 bys 4 3 2 1 H X EP PN PE Y E H H X XXXXXXX H G E E H EPE EP P E H H N EP P P H P P E H H H N HPGDCXXX HPXXHHDXHXXLXPXXHXLHXHPYNXNHE L Y H H H H E X X X X X XH X X X X X H X HH E H G P N D X H E H X X GLP EPEPE E E HS EP X TP 3... Date Added: 2009-06-16 18:48:40 |
| READ FIRST.txt Path: St. Norbert >> CS >> 460 Fall, 2009 Description: These programs are NOT well documented because my final program contains all code from previous versions. The code that was a break through in these programs is all well documented in my final version. I saw no need to document the same code twice... Date Added: 2009-06-16 18:51:19 |
| Freebsd Install Guide.txt Path: Wisc Whitewater >> ITBE >> 452 Fall, 2008 Description: A step-by-step guide to installing FreeBSD 5. It assumes moderate experience with linux and leaves you with a fully updated FreeBSD system. FreeBSD Installation A. 5.x vs 4.x The first thing to understand about FreeBSD is that there are two line... Date Added: 2009-06-16 18:56:03 |
| SeptHighs.xls Path: Trinity U >> CS >> 1300 Fall, 2009 Description: High Temperatures for September 1885-2002 Year 1 2 1885 90 84 1886 88 90 1887 88 90 1888 88 84 1889 90 83 1890 90 89 1891 94 94 1892 90 88 1893 91 90 1894 90 89 1895 90 91 1896 93 93 1897 91 89 1898 90 90 1899 87 85 1900 90 92 1901 95 95 1902 96 90 1... Date Added: 2009-06-16 18:56:28 |
| icq.txt Path: Wisc Whitewater >> ITBE >> 452 Fall, 2008 Description: The ICQ Security Tutorial / Written by R a v e N (blacksun.box.sk) <=> 13/7/2000, version 1.9 Author\'s notes: I\'m getting tired of repeating myself*, so please read my previous tutorials (located at http:/blacksun.box.sk). Otherwise, you might not un... Date Added: 2009-06-16 18:57:24 |
| standing2.txt Path: Wisconsin >> HOMEPAGES >> 1990 Fall, 2009 Description: Other Divisions Football Conference Standings as of 01/01/1991 Perfomance Ratings are from David Wilson\'s system ... Date Added: 2009-06-16 18:58:56 |
| Base02a_IMPROVE_Statistics.txt Path: UC Riverside >> MAY >> 308 Fall, 2009 Description: AllSite_AllDay SO4 NO3 NH4d OC EC TCM SOIL CM PM25 RCFM PM10 Fraction... Date Added: 2009-06-16 18:59:27 |
| handout26_113005.doc Path: Berkeley >> MCB >> 160 Fall, 2008 Description: ... Date Added: 2009-06-16 19:00:08 |
| jan14.pdf Path: Virginia Tech >> MATH >> 5126 Spring, 2008 Description: Math 5126 Monday, January 14 January 14, Ungraded Homework Prove that Z[ -5] is a Noetherian ring. Z[ -5] is the subring of C generated by Z and -5, and we have seen before that this is precisely Z + Z -5. Thus Z[ -5] is generated by 1 and -5... Date Added: 2009-06-16 19:03:51 |
| K 7. ..pdf Path: Minnesota >> SMITH >> 097 Fall, 2009 Description: K 7. LIFE AND CIVILIZATION AS PROBLEMS 12/93 The most important fact about human life, a fact that should be obvious but that it often takes individuals and groups too long to discover, is that the quality of human life depends primarily upon the q... Date Added: 2009-06-16 19:05:05 |
| Assignment-1.pdf Path: TCNJ >> ELEM >> 690 Spring, 2008 Description: ... Date Added: 2009-06-16 19:07:14 |
| Ida J. Orlando gabrielle dionne ppt.ppt Path: Neumont >> SINF >> 3023 Fall, 2009 Description: Thorie du processus infirmier Historique La thorie du processus infirmier Les 4 grands concepts Les sousconcepts 9 points importants de la thorie Les auteurs de rfrences de la thorie Les limites de la thorie Notre oeuvre d\'art Ne le 12 aot 1926 Ne... Date Added: 2009-06-16 19:07:29 |
| sevcikAim2005.pdf Path: RIT >> P >> 06007 Fall, 2009 Description: Proceedings of the 2005 IEEE/ASME International Conference on Advanced Intelligent Mechatronics Monterey, California, USA, 24-28 July, 2005 TB1-03 Exploring Search-And-Rescue in Near-Earth Environments for Aerial Robots Keith W. Sevcik, William E. ... Date Added: 2009-06-16 19:09:19 |
| Feasibility Assessment.xls Path: RIT >> P >> 06007 Fall, 2009 Description: Attribute 1a. Skills 1b. Experience 1c. Man Hours 1d. Suppliers 1e. Equipment 1f. Talent 1g. Creativity 2a. Sponsors 2b. Sponsor support 2c. More sponsors 2d. RIT Eng 2e. Fundraisers 3a. Stay on Schedule 3b. Change Req\'ts 3c. PDR Req\'ts 3d. CDR Req\'t... Date Added: 2009-06-16 19:09:21 |
| expression_las_rhl_QS.pdf Path: Washington >> MICRO >> 496 Fall, 2009 Description: Journal of Antimicrobial Chemotherapy (2006) 58, 12501253 doi:10.1093/jac/dkl407 Advance Access publication 9 October 2006 Expression of the las and rhl quorum-sensing systems in clinical isolates of Pseudomonas aeruginosa does not correlate with ef... Date Added: 2009-06-16 19:11:50 |
| eqn.ps Path: RIT >> PHYS >> 301 Fall, 2009 Description: <?xml version=\"1.0\" encoding=\"UTF-8\"?> <Error><Code>NoSuchKey</Code><Message>The specified key does not exist.</Message><Key>416b78a895f84e5475e1c70e130a59bedc8ad2c7.ps</Key><RequestId>4B C91678ED49C877</RequestId><HostId>N45sgbtfrROwPSRFo8p8uR0WlG7G... Date Added: 2009-06-16 19:12:38 |
| set2.pdf Path: Michigan State University >> PHY >> 851 Fall, 2008 Description: f % f geg B3 x )CB y l sr xoAi g !3 f %g w yH y e 9 w V C$3%\" 3 iC04B0 # #B # 0 f ! B 6 (B3 D $ ! $ w x 0 3 @ 0 ( B 0 D 0 $! B3 D $! $ B $ f |y ! #@ ! %\" 9 #@ 7 g C$#C\"93 # #2E10( #C0C(... Date Added: 2009-06-16 19:13:07 |
| 94_socCOG-teachmod_v_child.pdf Path: CSU San Marcos >> ID >> 340 Fall, 2009 Description: Mapping the mind Domain specificity in cognition and culture 18 Teachers\' models of children\'s minds and learning Sidney Stmuss and Tamar Shilony Edited by LAWRENCE A. WIRSCHFELD University of Michigan SUSAN A. GELMAN \' University of Michigan Lay... Date Added: 2009-06-16 19:13:32 |
| Chap 01 Introduction.pdf Path: Purdue >> STAT >> 520 Fall, 2008 Description: CHAPTER 1 INTRODUCTION Data obtained from observations collected sequentially over time are extremely common. In business, we observe weekly interest rates, daily closing stock prices, monthly price indices, yearly sales figures, and so forth. In me... Date Added: 2009-06-16 19:14:50 |
| Davis_etal_1993.pdf Path: N.C. State >> MEA >> 717 Spring, 2008 Description: ... Date Added: 2009-06-16 19:15:21 |
| Betz.pdf Path: Berkeley >> ES >> 196 Fall, 2009 Description: Brie Betz Lake Calumet Gulls 09 May 2005 The Effect of Seagulls on Recreational Water Quality at Lake Calumet, Illinois Brie Betz Abstract The Lake Calumet region, located 12 miles south of Chicagos downtown financial district, has experienced g... Date Added: 2009-06-16 19:18:21 |
| lectureNotes_Chapter5.pdf Path: Contra Costa College >> COEN >> 312 Fall, 2009 Description: 1 COEN 312 DIGITAL SYSTEMS DESIGN - LECTURE NOTES Concordia University Chapter 5: Synchronous Sequential Logic NOTE: For more examples and detailed description of the material in the lecture notes, please refer to the main textbook: Digital Design 3r... Date Added: 2009-06-16 19:19:06 |
| TF9_7.28.pdf Path: SMU - Cox School of Business >> EMIS >> 8361 Fall, 2009 Description: 7.28 project (in order of investment) investment DN (0) 0 E1 360k E2 380k E3 405k MARR = 12% Let CB = current best (defender) Accept DN CB = DN Consider E1 - CB = E1 - DN = E1 RORE1 = 20% > MARR Accept E1 CB = E1 Consider E2 - CB = E2 - E1 RORE2-E1 ... Date Added: 2009-06-16 19:22:31 |
| handshake_2.ppt Path: Georgia Tech >> CS >> 4803 Fall, 2008 Description: Security Handshake Pitfalls (II) CS 4803 Fall 04 Establishing Session Keys s Authentication handshakes to securely establish session keys x Using shared secret x Using public keys x One-way public key (only Alice needs to have keys) x Lamport\'s ha... Date Added: 2009-06-16 19:23:03 |
| PurchaseRequisition McMaster-Carr 3.pdf Path: RIT >> P >> 09451 Fall, 2009 Description: Multidisciplinary Senior Design Kate Gleason College of Engineering Purchase Requisition This form is to be used for purchases made by Chris Fisher in the Multidisciplinary Senior Design Office or to request reimbursement for project purchases. P0945... Date Added: 2009-06-16 19:23:47 |
| syllb.doc Path: SMU - Cox School of Business >> ENGR >> 8383 Fall, 2009 Description: CSCI 8383 Spring 2004 Hesham El-Rewini Advanced Computer Architecture Lecture Time Instructor Office Phone E-mail Office Hours Books TTH 11:00 am 12:20 pm Dr. Hesham El-Rewini 306B SIC (214) 768-3083 rewini@engr.smu.edu Monday 10:00 am 12:00 pm ... Date Added: 2009-06-16 19:26:24 |
| Chap9.pdf Path: Cal Poly Pomona >> PSY >> 402 Fall, 2009 Description: PSY 402 Theories of Learning Chapter 9 Motivation Evidence of Motivation Behavior is variable. Rate of responding changes even in the presence of the same stimuli (the same environment). Behavior is persistent. Behavior continues once started, eve... Date Added: 2009-06-16 19:26:46 |
| Examen2_A04.pdf Path: NSULA >> GEL >> 21947 Fall, 2009 Description: !\" \' ! $! ! ! % \" \" # \" ( ( ( % % % % , * \" \" \" ) ( ) (+, \" \" \" 4 \" 0 0 6 \" 5 \" \' ) 8/ : < >/ @ \"( 4 (7 ;/ : ( = : \" \" ? : \" \" \": 89 : \" \" 5 ... Date Added: 2009-06-16 19:26:53 |
| Week_15.ppt Path: Colorado >> ASTR >> 1020 Fall, 2008 Description: ASTR 1020 Introductory Astronomy II: Stars & Galaxies Week 15: (23April) Cosmology: Hubble expansion Abundance of the elements Dark matter, dark energy Measuring big distances to galaxies STANDARD CANDLES - important ones in `distance ladder, or `ch... Date Added: 2009-06-16 19:30:24 |
| r-solution12.pdf Path: GCSU >> MATH >> 1261 Fall, 2008 Description: Math 1261: Calculus I Reading Quiz 12 Solutions Name: 1. (2 pts) Why is the Fundamental Theorem of Calculus called fundamental? Brown Solution. The FTC establishes a connection between the two branches of calculus: differential calculus and integra... Date Added: 2009-06-16 19:31:55 |
| ch2-spectroscopie-1.pdf Path: Neumont >> CHM >> 3102 Fall, 2009 Description: 2. Spectrophotomtrie molculaire applique aux biomolcules Spectrophotomtrie d\'absorption UV-vis Fluorimtrie Spectroscopie infrarouge 61 2.1 Principes de la spectrophotomtrie d\'absorption UV-vis La spectrophotomtrie d\'absorption consiste mesurer l\'a... Date Added: 2009-06-16 19:33:29 |
| C476 Myths of Testing.pdf Path: Winthrop >> CSCI >> 476 Spring, 2008 Description: CSCI 476 Software Engineering II Testing Myths From: Beizer, B. Software System Testing and Quality Assurance, Van NostrandReinhold, 1984. Myths of Bottom Up testing: 1. Myth: If each module is thoroughly tested and then integrated carefully, one c... Date Added: 2009-06-16 19:34:57 |
| Access_CH02.ppt Path: Cuyamaca College >> CS >> 1823 Fall, 2009 Description: Essentials 2003 Access Level 1 Project 2: Building a Database Copyright 2004 Prentice-Hall. All rights reserved. 1 Objectives Create a new database from scratch Build a table in design view Create an AutoForm Add records to a table Crea... Date Added: 2009-06-16 19:37:54 |
| designreview2.1-thor.doc Path: Seattle Pacific >> EE >> 4212 Fall, 2009 Description: Design Review 2.1 EE 4212 Team Thor\'s Hammer Max Update of ongoing documen ts Power Supply Winter quarter schedule complete with current progress marked Characterization of Efficiency 3.3V switcher lower than expected 5,3.3 linear good Character... Date Added: 2009-06-16 19:39:27 |
| HW9.ppt Path: Dallas >> EE >> 3300 Fall, 2008 Description: HW9 S13.1 P892 #22: Domain of f ( x, y ) = ln( xy - 6) ln defined only for positive arguments so xy - 6 > 0; xy > 6 S13.1 P892 #32: Sketch f(x,y) = 6-2x-3y = z or 2x+3y+z=6 (a plane) S13.1 P892 #36: Sketch z= 1 2 x + y 2 x 2 + y 2 = 4 z 2 {z 0... Date Added: 2009-06-16 19:39:55 |
| 4460 Homework 2 Solution.pdf Path: Auburn >> ENG >> 4460 Fall, 2009 Description: SOLUTION TO HOMEWORK ASSIGNMENT NO. 2 Problem 3.1 A processing facility converts scrap tires into fuel via pyrolysis. As a part of this process a wastewater stream (R1) is generated, whose organic content needs to be reduced from 500 ppmw to 50 ppmw.... Date Added: 2009-06-16 19:40:50 |
| eqn.ps Path: RIT >> PHYS >> 312 Fall, 2009 Description: %!PS-Adobe-2.0 %Creator: dvips(k) 5.92b Copyright 2002 Radical Eye Software %Title: eqn.dvi %Pages: 1 %PageOrder: Ascend %BoundingBox: 0 0 596 842 %DocumentFonts: CMMI10 CMR7 CMR10 %EndComments %DVIPSWebPage: (www.radicaleye.com) %DVIPSCommandLine: d... Date Added: 2009-06-16 19:41:19 |
| Chapter 06.pdf Path: North Texas >> ENGR >> 2750 Fall, 2008 Description: Chapter 6 Interrupts and Resets Basics of Interrupts (1 of 4) What is an interrupt? A special event that requires the CPU to stop normal program execution and perform some service related to the event. Examples of interrupts include I/O completio... Date Added: 2009-06-16 19:44:02 |
| doc.txt Path: UCSC >> CMPS >> 203 Fall, 2008 Description: _String Constants_ This library provides the facility for multiple langauges in DrScheme\'s GUI. These are the exported syntactic forms and procedures: > (string-constant name) : string This form returns the string constant named `name\'... Date Added: 2009-06-16 19:44:30 |
| t2StudyGuide.doc Path: Kennesaw >> SCIENCE >> 3210 Fall, 2009 Description: CSIS3210 Fall/2002 - Study Guide for Second Test 1) Exercises done in class on Chapters 8 and 9 (also available on the web At http:/science.kennesaw.edu/~mguimara/3210/Ch8_9a.doc Below is an example of another exercise for you to practice (other que... Date Added: 2009-06-16 19:46:55 |
| A_critical_assessment_of_interval_arithmetic_practicalities.pdf Path: University of Louisiana at Lafayette >> INTERVAL >> 655 Fall, 2009 Description: A Critical Assessment of Interval Arithmetic Practicalities R. Baker Kearfott August 18, 2006 This will be completed shortly. 1 ... Date Added: 2009-06-16 19:49:06 |
| StructMPHSpec.pdf Path: Virginia Tech >> CS >> 1044 Fall, 2000 Description: CS 1044 Intro Programming in C+ Development Example 5 Array of Structs, Sorting, Code Instrumentation For this project you will implement a relatively simple database application to manage information about trips. The application will initialize vi... Date Added: 2009-06-16 19:49:08 |
| Chapter 4.ppt Path: Oregon State >> BA >> 340 Fall, 2008 Description: Chapter 4 Interest Rates Annual and Periodic Rates Impact on TVM Consumer Loans and Monthly Amortization Schedules Nominal and Real Interest Rates Risk-free Rate and Premiums Default, Maturity, Liquidity Brief History of Interest Rates Annu... Date Added: 2009-06-16 19:50:45 |
| reverseList.txt Path: North Texas >> PROGRAMASS >> 3110 Fall, 2009 Description: /* * Get a list of integers and output a reversed list. * * @Author Mario Lopez * @Version 1.0 * @Date Feb 23 2007 */ #include <iostream> #include <string> #include <list> using namespace std; / Function to read an inputted number int ... Date Added: 2009-06-16 19:51:25 |
| one-sample-bs.txt Path: UCSB >> EEMB >> 176 Fall, 2008 Description: COPY 10.7 mu COPY 10000 Niterations READ Y MEAN Y Ymean VARIANCE Y Yvar SUBTRACT Ymean mu delta SQUARE delta deltaSquare COUNT Y >-100000000000 N MULTIPLY deltaSquare N SignalObs PRINT SignalObs PRINT \" \" DIVIDE signalObs Yvar SignalNoiseObs PRINT S... Date Added: 2009-06-16 19:51:36 |
| sm7_57.pdf Path: Norwich >> ME >> 465 Fall, 2009 Description: Excerpts from this work may be reproduced by instructors for distribution on a not-for-profit basis for testing or instructional purposes only to students enrolled in courses for which the textbook has been adopted. Any other reproduction or translat... Date Added: 2009-06-16 19:51:53 |
| Project_remarks.pdf Path: Carnegie Mellon >> EE >> 551 Fall, 2009 Description: A list of the relevant TI C67 EVM manuals follows Manuals: Most manuals are available in hardcopy in the lab (10 copies). You may sign them out overnight. We have Code Composer Studio (it is better than Code Composer) . All manuals can be found onli... Date Added: 2009-06-16 19:52:42 |
| mtref.cenrap.aug.txt Path: UC Riverside >> BASE >> 308 Fall, 2009 Description: 2201020170 2 2002 5027 0 005001 2201040210 2 2002 5027 0 005001 2201040130 2 2002 5027 0 005001 2201020190 2 2002 5027 0 005001 2201020210 2 2002 502... Date Added: 2009-06-16 19:53:59 |
| cafexamp.doc Path: Trinity U >> CS >> 1300 Fall, 2009 Description: vti_encoding:SR|utf8-nl vti_author:SR|TRINITY\\jbelisle vti_modifiedby:SR|TRINITY\\jbelisle vti_timelastmodified:TR|12 Aug 2005 20:57:44 -0000 vti_timecreated:TR|12 Aug 2005 20:57:44 -0000 vti_cacheddtm:TX|12 Aug 2005 20:57:44 -0000 vti_filesize:IR|399... Date Added: 2009-06-16 19:56:25 |
| age-structured model.xls Path: Washington >> FISH >> 458 Spring, 2008 Description: Spreadsheet created by Trevor A Branch starting 2 April 2008, tbranch@gmail.com. Demonstrates a simple age-structured model not split into sexes for lecture to University of Washington, School of Aquatic and Fishery Sciences course FSH458 in Spring 2... Date Added: 2009-06-16 19:58:05 |
| puccinibio.txt Path: ECPI >> CIS >> 282 Fall, 2009 Description: Giacomo Puccini (1858 - 1924) = Giacomo Puccini was born on December 22, 1858, to a family of church musicians in Lucca. He first studied with his uncle at the Instituto Pacini in Lucca, but a performance of Verdi\'s \"Aida\" brought forth a love for ... Date Added: 2009-06-16 20:06:54 |
| More Totally Random LH Skits - AJ Talon.doc Path: Allan Hancock College >> Q >> 1220080 Fall, 2009 Description: Top of Form 1Anime </subcats.php?categoryid=201> Love Hina </list.php?categoryid=784> More Totally Random Love Hina Skits!text size: (+) <javascript:updateFontSize(\'u\');> : (-) <javascript:updateFontSize(\'d\');>Author: Andrew Joshua Talon </profile... Date Added: 2009-06-16 20:07:07 |
| rfc0915.txt Path: Arkansas Tech >> CS >> 4303 Fall, 2009 Description: Network Working Group Marc A. Elvy Request for Comments: 915 Harvard University Rudy Nedved ... Date Added: 2009-06-16 20:07:50 |
| problems10.pdf Path: UConn >> MATH >> 102 Fall, 2009 Description: Mathematics 102 Problems 16 Organization - Counting p p p p p p p p p p p p p p p p (68) (Dot To Dot) Consider a 4 4 square of dots. Beginning at the lower left point, how many different paths are there to the top right corner? It is assumed that... Date Added: 2009-06-16 20:08:23 |
| Geog473Spring2008_Lecture10.ppt Path: Maryland >> GEOG >> 473 Fall, 2008 Description: Spring 2008 Geog 473: GIS and Spatial Analysis Area Data Analysis: Spatial Autocorrelation Naijun Zhou Department of Geography University of Maryland April 15, 2008 Lecture outline 1. Concepts 2. Spatial autocorrelation: interval and ratio variable... Date Added: 2009-06-16 20:08:48 |
| SpatialJoin_Overview.doc Path: Wisconsin Milwaukee >> GEOG >> 525 Spring, 2008 Description: vti_encoding:SR|utf8-nl vti_timelastmodified:TR|27 Feb 2008 15:29:23 -0000 vti_extenderversion:SR|6.0.2.8161 vti_backlinkinfo:VX|Geog525_08/Geog525_Assign.htm ... Date Added: 2009-06-16 20:11:13 |
| quantile.pdf Path: UNC >> BIOS >> 662 Fall, 2008 Description: Population Quantiles Bios 662 Michael G. Hudgens, Ph.D. mhudgens@bios.unc.edu http:/www.bios.unc.edu/mhudgens 2007-08-28 13:13 BIOS 662 1 Population Quantiles Quantiles The text and notes discuss sample or empirical quantiles based on data from... Date Added: 2009-06-16 20:15:07 |
| W_fig1.ps Path: N.C. State >> ST >> 810 Fall, 2008 Description: ... Date Added: 2009-06-16 20:16:45 |
| September112006.pdf Path: Toledo >> EECS >> 4530 Fall, 2008 Description: Quick Review of Matrices Matrices and Transformations Computer Graphics September 11, 2006 Matrix Multiplication a11 . . a1m b11 . b1 j a . . a . . im i1 ari . . arm bm1 . bmj p11 . . b1c . . = pi1 . . bmc . p . r1 p1 j . ... Date Added: 2009-06-16 20:20:55 |
| fib.s.txt Path: New Mexico >> ECE >> 344 Fall, 2009 Description: 1 * 2 * Example code: calculation of Fibbonacci numbers 3 .org 0x30000000 4 30000000 7A07 lrw r10,base ; point R10 at base of table 5 * 6 30000002 6012 ... Date Added: 2009-06-16 20:21:27 |
| travailpratique.doc Path: Université du Québec à Montréal >> C >> 15293 Fall, 2009 Description: TRAVAIL PRATIQUE NO 3 De la crise de la dette l\'ajustement structurel I. Le dveloppement des capacits (partie hors-rapport) La partie hors-rapport de ce travail pratique traitera des enjeux lis au dveloppement des capacits tel que dfinit par la Banq... Date Added: 2009-06-16 20:24:56 |
| Ryan Trade Study Proposal.doc Path: Oakland University >> ME >> 463 Fall, 2009 Description: Ryan Reis Individual Engineering Feasibility/Trade Study Proposal AME 40463: Senior Design Group A2 September 19, 2006 Purpose The condenser is a major component of the human powered water still that could greatly benefit from a trade study. The pur... Date Added: 2009-06-16 20:26:00 |
| quiz1.ps Path: UCSC >> CMPS >> 130 Fall, 2008 Description: %!PS-Adobe-2.0 %Creator: dvips(k) 5.86 Copyright 1999 Radical Eye Software %Title: quiz1.dvi %Pages: 2 %PageOrder: Ascend %BoundingBox: 0 0 612 792 %EndComments %DVIPSWebPage: (www.radicaleye.com) %DVIPSCommandLine: dvips -f quiz1 %DVIPSParameters: d... Date Added: 2009-06-16 20:26:09 |
| ESC6A.pdf Path: CSU Northridge >> M >> 24771 Fall, 2009 Description: Essential Skills for Chapter 6 1. Find composite functions and their domains 1 1 For f(x) = ) and g(x) = ) find fBg and its domain. x+3 x2 Existence of fBg(x) = f(g(x) is dependent on the existence of g(x) first if g(x) does not exist, then f(g(x) ... Date Added: 2009-06-16 20:27:02 |
| Biotechnoloy Exam 3 samples ANSWERS.doc Path: Kennesaw >> BTECH >> 3100 Fall, 2009 Description: BTEC 3301 Exam 3 Samples. Marks: Time: 100 points 1hr Question 1 Multiple Choice (3 pts/questions=45) 1. Several products for prevention and gene therapy go for human species. They range between A. 70-75% B. 70-80% C. 60-70% D. 80-90% 2. Hemophilia ... Date Added: 2009-06-16 20:27:29 |
| MasterSlideBackground.doc Path: Trinity U >> CS >> 1300 Fall, 2009 Description: Master Slide Background Double-click on the picture You can preview your image with the washout color. You can also change the brightness and contrast and preview again. When you are happy with the preview, click OK. The text must be highlighted t... Date Added: 2009-06-16 20:28:01 |
| SES.xls Path: UMKC >> BDS >> 545 Fall, 2008 Description: SES PERIOD 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 A(t) ALPHA= 1.2660 SSE= 1.4111 ln(A(t) F(t) e(t) e(t)^2 |e(t)| PE APE 112 4.7185 4.7185 1... Date Added: 2009-06-16 20:33:37 |
| ACF_PACFHWB.xls Path: UMKC >> BDS >> 545 Fall, 2008 Description: SERIES 476 574 589 649 712 691 659 600 587 658 719 747 818 782 766 679 634 583 561 495 426 442 475 558 597 654 695 746 814 826 867 844 806 727 751 805 864 888 970 991 1041 1105 1159 1077 1053 984 965 903 1400 1200 1000 800 600 400 200 0 1 3 5 7 ... Date Added: 2009-06-16 20:33:53 |
| AIRLINECHAPTER2.xls Path: UMKC >> BDS >> 545 Fall, 2008 Description: ACTUAL- Ln of Original Data 6.5000 6.0000 5.5000 5.0000 4.5000 4.0000 1 5 13 21 29 37 45 53 61 69 77 85 93 101 9 17 25 33 41 49 57 65 73 81 89 97 1 ATUAL VS FITTED 6.5000 6.0000 5.5000 6.0000 5.5000 5.0000 4.5000 4.0000 1 6 16 26 36 46 56 ... Date Added: 2009-06-16 20:33:54 |
| cmsi671-spring2005-hw0125.pdf Path: Loyola Marymount >> CMSI >> 671 Spring, 2009 Description: CMSI 671 COMPUTER GRAPHICS Spring 2005 Assignment 0125 The goal of this assignment is to kickstart you into graphics programming - just get some code in there, build it, and run it. Don\'t worry about understanding everything that the code is doing. ... Date Added: 2009-06-16 20:37:43 |
| lect7_8_2.pdf Path: Caltech >> PHYS >> 199 Fall, 2009 Description: ... Date Added: 2009-06-16 20:38:20 |
| Design_Temp.doc Path: Bellevue >> ACADEMIC >> 535 Fall, 2009 Description: vti_encoding:SR|utf8-nl vti_timelastmodified:TR|28 Aug 2005 18:07:08 -0000 vti_extenderversion:SR|5.0.2.2623 vti_backlinkinfo:VX|CIS535Fall2005/index.htm ... Date Added: 2009-06-16 20:38:53 |
| a06minitest7.pdf Path: Université du Québec à Montréal >> R >> 16374 Fall, 2009 Description: ECO 1003: Minitest 7 Universit du Qubec Montral cole des Sciences de Gestion Dpartement des sciences conomiques Automne 2006 Vous avez 10 minutes pour rpondre aux deux questions suivantes. Veuillez respecter que c\'est un travail individuel. Bonne ch... Date Added: 2009-06-16 20:39:39 |
| ProtocolChecker.ps Path: UCSB >> CS >> 138 Fall, 2009 Description: %!PS-Adobe-3.0 %BeginProlog /imStr 0 def /imageSrc {currentfile /ASCII85Decode filter /RunLengthDecode filter imStr readstring pop } def /BD {bind def} bind def /D {def} BD /ISOF { dup findfont dup length 1 add dict begin { 1 index /FID eq {pop pop} ... Date Added: 2009-06-16 20:40:48 |
| h270.ps Path: Arizona >> Q >> 0117 Fall, 2009 Description: %!PS-Adobe-3.0 %BoundingBox: 54 54 558 738 %Title: Graphics produced by IDL %For: mmorita@lithops.as.arizona.edu, /net/qso/d5/mmorita/HST/HSTfinal3.5 %Creator: IDL Version 5.4 (sunos sparc) %CreationDate: Wed Apr 18 15:15:28 2001 %DocumentData: Clean... Date Added: 2009-06-16 20:41:28 |
| Lecture 8.pdf Path: Berkeley >> EE >> 105 Fall, 2009 Description: Lecture 8 ANNOUNCEMENTS A summary of frequently misunderstood/missed concepts is A summary of frequently misunderstood/missed concepts is now posted on the class website, and will be updated regularly. Graded HW assignments can be picked up in lab... Date Added: 2009-06-16 20:42:08 |
| EM121_P-12_Sol.pdf Path: Rose-Hulman >> EM >> 121 Fall, 2009 Description: ... Date Added: 2009-06-16 20:42:20 |
| class6 -- Routers and Routing.pdf Path: Roger Williams >> CIS >> 375 Fall, 2009 Description: Understanding Routing Module Fall M d l 6 F ll 2008 2008 Secure Technology, LLC. Spring Classes CIS 380/465 CCNA CIS 420 Computer Forensics CIS 421 Pen Testing 2008 Secure Technology, LLC. Router Redux Layer 3 Device y Multihomed Host Revise... Date Added: 2009-06-16 20:43:21 |
| L19_MO2.pdf Path: Wisconsin >> CHEM >> 562 Fall, 2008 Description: Chem 562. Lecture 19 Electronic structure of molecules. II. LCAO-MO and the variational principle October 19, 2005 1 Molecular Orbital (MO) Theory. Continued Recall that after the independent electron approximation, we have the following one-elect... Date Added: 2009-06-16 20:46:11 |
| Quiz09.pdf Path: UConn >> MATH >> 2210 Fall, 2009 Description: Math 2210 Quiz 9 Answers 3 2 . 4 1 April 15, 2009 Name: (16pts) 1. Consider the matrix A = (a) Is v = 7 and eigenvector of A? If so, find the eigenvalue for v. 7 35 = 5v. So the eigenvalue is 5. 35 Solution: Yes, since Av = (b) Is = -1 an eig... Date Added: 2009-06-16 20:46:23 |
| Motivation.ppt Path: UCSD >> CS >> 491 Fall, 2009 Description: vti_encoding:SR|utf8-nl vti_title:SR|CS 491 High Performance Distributed Objects vti_filesize:IR|77312 vti_backlinkinfo:VX|individual/achien/cs491-f97/reading.html vti_extenderversion:SR|4.0.2.2717 vti_timelastmodified:TR|26 May 2015 07:44:48 -0000 v... Date Added: 2009-06-16 20:47:56 |
| output.txt Path: Delaware >> CISC >> 181 Fall, 2008 Description: This output is going to the file lab12a.dat. I can also print the value of variables to a file. for example, x=3, y=4.5 Bye now! ... Date Added: 2009-06-16 20:48:39 |
| lecture17.pdf Path: UC Davis >> ECS >> 152 Fall, 2009 Description: Lecture 17 Local Area Networks ECS 152A Computer Networks 1 LAN Applications (1) Personal computer LANs Low cost Limited data rate Back end networks Interconnecting large systems (mainframes and large storage devices) High data rate High speed in... Date Added: 2009-06-16 20:49:55 |
| Adverb lessonplan.doc Path: U. Houston >> CUIN >> 3111 Fall, 2008 Description: Lisa Powers EDUC 4397 Final lesson plan Grade Topic Expectations 4 Adverbs Students will learn the definition of an adverb, be able to recognize adverbs in a sentence, and be able to use an adverb in a sentence to make ideas more vivid and precise. 1... Date Added: 2009-06-16 20:50:53 |
| EEN338 (Summer 2002).pdf Path: Texas >> EE >> 338 Fall, 2009 Description: EEN338 (Summer 2002) Instructor: Prof. Ananth Dodabalapur Office Hours: Tue and Fri 1025-1125 Office: ENS426 TA/Grader: Ms. Shuba Asopa Office ENS426 Office Hrs Course Credit 10% Homeworks (15 need to be submitted) 30% each: Midterm 1, Midte... Date Added: 2009-06-16 20:54:02 |
| sn1986g_1986_06_09.dif.ps Path: Southern Oregon >> D >> 1986 Fall, 2009 Description: ... Date Added: 2009-06-16 20:55:44 |
| sn1984l_1984_11_01.dif.ps Path: Southern Oregon >> D >> 1984 Fall, 2009 Description: ... Date Added: 2009-06-16 20:55:47 |
| Presentation_&_Critique_Submission.doc Path: Allan Hancock College >> ECOM >> 13003 Fall, 2009 Description: #C#Presentation_c?* TQ3utFiQD8\"#F_2 #On?(#(@ET S#{PFT f#ZZDU#$bbG# +%D Q]\'?yy !* S4 ^d\'xZ.#s{$9|.{/ % +DD D #Ax#[ u_ }9 [ #p# `L # -/# TN #P? :.+#GN+9#c2LU`N=\\w#|t| s]N+ptw9=ii+ ?\\N5?7... Date Added: 2009-06-16 20:58:25 |
| disk.txt Path: Allan Hancock College >> COIT >> 12120 Fall, 2009 Description: .114 .110 .121 .133 .123 .143 .173 .177 .162 .173 .161 .123 .107 .164 .188 .129 .122 .153 .175 .118 .116 .161 .166 .120 .128 .170 .195 .194 .114 .170 .135 .124 .132 .145 .190 .145 .134 .152 .137 .112 .105 .105 .177 .149 .151 .110 .174 .113 .110 .112 ... Date Added: 2009-06-16 21:00:23 |
| Exam2.pdf Path: SUNY Fredonia >> CSIT >> 241 Fall, 2009 Description: r v X a a v r v a r qw ls v v y u C mv s W@ w fgeedu C ltv lW us s fgeedu C v poW s i r y qw v n ` y w m xv fgeedu C v 4lkW s ` j ` X ihyw hv f e gedu C v s 6 W Dgf X y w g 6 w X yxv @ i ut sqi f d b ... Date Added: 2009-06-16 21:01:54 |
| 11-reviews.pdf Path: TCNJ >> FSP >> 101 Fall, 2008 Description: Raper 11 Reviews Reviewer 1 After reading this paper, I can see that much work is needed to make this paper an acceptable research-style paper. First, I feel much more research is needed to make this a research paper effective. Next, sources need to... Date Added: 2009-06-16 21:01:59 |
| lect7.ppt Path: WVU >> IDT >> 601 Fall, 2008 Description: DistanceEducation VideoconferencingTechniques Projects 1. Observe and critique one 2-way video/2-way audio conference distance learning program, and one 1-way video/2way audio satellite delivered distance learning program. Projects 2.C... Date Added: 2009-06-16 21:03:05 |
| Ses9.ppt Path: CSU Fullerton >> IPC >> 144 Fall, 2009 Description: IPC144 Session 9 The C Programming Language 1 Objectives Construct the basic structure of a C program Use this structure in creating programs that can be compiled List the data types used in C Differentiate between integer and float data types ... Date Added: 2009-06-16 21:04:18 |
| 3326_homework_19.pdf Path: Trinity U >> MATH >> 3326 Fall, 2009 Description: MATH 3326-1 Intro to Abstract Math Fall 2008 Homework 19 Due Date: Nov. 13th Problem 64. In what follows, (c, d) = {x R| c < x < d}, i.e., the open interval. Establish the following set-theoretic equivalences. a) For any reals a < b, (a, b) (0,... Date Added: 2009-06-16 21:05:01 |
| syllabus_nh.pdf Path: N.C. State >> PE >> 102 Fall, 2008 Description: NCSU Department of Physical Education Instructor: E-Mail: Phone: Nita Horne nita_horne@ncsu.edu (919) 515-6382 PE 102 Fitness Walking 1 Credit Hour Course Prerequisites: None Office: 2019 Carmichael Gymnasium Office Hours: MW 1:30-2:30, TH 12:15-1:1... Date Added: 2009-06-16 21:05:10 |
| SYL8086 Aut07.pdf Path: Université du Québec à Montréal >> WEB >> 8086 Fall, 2009 Description: COURS: PROFESSEUR: SESSION: ECO 8086 Applications de modles conomiques Yvon FAUVEL Automne 2007 SYLLABUS OBJECTIFS: Ce cours vise essentiellement familiariser l\'tudiant avec la thorie et la pratique de la spcification, de l\'estimation, de la valid... Date Added: 2009-06-16 21:07:21 |
| 20 Two-way Factorial Design 323.doc Path: Cal Poly >> STAT >> 323 Fall, 2009 Description: Stat 323 20-Two-way Factorial Design 1 Two-way Factorial Design MODEL Suppose there are a levels of factor A, b levels of factor B, and n replications of the ab treatments, giving a total of abn observations. The treatments are assigned randomly t... Date Added: 2009-06-16 21:09:40 |
| F00_q4.pdf Path: Michigan >> ECE >> 210 Fall, 2009 Description: ... Date Added: 2009-06-16 21:09:56 |
| myDAQ-SCXI Getting Started-320515f.pdf Path: N. Illinois >> ILS >> 390 Fall, 2009 Description: SCXI Getting Started with SCXI TM Getting Started with SCXI July 2000 Edition Part Number 320515F-01 Worldwide Technical Support and Product Information www.ni.com National Instruments Corporate Headquarters 11500 North Mopac Expressway Worldwide... Date Added: 2009-06-16 21:11:33 |
| Rubric Rough Drafts.xls Path: U. Memphis >> HMSE >> 4999 Summer, 2008 Description: Research Report : Senior Project Teacher Name: Dr. Ryan Student Name: _ CATEGORY 16 Introduction (Rough Draft #1) Project clearly state and develops purpose/aims for the study, and why it is appropriate. 12 Project clearly state and develops purpose... Date Added: 2009-06-16 21:12:21 |
| Horowitz.doc Path: Penn State >> AMH >> 5054 Fall, 2009 Description: As We May Think Adam Horowitz Everyday technology is changing all around us. Scientists are improving technology for themselves as well as the common people. They are trying to improve the simple everyday tasks making them easier and quicker to compl... Date Added: 2009-06-16 21:12:25 |
| Spotlight on Metabolism.doc Path: Wharton County >> REVIEW >> 1322 Fall, 2009 Description: Spotlight on Metabolism Key Terms 1. _ - All chemical reactions within organisms that enable them to maintain life. The two main categories are catabolism and anabolism. 2. _ - A key intermediate product in the metabolic breakdown of carbohydrates,... Date Added: 2009-06-16 21:14:03 |
| hw5.pdf Path: Pittsburgh >> ENGR >> 3088 Fall, 2009 Description: IE 3088 Homework 5 Due on Thursday February 22nd by 3:00 PM at my oce. Youre welcome to turn it in on Wednesday in class if you like. 1 Cutting planes By Monday, please look at an IP solver and create a list of all the types of cuts that the solve... Date Added: 2009-06-16 21:15:40 |
| lowtech-sensors-and-actuators.pdf Path: Allan Hancock College >> MMDS >> 2802 Fall, 2009 Description: TABLE OF CONTENTS INTRODUCTION . 3 LOW TECH .. 4 CONTEXT. 4 A CONCEPTUAL FRAMEWORK FOR PLANNING YOUR SYSTEM. 5 COMPOUND SYSTEMS.. 7 VOICE ACTIVATED REMOTE LASER. 8 TOUCH TRIGGERED MULTI-SOUND (WITH COMPARATOR).. 8 SELF-POWERED REMOTE STEP SENSOR . 9 ... Date Added: 2009-06-16 21:16:28 |
| CCR_on_Ln_luminescenece.pdf Path: Michigan >> CHEM >> 402 Fall, 2008 Description: Coordination Chemistry Reviews 252 (2008) 25122527 Contents lists available at ScienceDirect Coordination Chemistry Reviews journal homepage: www.elsevier.com/locate/ccr Review Recent developments in the field of supramolecular lanthanide lumines... Date Added: 2009-06-16 21:17:28 |
| vi_crib.pdf Path: Los Angeles Southwest College >> CSE >> 215 Fall, 2009 Description: ygrdtyt d g r q ygrdtyt d r fgyy d g r gd x xgy ~pwwy5\'tgsrpwwyQ\'p5\'pwt\'pz{ iyf r fgyy d g r gr xg i wujp\'p5\'ptpg\'g g x q q x | i ft r fgyy d g r gr xg i x x et g y | \'fsqsw\'sfXsfxf\'wjp\'5\'tpg\'Sg\'hw7pf\' Q g x r fgyy d g r gr xg \'sfqjp\'p5\'... Date Added: 2009-06-16 21:17:34 |
| 105Unit5labWS.pdf Path: Pima CC >> DTC >> 505 Fall, 2009 Description: BIO 105 LAB SIGN OFF PAGE UNIT 5 Name _ Please staple all of your lab pages for this Unit together with this page as the top You will use this page to get your Labs for Unit 5 signed off by the Biology Learning Center staff You need to have all of t... Date Added: 2009-06-16 21:18:24 |
| 003Lectoutline.pdf Path: Pima CC >> DTC >> 201 Fall, 2009 Description: 1 LECTURE OUTLINE - UNIT 3 Bones and Skeletal Tissues [*The following lecture outline follows your textbook very closely; read the outline and the associated sections in Chapter 6 and 7 of your textbook; do not try to learn the specific bone structur... Date Added: 2009-06-16 21:18:37 |
| G-CPU_Block_Diagram.pdf Path: UF >> MIL >> 3701 Fall, 2009 Description: University of Florida Department of Electrical & Computer Engineering EEL 3701 Revision 0 Drs. Gugel and Schwartz 18-Nov-08 Page 1/1 Bi-directional Data Bus G-CPU Block Diagram 8 6 IR_LD CLK 8 8 IR5:0 Register IR5:0 6 CLK Z Flag N Flag Contro... Date Added: 2009-06-16 21:19:01 |
| ECE351_HW9_P.doc Path: Rose-Hulman >> ECE >> 351 Fall, 2009 Description: ECE351 HW # 8 Due 5/13/2004 Problem 1: a) Find Ao and a for the TL072 using a datasheet. b) Find Ao and a for the TL072 using PSpice. Problem 2: Using the parameters for the TL072, find the upper -3 dB frequency for the following circuits: Figure P9... Date Added: 2009-06-16 21:19:53 |
| Graph Reduction.doc Path: TCNJ >> CSC >> 330 Fall, 2008 Description: Graph Reduction Models a most favorable possible (optimistic) continuation of execution from the current system state. while there is an unblocked process Pi: 1. For each request edge (Pi, Rj), remove the request edge and decrement the corresponding ... Date Added: 2009-06-16 21:20:10 |
| Ethics Case Study.txt Path: Rosalind Franklin University of Medicine & Science >> ITEC >> 495 Fall, 2009 Description: <b>12-1 Ethics Case Assignments </b> Due April 5 <img src=\"http:/cs.franklin.edu/~smithw/Images/clips/new.gif\"> Each team to present one paper via DropBox. Be sure your Team Name is on Cover Sheet and a list of all members. Write a two to three ... Date Added: 2009-06-16 21:23:07 |
| final_exam_grades.txt Path: Virginia Tech >> CS >> 3304 Fall, 1999 Description: 0127 172 0370 108 0602 128 0679 128 1177 152 1266 140 1613 96 1755 132 2095 152 2400 164 2746 88 2827 152 3150 92 3372 136 3416 108 3422 108 3547 120 3658 120 3867 96 4063 152 4094 116 4198 120 4377 136 4591 140 4783 112 4953... Date Added: 2009-06-16 21:24:16 |
| final #2.doc Path: Uni. Westminster >> ACC >> 1105 Fall, 2009 Description: 1 History of Big Brothers Big Sisters Big Brothers Big Sisters (BBBS) is a nonprofit organization that has provided adult mentors to children for over one hundred years. Big Brothers Big Sisters was created to provide a positive nurturing relationshi... Date Added: 2009-06-16 21:25:43 |
| T0436.t2k.dssp-ebghstl-logo.pdf Path: UCSC >> T >> 0436 Fall, 2009 Description: T0436.t2k dssp-ebghstl 3 2 1 1 10 20 30 40 H 3 2 1 T E T S G H 51 60 70 80 90 S 3 2 1 T H T T S H T 101 110 120 130 140 G 3 2 1 E S H T E T H T 151 160 170 180 190 E 3 2 1 T S H E T S T H 201 210 22... Date Added: 2009-06-16 21:26:14 |
| T0436.t2k.w0.5-logo.pdf Path: UCSC >> T >> 0436 Fall, 2009 Description: T0436.t2k w0.5 4 3 2 1 1 10 20 30 40 H 4 3 2 1 T S G T G H 51 60 70 80 90 G 4 3 2 1 T T H S G T G H 101 110 120 130 140 G 4 3 2 1 Q P S H T Q P Q H T 151 160 170 180 190 Q 4 3 2 1 T S H S Q P Q S T S T ... Date Added: 2009-06-16 21:26:14 |
| 527 midterm 2006 answer sheet.pdf Path: Washington >> PBAF >> 527 Fall, 2009 Description: Public Affairs 527 Daniel J. Evans School of Public Affairs Marieka Klawitter Quantitative Analysis Midterm Exam Winter 2006 ANSWER SHEET Question I: a) Do victims differ demographically from the general population? Using table 1, describe how the ... Date Added: 2009-06-16 21:27:19 |
| constitutions_full_transcript.pdf Path: Columbia >> C >> 250 Fall, 2009 Description: COLUMBI A columbia university D I G I TA L K N O W L E D G E V E N T U R E S Constitutions, Democracy, and the Rule of Law Do Constitutions Constrain? October 16, 2003 Welcome and Introduction Welcome by Lee C. Bollinger, President, Columbia Univer... Date Added: 2009-06-16 21:31:33 |
| Chapter 2.ppt Path: MSU Billings >> CHEM >> 115 Fall, 2009 Description: Chemistry, The Central Science, 11th edition Theodore L. Brown; H. Eugene LeMay, Jr.; and Bruce E. Bursten Chapter 2 Atoms, Molecules, and Ions John D. Bookstaver St. Charles Community College Cottleville, MO Atoms, Molecules, and Ions 2009, Prent... Date Added: 2009-06-16 21:36:23 |
| Caprifoliaceae.pdf Path: MSU Billings >> BIOL >> 315 Fall, 2009 Description: Dipsacales 2 families [or 7] 44 genera 1100 species Caprifoliaceae Latest treatment includes Dipsacaceae Viburnum in the family Adoxaceae Caprifoliaceae: bilateral, elongate style, capitate stigma, hairy nectary... Date Added: 2009-06-16 21:36:26 |
| inbus_excel_anecd_01_mkt_direct_targ.docx Path: Oregon >> DSC >> 240 Winter, 2008 Description: inbus_excel_anecd_01_mkt_direct_targ Excel in Practice: My Role as Direct Marketing Analyst How does a company selling mountain climbing gear decide to send me a catalog advertising their new latest stainless bolt hangers and other useful outdoors p... Date Added: 2009-06-16 21:36:57 |
| gi118683.txt Path: Western Kentucky University >> BIOL >> 312 Spring, 2008 Description: >gi|118683|sp|P25453.1|DMC1_YEAST Meiotic recombination protein DMC1 MSVTGTEIDSDTAKNILSVDELQNYGINASDLQKLKSGGIYTVNTVLSTTRRHLCKIKGLSEVKVEKIKE AAGKIIQVGFIPATVQLDIRQRVYSLSTGSKQLDSILGGGIMTMSITEVFGEFRCGKTQMSHTLCVTTQL PREMGGGEGKVAYIDTEGTFRPERIKQIAEGYELDPESC... Date Added: 2009-06-16 21:38:28 |
| Chapter_13.pdf Path: Berkeley >> ECON >> 161 Fall, 2008 Description: Chapter 13 1 Final PART V: MACROECONOMIC POLICY Chapter 13: Stabilization Policy J. Bradford DeLong Questions What principles should guide stabilization policy? What aspects of stabilization policy do economists argue about today? Is monetary p... Date Added: 2009-06-16 21:39:53 |
| SYS466Review.doc Path: CSU Fullerton >> SYS >> 466 Fall, 2009 Description: Domain Class Diagram: PurchaseOrder poNum poStatus 1 contains 1.n purchases product from 0.n 1 Vendor vendorNum companyName companyPhone vendorEmail 1 sells 0.n Product prodNum qtyOnHand POItem records purchase of qtyOrdered qtyRecvd 0.n 1 Quest... Date Added: 2009-06-16 21:40:02 |
| Lec14.pdf Path: Stanford >> E >> 104 Fall, 2009 Description: E104 Lecture 14 - 8 November 1999 (Continued) Coupled Systems, modes of natural motion Rayleigh\'s method - a method for estimating the natural frequency(ies) for undamped modes of natural motion without deriving or solving the EOM. Surprisingly accu... Date Added: 2009-06-16 21:44:23 |
| Internet Basics 2.doc Path: Trinity U >> CS >> 1300 Fall, 2009 Description: vti_encoding:SR|utf8-nl vti_timelastmodified:TR|16 Jan 2008 20:36:08 -0000 vti_author:SR|TRINITY\\jbelisle vti_modifiedby:SR|TRINITY\\jbelisle vti_nexttolasttimemodified:TW|04 Oct 2006 17:10:25 -0000 vti_timecreated:TR|10 Jan 2008 21:27:44 -0000 vti_ti... Date Added: 2009-06-16 21:44:59 |
| glenn.pdf Path: University of Hawaii - Hilo >> WIST >> 206 Fall, 2009 Description: Jl. of Interactive Learning Research (2003) 14(3), 285-299 The Effect of Interaction Levels on Student Performance: A Comparative Analysis of Web-Mediated versus Traditional Delivery LOWELL M. GLENN Utah Valley State College, USA glennlo@uvsc.edu CH... Date Added: 2009-06-16 21:45:41 |
| puccinibio.txt Path: Penn State >> IST >> 269 Fall, 2009 Description: Giacomo Puccini (1858 - 1924) = Giacomo Puccini was born on December 22, 1858, to a family of church musicians in Lucca. He first studied with his uncle at the Instituto Pacini in Lucca, but a performance of Verdi\'s \"Aida\" brought forth a love for ... Date Added: 2009-06-16 21:50:08 |
| slac-pub-3591.pdf Path: Stanford >> PUBS >> 3500 Fall, 2009 Description: SLAC -PUB March i985 T/E - 3591 Search for Monojet Production in e+e- Annihilation* W. W. Ash, H. R. Band, H. T. Blume, T. Camporesi, G. B. Chadwick, S. H. Clearwater,lC1 R. W. Coombes, M. C. Delfino, R. De Sangro, E. Fernandez, W. T. Ford, M. W... Date Added: 2009-06-16 21:51:23 |
| xzero.txt Path: Berkeley >> ASTRO >> 00338338 Fall, 2009 Description: Source Contamination: 1.09E-04 +/- 1.2E-05 cts/s ... Date Added: 2009-06-16 21:52:39 |
| seminar-021206-sreshta.txt Path: Georgia Tech >> ECE >> 590 Fall, 2009 Description: Subject: UNM/ECE Seminar Announcement: Sukanya Sreshta, Fri. Dec 6, 3PM * * * * University of New Mexico * * Electrical and Comp... Date Added: 2009-06-16 21:53:00 |
| ODPRES~1.pdf Path: East Los Angeles College >> HCC >> 0109 Fall, 2009 Description: GM5135 Interprofessional Approaches to Service User Care ODP Resit THESE RESULTS ARE PROVISIONAL UNTIL RATIFIED BY AN EXAMINATION BOARD Student Number 07388532 Result (%) 40 ... Date Added: 2009-06-16 21:54:20 |
| Public Health.pdf Path: San Diego State >> ES >> 0910 Fall, 2009 Description: Public Health In the College of Health and Human Services OFFICE: Hardy Tower 119 TELEPHONE: 619-594-6317 / FAX: 619-594-6112 http:/publichealth.sdsu.edu Faculty Emeritus: Barnes, Boskin, Burgess, Chang, Kessler, Kitzinger, McTaggart, Noto, Peddecord... Date Added: 2009-06-16 21:56:59 |
| Exercise and Nutritional Sciences.pdf Path: San Diego State >> ES >> 0910 Fall, 2009 Description: Exercise and Nutritional Sciences In the College of Professional Studies and Fine Arts OFFICE: Exercise and Nutritional Sciences 351 TELEPHONE: 619-594-5541 Accredited by the Commission on Accreditation of Athletic Training Education for Athletic Tra... Date Added: 2009-06-16 21:57:00 |
| autosuture_device_PR7.pdf Path: Wisconsin >> BME >> 200 Fall, 2009 Description: Progress Report 7 Project Title: Team Members: Client: Advisor: Date: Auto-Suture Device Jennifer Wager, Joe Cabelka, Therese Rollmann, and Mark Yarmarkovich Dr. Marcus, UW Hospital Prof. Tyler 3/9/07-3/16/07 Problem Statement: Our goal is to develo... Date Added: 2009-06-16 21:57:03 |
| COE.pdf Path: San Diego State >> ES >> 0607 Fall, 2009 Description: College of Education Administration Dean: Lionel R. Meno Associate Dean: Margie K. Kitano Associate Dean for Faculty Development and Research: Rena B. Lewis Assistant Dean for Student Affairs: Patricia Lozada-Santone Doctoral Programs: Rafaela M. San... Date Added: 2009-06-16 21:58:54 |
| lecture05.ppt Path: North-West Uni. >> CS >> 110 Fall, 2009 Description: vti_encoding:SR|utf8-nl vti_timelastmodified:TR|14 Jan 2002 20:41:20 -0000 vti_extenderversion:SR|4.0.2.4426 vti_backlinkinfo:VX|academics/courses/a10/html/notes.html ... Date Added: 2009-06-16 22:00:33 |
| Microsoft_PowerPoint_2007_Directions[1].ppt Path: Idaho >> PTTE >> 111 Fall, 2008 Description: Microsoft PowerPoint 2007 InClass Activities Activity One You are the president of the Los Angeles branch of First Choice Travel. You are interested in arranging a vacation travel package to Cancun, Mexico. Connect to the Internet and search... Date Added: 2009-06-16 22:00:47 |
| NMRClassNotes9.ppt Path: Rutgers >> CHEM >> 504 Fall, 2009 Description: INADEQUATE INADEQUATE developed for nuclei with low natural abundance, like 13C. Similar to a DQCOSY, but uses JCC couplings, which are rare (Why?). Exploits NOE using 1H decoupling throughout pulse sequence. Detects direct connectivities between... Date Added: 2009-06-16 22:01:11 |
| transhw.txt Path: SDSMT >> MCS >> 225 Spring, 2009 Description: \\documentstyle[11pt]{article} %html -s article \\title{Calculus III Lectures} \\dateofissue{\\today} \\origin{Math/CS SDSMT} \\author{Jeff McGough} \\abstract{Lecture Notes} \\keywords{Calculus III} \\begin{document} \\titlepage %html -r http:/localhost... Date Added: 2009-06-16 22:01:51 |
| MillerCh10.pdf Path: Texas >> ADV >> 391 Fall, 2009 Description: Chapter IO Privacy, Civil Liberties, and Encryption Con trolling Our Data /den tity In 1791 the British reformer, Jeremy Benthan, published a design for a jail in which the prisoners could be continuously watched from a central guard station. The p... Date Added: 2009-06-16 22:01:55 |
| 5700music lab.doc Path: N.E. Illinois >> UX >> 5700 Fall, 2009 Description: PED 5700 Exercise and Music Lab Instructions Each 5700 student will need to only test one subject. (Let me know if you need a subject. I can get some from my undergraduate exercise physiology class.) Changes were made to what was discussed in ... Date Added: 2009-06-16 22:03:34 |
| EAD 864_Essay_Eight.doc Path: Michigan State University >> CEP >> 813 Spring, 2008 Description: Unit 8 Writing Assignment 1 Unit 8 Writing Assignment Eun-Jin Kim Han Michigan State University EAD 864 Adult Career Development Professor Steven Weiland May 6, 2005 Unit 8 Writing Assignment 2 Of the many theories related to adult career devel... Date Added: 2009-06-16 22:04:21 |
| Feb_20th.doc Path: SUNY Stony Brook >> AMS >> 31209 Fall, 2009 Description: February 20th Order Statistics Let X 1 , X 2 ,L , X n be a random sample from a population with p.d.f. f ( x) . Then, X (1) = min( X 1 , X 2 ,L , X n ) X ( n ) = max( X 1 , X 2 ,L , X n ) and X (1) X (2) L X (k ) L X (n) p.d.f.\'s for X (1) and... Date Added: 2009-06-16 22:05:06 |
| slac-pub-2282.pdf Path: Stanford >> PUBS >> 2250 Fall, 2009 Description: SLAC-PUB-2282 March 1979 0) A DIAGRAMATIC OF SOME CONTRIBUTIONS ANALYSIS RULE* TO THE AI = l/2 Mark B. Wise? Stanford Linear Accelerator Center Stanford University, Stanford, California 94305 and Edward Witten Department of Physics Harvard Univer... Date Added: 2009-06-16 22:07:31 |
| Number2.txt Path: Portland >> CS >> 420 Fall, 2008 Description: 2. Inheritance tracing Explore the class and superclass hierarchy as far as it goes in each direction starting from some given object. After you automate the process, try it for several different starting objects (e.g. 3.14, \'Anu\', #Anu, LargePosit... Date Added: 2009-06-16 22:09:15 |
| andhrapradesh1993.xls Path: Yale >> RP >> 269 Fall, 2009 Description: STATE ANDHRA PRADESH ANDHRA PRADESH ANDHRA PRADESH ANDHRA PRADESH ANDHRA PRADESH ANDHRA PRADESH ANDHRA PRADESH ANDHRA PRADESH ANDHRA PRADESH ANDHRA PRADESH ANDHRA PRADESH ANDHRA PRADESH ANDHRA PRADESH ANDHRA PRADESH ANDHRA PRADESH ANDHRA PRADESH ANDH... Date Added: 2009-06-16 22:12:22 |
| regression example.xls Path: Union College >> MER >> 445 Fall, 2009 Description: x 0 1 2 3 4 5 6 7 8 9 10 data f(x) SDM f(x) -0.350 1 16.000 0.720 1.790 2.3 7.290 2.860 3.930 5.7 0.490 5.000 6.070 6.3 1.690 7.140 8.210 9.7 22.090 9.280 10.350 line SE f(x) 0.075 0.078 0.920 1.815 0.314 2.760 3.755 0.490 4.800 5.895 0.706 7.040 8... Date Added: 2009-06-16 22:13:21 |
| minpath44.pdf Path: Georgia Tech >> MATH >> 4580 Fall, 2008 Description: Practice with the Min Path Algorithm Use the min path algorithm to solve the min path problem and to find a solution to the max tension problem. A feasible potential has been provided. 6 #2 [2 ,1 5] 22 [0,20] #3 1] [6 ,2 ,2 5, 11 [- [- 2] 4]... Date Added: 2009-06-16 22:13:46 |
| SQLSyntax.doc Path: CSU Northridge >> COMP >> 440 Fall, 2009 Description: SQL Syntax 1. 2. 3. Create a database is to open a file to do the following tasks: a. To create the FORMAT of base tables: Each table need to have a unique name with a well-defined format: i. Field name (column name), ii. data type of this column ... Date Added: 2009-06-16 22:14:24 |
| 05 Pointers.pdf Path: Kent State >> CS >> 23021 Summer, 2008 Description: Pointers. 1 Declaring Pointers. 1 Initializing Pointers . 2 Reseating Pointers . 2 The Null Pointer. 3 Dereferencing Pointers . 3 Test Before Use.. 4 The Compiler\'s Perspective. 5 Pointers From before, we know that when we declare a variable, the co... Date Added: 2009-06-16 22:15:26 |
| imrotate.ps Path: Air Force Academy >> GES >> 125 Fall, 2009 Description: %!PS-Adobe-2.0 %Creator: dvipsk 5.58f Copyright 1986, 1994 Radical Eye Software %Title: imrotate.dvi %Pages: 1 %PageOrder: Ascend %BoundingBox: 0 0 612 792 %EndComments %DVIPSCommandLine: dvips imrotate %DVIPSParameters: dpi=600, compressed, comments... Date Added: 2009-06-16 22:17:02 |
| astmd3775_03.pdf Path: N.C. State >> TT >> 601 Fall, 2008 Description: Designation: D3775 03a Standard Test Method for Warp End Count and Filling Pick Count of Woven Fabric1 This standard is issued under the fixed designation D3775; the number immediately following the designation indicates the year of original adopt... Date Added: 2009-06-16 22:20:44 |
| t2f08.pdf Path: N.C. State >> CSC >> 234 Fall, 2008 Description: CSC23x - Test2 - Fall 2008 - No calculator or computer allowed 01. What will be the hex value in ax after executing all these instructions? mov mul ax,0402h ah A. 0008 B. 0804 C. 1008 D.0408 E. none of the previous 02. What will be the hex va... Date Added: 2009-06-16 22:21:16 |
| ET.pdf Path: BYU >> CS >> 470 Fall, 2009 Description: Economic Theory 10, 185-193 (1997) The geometry of inductive reasoning in games5 Diana Richards Department of Political Science, University of Minnesota, Minneapolis, MN 55455, USA Received: October 27, 1995; revised version May 2, 1996 Summary. Th... Date Added: 2009-06-16 22:24:28 |
| HW7_S07.pdf Path: Iowa State >> EE >> 422 Fall, 2009 Description: HW # 7 for Course EE422 (S\'07) (Due on Thursday, April 5th ) Full name: University ID: Q1) A source emits eight equiprobable messages, which are assigned signals s1 , s2 , . . . , s8 , as shown in the Fig below s4 s5 . . . . s3 s6 2 d /2 s2 ... Date Added: 2009-06-16 22:25:06 |
| sp09_lab3.docx Path: Missouri S&T >> EE >> 265 Fall, 2009 Description: Laboratory #3 Due no later than February 13, 2009 Find, or create, a .wav audio file between 1 and 10 seconds long. Read the file into Matlab, and do all of the following: 1. Plot it, labeling both axis, put a title on it, and grid lines. 2. Plot bot... Date Added: 2009-06-16 22:25:19 |
| ps8.ps Path: Duke >> PROBSETS >> 211 Fall, 2009 Description: %!PS-Adobe-2.0 %Creator: dvips(k) 5.86 Copyright 1999 Radical Eye Software %Title: ps8.dvi %Pages: 1 %PageOrder: Ascend %BoundingBox: 0 0 612 792 %EndComments %DVIPSWebPage: (www.radicaleye.com) %DVIPSCommandLine: dvips ps8.dvi -o %DVIPSParameters: d... Date Added: 2009-06-16 22:25:46 |
| Graphic_Organizer.doc Path: SUNY Potsdam >> HAWAJ >> 191 Fall, 2009 Description: Name:_ Date:_ Story Map 1 Write notes in each section. Setting: Time: Place: Characters: Problem: Plot/Events: Resolution: ... Date Added: 2009-06-16 22:26:14 |
| UMLmodelling.pdf Path: Allan Hancock College >> INFS >> 2024 Fall, 2009 Description: Information Systems Analysis INFS2024 Information Systems Analysis INFS2024 What Do We Hope to Achieve Today? Information Systems Analysis INFS2024 Object-Oriented Modelling (Unified Modelling Language) Dennis Hart 2002-2009 1 Understand the ba... Date Added: 2009-06-16 22:27:21 |
| assignment3.pdf Path: New Mexico >> CS >> 152 Fall, 2009 Description: CS152L Assignment 3 Summer 2008 Matthew Barrick Due 07/17/2008 11:59 PM Overview: You will be implementing Conway\'s Game of Life as described in class. You may want to refer to the Wikipedia page http:/en.wikipedia.org/wiki/Conway%27s_Game_of_Life... Date Added: 2009-06-16 22:29:40 |
| GroundStates.pdf Path: New Mexico >> PHYS >> 521 Fall, 2009 Description: ... Date Added: 2009-06-16 22:30:26 |
| l17_handouts_4up.pdf Path: Cornell >> ECE >> 314 Spring, 2008 Description: Announcements ECE 3140/CS 3420 Computer Organization Spring S i 2009 Caches Associative Caches Project 4a Due Tue., Apr 7 10:00pm Homework 5 has been posted Due, Thu, Apr 9, 10:00pm Homework 6 will be posted by Tue, Apr 6 Due, Thu, Apr 16, 10... Date Added: 2009-06-16 22:30:44 |
| l21_handouts_4up.pdf Path: Cornell >> ECE >> 314 Spring, 2008 Description: Announcements ECE 3140/CS 3420 Computer Organization Spring S i 2009 Exceptions Homework 6 Due, Sat, Apr 18, 10:00pm Solutions to be posted at that time Please list problems to be graded at start of your homework! (Otherwise, we choose!) Prelim... Date Added: 2009-06-16 22:30:50 |
| KSC6E.doc Path: CSU Fullerton >> MGT >> 339 Fall, 2009 Description: SIGNIFICANT CONCEPTS & KEY WORDS KRM: Chapter 6 Process Performance and Quality Introduction Costs of poor process performance and quality* Prevention Appraisal Internal failure External failure Total quality management* Figure 6.1 Customer ... Date Added: 2009-06-16 22:32:25 |
| How to Study Statistics.pdf Path: LA Tech >> QA >> 233 Fall, 2009 Description: How to Study Statistics How should I take notes in class? When taking notes in class, listen actively with the intent to learn from the lecture, and make notes on the slide set you have downloaded and printed from the QA 233 Virtual Classroom websit... Date Added: 2009-06-16 22:35:19 |
| assign.xls Path: LA Tech >> QA >> 525 Fall, 2009 Description: THE NEW ORLEANS PELICANS ASSIGNMENT PROBLEM EXAMPLE Probabilities Of Winning Pitching Assignments Opponent Opponent Pitcher Baton Rouge Mobile Little Rock Montgomery Pitcher Baton Rouge Mobile Jones Baker Parker Wilson 0.6 0.7 0.9 0.5 0.8 0.4 0.8 0.3... Date Added: 2009-06-16 22:35:27 |
| TF9_7.28.pdf Path: SMU - Cox School of Business >> ENGR >> 8361 Fall, 2009 Description: 7.28 project (in order of investment) investment DN (0) 0 E1 360k E2 380k E3 405k MARR = 12% Let CB = current best (defender) Accept DN CB = DN Consider E1 - CB = E1 - DN = E1 RORE1 = 20% > MARR Accept E1 CB = E1 Consider E2 - CB = E2 - E1 RORE2-E1 ... Date Added: 2009-06-16 22:35:59 |
| exam3.pdf Path: Alabama >> CS >> 603 Fall, 2008 Description: CS 603 Exam 3 Spring 2008 Name _ 1. Given this Prolog database: split(P,Q,L) :- append(P,Q,L), alldiff(P,Q). append([ ],Y,Y). append([H|T],Y,[H|Z]) :- append(T,Y,Z). alldiff([ ],[ ]). alldiff([H|T],[X|Y]) :- diff(H,X), alldiff(T,Y). diff(a,b). dif... Date Added: 2009-06-16 22:37:02 |
| food.xls Path: U. Houston >> CUIN >> 3111 Fall, 2008 Description: Food # Spaghetti Pizza Hamburger Hotdog Sandwich 4 8 7 6 3 9 8 7 Number of Students 6 5 4 3 2 1 0 Spaghetti Pizza Our Favorite Foods Column B Hamburger Food Hotdog Sandwich Column B Sandwich ... Date Added: 2009-06-16 22:37:09 |
| Preliminary_Assignment.doc Path: Washington >> GEOG >> 462 Fall, 2008 Description: Final Project Scoping Document Assignment Due: Friday, Nov 7 *Each team must fill out only one form. Team Members (MUST be no more or no less than 3): MEMBER NAME EMAIL SECTION Problem Statement Based on your understanding of the coastal zone gained... Date Added: 2009-06-16 22:40:16 |
| test3practice.ps Path: N. Arizona >> NS >> 226 Fall, 2009 Description: %!PS-Adobe-2.0 %Creator: dvips(k) 5.86 Copyright 1999 Radical Eye Software %Title: test3practice.dvi %Pages: 1 %PageOrder: Ascend %BoundingBox: 0 0 612 792 %EndComments %DVIPSWebPage: (www.radicaleye.com) %DVIPSCommandLine: dvips test3practice.dvi %D... Date Added: 2009-06-16 22:41:15 |
| vectors1.pdf Path: Clemson >> CS >> 405 Fall, 2009 Description: ... Date Added: 2009-06-16 22:49:27 |
| vectors1.pdf Path: Clemson >> CS >> 881 Fall, 2009 Description: ... Date Added: 2009-06-16 22:49:28 |
| hw2.pdf Path: SIU Edwardsville >> CS >> 456 Fall, 2008 Description: CS 456 Homework #2 DUE: Monday, October 16, 2006, in class NO LATE SUBMISSIONS! Answers to the following 5 problems are to be handed in at the beginning of class on 10/16/06. You are to do all 5 problems. 1. Do problem 2 from chapter 4 of the text b... Date Added: 2009-06-16 22:52:38 |
| cho_12_14_06.pdf Path: Texas Tech >> ARCH >> 5384 Fall, 2008 Description: CITY OF LEVELLAND, TEXAS Community Design and Development ASSESSMENT REPORT Report for: MaryAlice Torres-MacDonald Associate Professor Community Design and Development Fall 2006 Debbie Wuerflein Main Street Specialist Levelland Chamber of Commerce... Date Added: 2009-06-16 22:53:43 |
| hw7.pdf Path: Old Dominion >> CS >> 471 Fall, 2008 Description: CS471: Operating System Concepts Spring 2009 (Lecture: T 7:10-9:50 PM) Homework #7 Points: 20 Due: April 14, 2009 Textbook (8th Edition) Question 1 [Points 4] Question 2 [Points 4] Question 3 [Points 4] Question 4 [Points 4] Question 5 [Points 4] 14... Date Added: 2009-06-16 22:55:11 |
| Lecture-Set_7.pdf Path: Wisconsin >> ECE >> 753 Fall, 2009 Description: 2/27/2009 Overview ECE 753: FAULT-TOLERANT COMPUTING Kewal K.Saluja Department of Electrical and Computer Engineering Introduction Motivation and Background Hamming Codes by example SEC-DED Codes Algebraic method SEC-DED Codes Hardware SE... Date Added: 2009-06-16 22:55:47 |
| lec20.ps Path: Rutgers >> CS >> 314 Fall, 2002 Description: %!PS-Adobe-2.0 %Creator: dvips(k) 5.83 Copyright 1998 Radical Eye Software %Title: lec20.dvi %Pages: 15 %PageOrder: Ascend %BoundingBox: 0 0 612 792 %DocumentFonts: CMBX12 CMSY10 CMSS17 CMR17 CMR12 CMTT12 CMMI12 %+ LCIRCLE10 CMTI12 %EndComments %DVIP... Date Added: 2009-06-16 23:02:43 |
| Figure 15 Alignment Conserved Non-Coding Sequence (CNS-3).doc Path: Texas >> JLV >> 1212 Fall, 2009 Description: Figure 15. Alignment of sequences corresponding to conserved non-coding sequence (CNS-3) of striped bass hoxa2a. Conserved Non-Coding Sequence (CNS-3) CNS-3 10 Fugua2b region 3 Oreoa2a region 3 Mousea2 region 3 Moronea2a region 3 Humana2 region 3 He... Date Added: 2009-06-16 23:03:21 |
| Review Session.pdf Path: Oregon >> ECON >> 101 Fall, 2009 Description: Review Session Wednesday March, 19th in PLC 180 from 4:00-5:50PM ... Date Added: 2009-06-16 23:04:17 |
| thorton dial.doc Path: U. Houston >> ELED >> 4320 Fall, 2009 Description: Candy Carl HISD Cluster Social Studies Professional Development Opportunity A professional development opportunity is the chance to gain knowledge, and enhance skill in a particular profession in order to develop growth. Professional development oppo... Date Added: 2009-06-16 23:04:21 |
| IEEE Abbreviations.pdf Path: University of Illinois, Urbana Champaign >> ECE >> 469 Fall, 2008 Description: APPENDIX VII Recommended Unit Symbols, SI Prefixes, and Abbreviations A. Recommended Unit Symbols Multiple 10 1021 1018 1015 1012 109 106 103 102 10 10-2 10-2 10-3 10-6 10-9 10-12 10-15 10-18 10-21 10-24 B. 24 TABLE I SI PREFIXES The following stan... Date Added: 2009-06-16 23:04:48 |
| Structural Subsystem Design 09.pdf Path: UNC Charlotte >> ENGR >> 1201 Fall, 2008 Description: XLIX Engineering Design Firm 9201 University City Blvd Charlotte, NC 28223 Structural Subsystem Design Project Background Charlotte Rides, Inc. has specified that the Structural Subsystem Design must be tested by the use of a scale model beam built ... Date Added: 2009-06-16 23:04:52 |
| NP.pdf Path: Wilfrid Laurier >> CPSC >> 413 Fall, 2009 Description: CPSC 413 - Fall, 2000 Polynomial-Time Verification, N P, and N P-Completeness December, 2000 Material in this handout was discussed in lectures on Thursday, November 30. 1 Introduction At this point we have seen a way to relate the computational ... Date Added: 2009-06-16 23:06:48 |
| executive_summary.pdf Path: Maine >> ELC >> 200 Fall, 2009 Description: E X E C U T I V E S U M M A R Y Executive Summary Our Nation\'s critical infrastructures are composed of public and private institutions in the sectors of agriculture, food, water, public health, emergency services, government, defense industrial ba... Date Added: 2009-06-16 23:09:45 |
| argumentprompt.doc Path: N. Arizona >> CM >> 398 Fall, 2009 Description: Essay#3: Argument Paper & Collaborative Presentation English 105 Objective: To enable students to learn how to work on a collaborative writing project. This project represents a teamwork approach that is often used in the workplace. It is the resp... Date Added: 2009-06-16 23:10:07 |
| daniela_stelwin.pdf Path: Toledo >> AST >> 1410 Fall, 2009 Description: Stellar Interiors Models Overview 1. 2. 3. 4. 5. 6. 7. Internal structure equations Constitutive relations Boundary conditions Polytropes Shooting Method Henyey Method Results Equations of structure 1) Hydrostatic Equilibrium 2) Conservation of Mas... Date Added: 2009-06-16 23:10:55 |
| Lab4.pdf Path: Minnesota >> GEO >> 4501 Fall, 2008 Description: Geo 4501: Structural Geology TA: Elisa Fitz-Diaz, Rory McFadden Lab 4 Finite strain In order to quantify internal deformation in rocks a number of methods have been proposed since the 1960\'s. Some of them are based on the measurement of distortion ... Date Added: 2009-06-16 23:11:12 |
| SSRD_IOC2_S05B_T13_1.5.pdf Path: USC >> CSCI >> 577 Fall, 2009 Description: ! \" # $ % ;# + 3 \'! + + 6+ 2 6+ - 7 > > > ) ) ! 6+) ) > ... Date Added: 2009-06-16 23:12:37 |
| pset_4.pdf Path: UNC >> PLCY >> 289 Fall, 2008 Description: PLCY 289 Microeconomic Theory for Public Policy Analysis Problem Set 4 1. The inverse demand for colored chalk is given by P(Q)=100-2Q where Q is total market quantity, and total cost of production is 4Q. a. If the market is perfectly competitive wha... Date Added: 2009-06-16 23:13:24 |
| CET3220-S04_Class_Detention.pdf Path: Toledo >> CET >> 3220 Fall, 2008 Description: UNIVERSITY OF TOLEDO THE COLLEGE OF ENGINEERING ENGINEERING TECHNOLOGY DEPT. Stormwater Detention Example Inflow Hydrograph CET-3220 HYDROLOGY & HYDRAULICS PAGE 1 UNIVERSITY OF TOLEDO THE COLLEGE OF ENGINEERING ENGINEERING TECHNOLOGY DEPT. Dete... Date Added: 2009-06-16 23:13:27 |
| 3.6.ppt Path: University of Louisville >> GRBARN >> 107 Fall, 2009 Description: 3.6 Two Applications Application 1: Wassily Leontief \"open\" input-output models \"closed\" model - all the goods produced are used by the producers \"open\" model more goods are produced than is needed by the produces, the extra output is available to t... Date Added: 2009-06-16 23:15:37 |
| Syllabus.ps Path: Maryland >> ENEE >> 244 Fall, 2008 Description: %!PS-Adobe-2.0 %Creator: dvipsk 5.58f Copyright 1986, 1994 Radical Eye Software %Title: outlf00.dvi %Pages: 2 %PageOrder: Ascend %BoundingBox: 0 0 612 792 %DocumentPaperSizes: Letter %EndComments %DVIPSCommandLine: dvips outlf00 %DVIPSParameters: dpi... Date Added: 2009-06-16 23:16:51 |
| abr12z.txt Path: University of Illinois, Urbana Champaign >> ATMOS >> 20090402 Fall, 2009 Description: UPPER AIR CALCULATIONS AND PLOTTING (Ver 5.49-LINUX-X11) Current filename: /mnt/noaaport/nwstg/convert/09040200_upa.wxp Date: 0000Z 2 APR 09 Searching for KABR. Searching the city database file for: KABR . Date:0000Z 2 APR 09 Station: KABR W... Date Added: 2009-06-16 23:18:38 |
| Han - Tech3.pdf Path: Penn State >> YXH >> 150 Fall, 2009 Description: SMEAL COLLEGE OF BUSINESS BUILDING University Park, PA Yena K. Han The Pennsylvania State University Architectural Engineering, Lighting/Electrical Faculty Advisor: Richard G. Mistrick, Ph.D., P.E., FIES 05 DEC 2008 BUILDING OVERVIEW ARCHITECTS Bow... Date Added: 2009-06-16 23:23:02 |
| Ch06_PChem_modified [Compatibility Mode].pdf Path: Alabama >> CH >> 342 Fall, 2008 Description: Chapter 6: Chemical Equilibrium It was shown in the previous chapter that the direction of spontaneous change for a process is predicted by S +Ssurroundings > 0. In this Chapter, this spontaneity criterion is 0 Chapter used to determine two new stat... Date Added: 2009-06-16 23:24:37 |
| Ch 36 notes.pdf Path: Alabama >> CH >> 342 Fall, 2008 Description: Chapter 36: Elementary Chemical Kinetics Chemical kinetics involves the study of the rates and mechanisms of chemical reactions, Thermodynamic descriptions of chemical reactions involves the Gibbs or Helmholtz energy for a reaction and the correspo... Date Added: 2009-06-16 23:24:38 |
| Greenlake.road.pdf Path: Washington >> OPEN >> 2100 Fall, 2009 Description: ... Date Added: 2009-06-16 23:28:16 |
| quiz3.pdf Path: Indiana State >> CARBON >> 106 Fall, 2009 Description: ... Date Added: 2009-06-16 23:30:51 |
| 20040907 Tuesday ugis 147b lecture.doc Path: Berkeley >> UGISC >> 147 Fall, 2009 Description: 1 of 5 418b9e232a551851b291a0d52858ab787d155a2d.doc 20040907 Tuesday ugis 147b lecture martin manalansan googling hobby asian American aids 1988 demolished idea of wgm only cases of aids late 80s was turn - more people of color - more lower class - m... Date Added: 2009-06-16 23:32:34 |
| 325-ch01b.pdf Path: Mt. Holyoke >> HOME >> 325 Fall, 2009 Description: Highlights from Ch 1 (continued) http:/physics.syr.edu/courses/video/RightHandRule/ ... Date Added: 2009-06-16 23:32:46 |
| stepper motor.pdf Path: Minnesota >> ME >> 3222 Fall, 2008 Description: Stepper motor Stepper Motor Produces rotation through equal angles (step) for each digital pulse input. it is a digital device. It can not rotate continuously Easy interface with a computer. Can be up to about 1 HP. Kind of between a DC motor and a... Date Added: 2009-06-16 23:33:04 |
| lab10.pdf Path: CSU Stanislaus >> CS >> 3850 Fall, 2009 Description: CS 3850-Object-Oriented Programming California State University, Stanislaus R. L. Zarling Winter, 2006 Laboratory 10: Wednesday, February 1 (Optional - not to be turned in) lab10a.cpp: reading the spelling dictionary To improve the spelling checker ... Date Added: 2009-06-16 23:34:20 |
| bwlec2.ps Path: University of Illinois, Urbana Champaign >> CS >> 475 Fall, 2008 Description: %!PS-Adobe-2.0 %Creator: dvips(k) 5.94b Copyright 2004 Radical Eye Software %Title: lectures.dvi %CreationDate: Thu Aug 24 10:06:25 2006 %Pages: 25 %PageOrder: Ascend %Orientation: Landscape %BoundingBox: 0 0 596 842 %DocumentFonts: CMBX12 CMR8 CMTT8... Date Added: 2009-06-16 23:34:45 |
| E751_ps3_ret_ans.pdf Path: Wisconsin >> E >> 751 Fall, 2009 Description: Economics 751: Problem Set 3 Solution This problem set investigates the properties of the simple life cycle model of labor supply presented in class. We explore these properties in the context of retirement decisions. Individuals live three periods, ... Date Added: 2009-06-16 23:36:20 |
| HW1.pdf Path: UF >> STA >> 6166 Summer, 2008 Description: ... Date Added: 2009-06-16 23:37:09 |
| sh070729_engMaskCheck01.ps Path: Wisconsin >> TC >> 070729 Fall, 2009 Description: %!PS-Adobe-3.0 %Creator: MATLAB, The Mathworks, Inc. %Title: sh070729_engMaskCheck01.ps %CreationDate: 08/05/2007 10:57:18 %DocumentNeededFonts: Helvetica %DocumentProcessColors: Cyan Magenta Yellow Black %LanguageLevel: 2 %Pages: (atend) %BoundingBo... Date Added: 2009-06-16 23:37:20 |
| Estimation and Tests of Population Proportion (I).pdf Path: UF >> STA >> 6166 Summer, 2008 Description: ESTIMATION AND TESTING POPULATION PROPORTIONS 1 INTERVAL ESTIMATION OF THE POPULATION PROPORTION Recall the binomial experiment in which we randomly select individuals from a population and record, for each individual, which of two categories they... Date Added: 2009-06-16 23:37:37 |
| PS5AK.pdf Path: UCSC >> ECON >> 100 Fall, 2009 Description: Economics 100B Intermediate Macroeconomics Kuntal Kumar Das Problem Set 5 Answer Key 1. Problem 6, Chapter 14 of Blanchard a. b. $V=$100/0.1=$1000 Since the first payment occurs at the end of the year, $V = $z[1- 1/(1+i)n]/[1-(1+i)] - $z. 10 years: $... Date Added: 2009-06-16 23:38:49 |
| Dummy Variables Overview.doc Path: UCSB >> ESM >> 206 Fall, 2008 Description: Dummy Variables Overview Case: Two Nominal Independent Variables (and one continuous) y = Number of species in country i Independent Variables: Island or Mainland Continent (Asia, Africa, or South America) Population (continuous) Model: yi= 0+ 1Isla... Date Added: 2009-06-16 23:39:15 |
| LabWeek3.ppt Path: UCSB >> ESM >> 206 Fall, 2008 Description: vti_encoding:SR|utf8-nl vti_syncofs_www2.bren.ucsb.edu\\:21/~alloret/public_html:TW|15 Apr 2004 15:10:00 -0000 vti_timelastmodified:TR|29 Mar 2005 18:49:03 -0000 vti_title:SR|Presentacin de PowerPoint vti_syncwith_www2.bren.ucsb.edu\\:21/~alloret/publi... Date Added: 2009-06-16 23:39:35 |
| ec130hw1p.pdf Path: Rose-Hulman >> EC >> 130 Fall, 2009 Description: Homework 1 Problem 1 Convert the following unsigned binary numbers to decimal. a) 100110.101 b) 001110.01 Problem 2 Convert the following decimal numbers to binary. Please use 6 bits for the binary places to the left and 4 to the right of the binar... Date Added: 2009-06-16 23:40:28 |
| catching-cold-ACE.pdf Path: N.E. Illinois >> UX >> 4900 Fall, 2009 Description: CAN EXERCISE REDUCE YOUR RISK OF CATCHING A COLD? Sir William Osler, the famous Canadian medical doctor, once quipped, \"There\'s only one way to treat the common cold - with contempt.\" And for good reason. The average adult has two to three respirator... Date Added: 2009-06-16 23:41:21 |
| Untitled-11.pdf Path: Georgia Tech >> GTG >> 396 Fall, 2009 Description: 010100001010 000000111101 1 0100101011100 11 001101011001100 01 1000001101001010100 001 00011010100000011111 1101 100010111010101010010 001100 1001100101101011110010 1101010 011011010110101101011011 0000011101 010 000101010101000111001011 00010101010... Date Added: 2009-06-16 23:43:07 |
| jvm.jcov.txt Path: Georgia Tech >> GTG >> 0127 Fall, 2009 Description: version : @(#)jvm.jcov.txt 1.2 01/07/13 JCOV support in JDK1.3 and later Up to JDK1.2.x Jcov runtime support has been an integral part of the debug version of the Javasoft\'s JVM, therefore it could not work with any other JVMs. In JDK1.3 all Jcov ... Date Added: 2009-06-16 23:44:51 |
| worklog.pdf Path: CSU San Marcos >> EDUC >> 422 Fall, 2009 Description: Name: Project Title: Daily Work Log Date: Hours worked: Description of work completed: Date: Hours worked: Description of work completed: Date: Hours worked: Description of work completed: Date: Hours worked: Description of work completed: Date:... Date Added: 2009-06-16 23:45:13 |
| Proofs-1A.pdf Path: Adelphi >> M >> 301 Fall, 2009 Description: Introduction to Proofs Section 1.1 Preview Conditional Statements (Due: Wednesday, 4 February.) Read through this section (pages 1 - 10). Keep in mind the difference between a sentence and a statement, and write up answers to Preview Activity 1. \"Te... Date Added: 2009-06-16 23:45:31 |
| Water unit overview.pdf Path: Lehigh >> RER >> 205 Spring, 2009 Description: Rajika E. Reed, MPH Water Unit Overview 7th Grade Environmental Science I Content Outline Students will review the water cycle, understand where our water resources lie, and learn about how pollution affects the water within our watershed. A. Overar... Date Added: 2009-06-16 23:46:10 |
| 9007BC.pdf Path: Michigan State University >> LIB >> 1990 Fall, 2009 Description: USGA GREEN SECTION RECORD JULY/AUGUST 1990 TURF TWISTERS GO \"LOW-TECH\' Question: I have a new, well-designed irrigation system but still have dry areas on knolls in some greens and fairways. Any ideas? (Michigan) Answer: Go Low-Tech and occasionally... Date Added: 2009-06-16 23:46:45 |
| Lecture11.ppt Path: Stanford >> ECON >> 216 Fall, 2009 Description: Economics 216: The Macroeconomics of Development Lawrence J. Lau, Ph. D., D. Soc. Sc. (hon.) Kwoh-Ting Li Professor of Economic Development Department of Economics Stanford University Stanford, CA 94305-6072, U.S.A. Spring 2000-2001 Email: ljlau@stan... Date Added: 2009-06-16 23:46:56 |
| pdpta2009-draft-4.pdf Path: Trinity U >> CSCI >> 3352 Fall, 2009 Description: Hybrid Parallelization of N-body Simulations Involving Collisions and Self-Gravity Mark C. Lewis, Matthew Maly, and Berna L. Massingill Department of Computer Science, Trinity University, San Antonio, TX, USA Abstract This paper explores the relati... Date Added: 2009-06-16 23:50:08 |
| Lecture6.pdf Path: Maryville MO >> ECE >> 4220 Fall, 2009 Description: ... Date Added: 2009-06-16 23:50:27 |
| 060122_ZPD256F02.pdf Path: Wisconsin >> SH >> 060122 Fall, 2009 Description: 16384 12288 8192 4096 0 -4096 -8192 -12288 -16384 17.7 060122; Scan dir: forward Signed ZPD Magnitude (256 point unfiltered), assuming ZPD at Max(IFG) LW band HBB ABB Zenith Earth 18.72 19.74 20.76 21.78 22.8 16384 12288 8192 4096 0 -4096 -819... Date Added: 2009-06-16 23:51:47 |
| 06012214.pdf Path: Wisconsin >> SH >> 060122 Fall, 2009 Description: ... Date Added: 2009-06-16 23:52:03 |
| 3140-proposal.rtf Path: Weber >> FACULTY >> 3140 Fall, 2009 Description: TheProposal Thisassignmentasksyou(yourgroup,collaboratively)tocreateaformalrequest toworkonthefinaltechnicaleditingproject.Includeaworkplan,task breakdown,timeschedule,andestimatedbudget. ProposalOverview Aproposalmakesanoffer.Inaproposalyouproposeto... Date Added: 2009-06-16 23:53:00 |
| YCR073C.t2k.dssp-ehl2-logo.pdf Path: UCSC >> YCR >> 073 Fall, 2009 Description: YCR073C.t2k DSSP-EHL2 2 1 1 10 20 30 40 2 1 CCCCCCCCCCCCCC C E E E E C C C X X X X X X X X X X X X X X X C C X X X X X X H H C H C C C C C C C X X X X X X X X X H HHCCCCCCCCCCC H H H C C C C C H X X X X X X X X X X X X X X X X C C C X X X ... Date Added: 2009-06-16 23:56:18 |
| YCR008W.t2k.alpha-logo.pdf Path: UCSC >> YCR >> 008 Fall, 2009 Description: YCR008W.t2k ALPHA 3 2 1 B E B S E S XXXXXXXXXXXXXXXXXXXX B E H E B B B H B E B C B H B E X X X H E E XXXXXXXXXXXXXXXXXXXXXXXXXXX B B B B H E B E B B S H B B H E B E E B B B C B B E E B E E B 1 10 20 30 40 E 3 2 1 B S H E ... Date Added: 2009-06-16 23:56:29 |
| hw10.pdf Path: Johns Hopkins >> C >> 171 Fall, 2008 Description: ... Date Added: 2009-06-16 23:57:14 |
| class5.pdf Path: Laurentian >> IDST >> 200701 Fall, 2009 Description: IDST 2008A Class-5 (Jan.18, 2007) Regions and cities in Japan (continued) Regions and cities in Japan ( 4. Kanto 5. Chubu 6. Kinki 7. Chugoku 8. Shikoku 9. Kyushu Practice(2) Districts, Prefectures and capitals of Pref. ... Date Added: 2009-06-16 23:57:23 |
| Web Principles.ppt Path: U. Houston >> CUIN >> 7316 Fall, 2008 Description: Web Design Principles Designing Text Bad Good The evil Scroll Bad Good Color Harmony Bad Good The Homepage Bad Good X Errors! Just plain horrible Bad Good ... Date Added: 2009-06-16 23:59:12 |
| Chap17.ppt Path: MSCD >> CMS >> 071 Fall, 2009 Description: Chapter 17 User Interface Design McGrawHill/Irwin Copyright 2007 by The McGrawHill Companies, Inc. All rights reserved. System User Classifications Expert User an experienced computer user Spends considerable time using specific application pr... Date Added: 2009-06-16 23:59:29 |
| destination.doc Path: CSU Northridge >> GAH >> 8920 Fall, 2009 Description: Food Item: Butter - Stick Saturated Fat (g): 57.3 Cholesterol (mg): 247 Food Item: Cream sour cultured Saturated Fat (g): 30 Cholesterol (mg): 102 Food Item: Duck meat only roasted Saturated Fat (g): 9.2 Cholesterol (mg): 198 Food Item: Egg Nog comme... Date Added: 2009-06-16 23:59:36 |
| botup_may07_v05-minimal.xls Path: Stanford >> SLAC >> 20070515 Fall, 2009 Description: Notes To-do-list Input 20. Feb 07 Gregory 15. Feb 07 Gregory Input Input 21. Jan 07 Gregory Input ProductionII 21. Jan 07 Gregory CostsII 19. Jan 07 Gregory FundingII 23. Dec 06 Gregory LumChart Luminosity 18. Dec 06 Fergus LumChart Page... Date Added: 2009-06-17 00:01:05 |
| L17_Managerial communication [Read-Only].pdf Path: Allan Hancock College >> BUSN >> 8030 Fall, 2009 Description: Communication Chapter 17 Managerial Communication and Interpersonal Skills Communication is defined as the transferring and understanding of meaning. Robbins, Bergman, Stagg, Coulter: Management 4e 2006 Pearson Education Australia Robbins, Bergma... Date Added: 2009-06-17 00:03:11 |
| NCAAinfo.txt Path: Virginia Tech >> CS >> 1044 Fall, 2000 Description: year 1988 2 year 1990 1 year 1986 1 titles Tennessee titles Virginia Tech margin 1985 5 margin 1990 10 ... Date Added: 2009-06-17 00:04:27 |
| final.ps Path: Minnesota >> STAT >> 3011 Fall, 2008 Description: %!PS-Adobe-2.0 %Creator: dvips(k) 5.86 Copyright 1999 Radical Eye Software %Title: final.dvi %Pages: 8 %PageOrder: Ascend %BoundingBox: 0 0 612 792 %EndComments %DVIPSWebPage: (www.radicaleye.com) %DVIPSCommandLine: dvips -o final.ps final %DVIPSPara... Date Added: 2009-06-17 00:09:26 |
| week2.pdf Path: Toledo >> CSC >> 263 Fall, 2009 Description: 2-3-4 Trees See section 3.3.2 in the GT text. A 2-3-4 tree (also called a (2,4) tree) is similar to a BST in that it stores values in the internal nodes and has a property relating the values stored in a subtree to the values in the parent node. b... Date Added: 2009-06-17 00:12:15 |
| INTRO144.pdf Path: Neumont >> INSTRU >> 004 Fall, 2009 Description: FONDS D\'ARCHIVES NO 144 Rpertoire numrique dtaill du fonds Yvon LeBlanc (1920-1982) Lewis LeBlanc Centre d\'tudes acadiennes Universit de Moncton 1991 INTRODUCTION Survol historique L\'architecte acadien, Yvon LeBlanc, est le fils d\'Emilie Landry de M... Date Added: 2009-06-17 00:14:20 |
| INTRO144.pdf Path: Neumont >> INSTRU >> 144 Fall, 2009 Description: FONDS D\'ARCHIVES NO 144 Rpertoire numrique dtaill du fonds Yvon LeBlanc (1920-1982) Lewis LeBlanc Centre d\'tudes acadiennes Universit de Moncton 1991 INTRODUCTION Survol historique L\'architecte acadien, Yvon LeBlanc, est le fils d\'Emilie Landry de M... Date Added: 2009-06-17 00:14:21 |
| MA-IX140.pdf Path: Neumont >> INSTRU >> 004 Fall, 2009 Description: INDEX DU FONDS NO 140: MANUSCRITS Activits franaises inc., 140.46 Activits franaises (revue), 140.46 Anti-Nazisme (brochures), 140.58 Articles divers, 140.47 Association acadienne d\'ducation (A.A.E.), 140.7, 140.17 Association canadienne des ducateur... Date Added: 2009-06-17 00:14:31 |
| MA-IX140.pdf Path: Neumont >> INSTRU >> 140 Fall, 2009 Description: INDEX DU FONDS NO 140: MANUSCRITS Activits franaises inc., 140.46 Activits franaises (revue), 140.46 Anti-Nazisme (brochures), 140.58 Articles divers, 140.47 Association acadienne d\'ducation (A.A.E.), 140.7, 140.17 Association canadienne des ducateur... Date Added: 2009-06-17 00:14:31 |
| Prob55pg4.pdf Path: Maryland >> PHYS >> 601 Fall, 2008 Description: ... Date Added: 2009-06-17 00:15:27 |
| DLN134pg1.pdf Path: Maryland >> PHYS >> 601 Fall, 2008 Description: ... Date Added: 2009-06-17 00:15:44 |
| dos-th213.pdf Path: Neumont >> INSTRU >> 005 Fall, 2009 Description: Fonds d\'archives no 213 Rpertoire numrique dtaill de fonds Anselme-Chiasson (1788-2003) DOSSIERS THMATIQUES, 1788-2002, 193,5 CM Cette srie qui comprend plus de la moiti du fonds dmontre les intrts du pre Anselme sur divers sujets. Titres bass sur le... Date Added: 2009-06-17 00:17:22 |
| Poker Example (1).xls Path: Tarleton >> M >> 311 Fall, 2009 Description: Poker Example x 0 1 2 3 4 f(x) 0.66 0.3 0.04 0 0 Relative Frequency(x) 0.63 0.32 0.05 0 0 0.7 0.6 0.5 0.4 0.3 0.2 0.1 0 0 1 2 3 Column B Column B Column C 2 3 4 ... Date Added: 2009-06-17 00:18:18 |
| Week 6 LGM 09A.ppt Path: Washington >> OCEAN >> 450 Fall, 2008 Description: Reservoir Exchange Rates Gigatons C/yr or Pg C/yr 1 CO2 flux to/from the oceans is NOT uniform. Some areas have input, some have output. 2 WHY are some areas of the oceans a SINK for atmospheric CO2? WOCE World Ocean Climate Experiment systema... Date Added: 2009-06-17 00:24:52 |
| dm-stat.ps Path: Maryland >> CMSC >> 828 Fall, 2005 Description: %!PS-Adobe-2.0 %Creator: dvipsk 5.58f Copyright 1986, 1994 Radical Eye Software %Title: mining.dvi %Pages: 7 %PageOrder: Ascend %BoundingBox: 0 0 612 792 %EndComments %DVIPSCommandLine: dvips mining.dvi -o %DVIPSParameters: dpi=600, compressed, comme... Date Added: 2009-06-17 00:25:34 |
| textmining.ppt Path: Maryland >> CMSC >> 828 Fall, 2005 Description: An Overview of Text Mining Rebecca Hwa 4/25/2002 References M. Hearst, Untangling Text Data Mining, in the Proceedings of the 37th Annual Meeting of the Association for Computational Linguistics, 1999. E. Riloff and R. Jones, Learning Dictionaries ... Date Added: 2009-06-17 00:25:38 |
| 11.2.xls Path: Stanford >> BIO >> 141 Fall, 2009 Description: mature 2yr old mature 2yr old column mean (col mean GM)^2 DATA VALUES Canadian Guernsey HolsteinFriesian Jersey 3.74 3.92 4.54 3.4 4.01 4.95 5.18 3.55 3.77 4.47 5.75 3.83 3.78 4.28 5.04 3.95 4.1 4.07 4.64 4.43 4.06 4.1 4.79 3.7 4.27 4.38 4.72 3.3... Date Added: 2009-06-17 00:27:04 |
| serial cancellations 05.pdf Path: East Los Angeles College >> USERS >> 041117 Fall, 2009 Description: Joint LES/MPS Committee on Library Policy in the Sciences PLANT SCIENCES LIBRARY SUB-COMMITTEE Serial cancellations 2005 The following titles will not be received in hard copy in Plant Sciences from Jan 2005; they will remain available in print in t... Date Added: 2009-06-17 00:28:31 |
| SOFTWARE.xls Path: East Los Angeles College >> USERS >> 020530 Fall, 2009 Description: Sheet1 vti_encoding:SR|utf8-nl vti_timelastmodified:TR|05 Jun 2003 00:00:00 -0000 vti_extenderversion:SR|6.0.2.6353 vti_author:SR|PLS11\\PLSSTAFF vti_modifiedby:SR|PLS11\\PLSSTAFF vti_timecreated:TR|05 Jun 2003 00:00:00 -0000 vti_backlinkinfo:VX| vti_c... Date Added: 2009-06-17 00:28:55 |
| cy3210_an2011_.pdf Path: Idaho >> ECE >> 340 Fall, 2008 Description: Application Note AN2011 Design Aids - CY3210 PSoCEval1 and MiniEval1 Development Board Example Projects - AN2011 By: Jay L. Jedinak Associated Project: No Associated Part Family: CY8C24x94, CY8C27x43, CY8C29x66 GET FREE SAMPLES HERE Associated Appl... Date Added: 2009-06-17 00:29:30 |
| hw3.ppt Path: Texas >> CS >> 378 Fall, 2008 Description: <?xml version=\"1.0\" encoding=\"UTF-8\"?> <Error><Code>NoSuchKey</Code><Message>The specified key does not exist.</Message><Key>4169c5c5a2fce8c0830164b2f0289e33c4fae893.ppt</Key><RequestId>A 6F100C7D599E206</RequestId><HostId>OgT7rxV9gDUa9elieHoPoihnr5a... Date Added: 2009-06-17 00:29:51 |
| snew8.pdf Path: ECCD >> LEC >> 4700 Fall, 2009 Description: LECTURE 8 1.9 \"Electron in a Box\" Revisited We find that if the walls of the box have finite height the behavior is quantized with \"smearing\" due to tunneling. We have as the potential energy: V(x) Vo E electron energy x -L/2 L/2 and for E < Vo (c... Date Added: 2009-06-17 00:31:52 |
| hydraulic.pdf Path: Stetson >> GPA >> 754 Fall, 2009 Description: ControlLogix Hydraulic Servo Module 1756-HYD02 User Manual Important User Information Because of the variety of uses for the products described in this publication, those responsible for the application and use of these products must satisfy thems... Date Added: 2009-06-17 00:32:52 |
| retail marketing.doc Path: Allan Hancock College >> HM >> 615 Fall, 2009 Description: PRACTICALITIESOFRETAILING Marketing vs Selling What is the difference between marketing and selling? Marketing is finding out what kind of a product a specific type of person (a target market) is interested in, and establishing how best to satisfy th... Date Added: 2009-06-17 00:32:59 |
| in2.txt Path: Portland >> CS >> 333 Winter, 2008 Description: twotwo... Date Added: 2009-06-17 00:33:01 |
| Rudd_Whelan_pcurve.pdf Path: Berkeley >> ECON >> 161 Fall, 2008 Description: New Tests of the New-Keynesian Phillips Curve Jeremy Rudd and Karl Whelan Division of Research and Statistics Federal Reserve Board June 26, 2001 Abstract Is the observed correlation between current and lagged ination a function of backward-looking... Date Added: 2009-06-17 00:33:18 |
| Idiopathic_Disease.doc Path: Penn State >> JLS >> 908 Fall, 2009 Description: Joshua Seville Idiopathic Hypotonia PT 100 9/30/07 Idiopathic Hypotonia Idiopathic Hypotonia is a disease that causes decreased muscle tone. This disease can cause infants to feel like a \"rag doll.\" Hypotonia affects infants in many different ways.... Date Added: 2009-06-17 00:33:44 |
| spring_lecture13_outline.txt Path: Washington >> PSYCH >> 400 Fall, 2009 Description: <?xml version=\"1.0\" encoding=\"UTF-8\"?> <Error><Code>NoSuchKey</Code><Message>The specified key does not exist.</Message><Key>415b11f8b3b3db845262d47bd3ef569cd655bd0c.txt</Key><RequestId>A500B37853C20DDC</RequestId><HostId>0OIJWCSavs/p4eZhaJWUCMKmrzRX... Date Added: 2009-06-17 00:35:22 |
| simulation_assinment.doc Path: Washington >> INFO >> 311 Spring, 2008 Description: vti_encoding:SR|utf8-nl vti_timelastmodified:TR|31 Oct 2004 09:18:29 -0000 vti_extenderversion:SR|6.0.2.6353 vti_author:SR|ISCHOOL\\shuhual vti_modifiedby:SR|ISCHOOL\\shuhual vti_timecreated:TR|31 Oct 2004 02:39:55 -0000 vti_title:SR|Leading Discussion... Date Added: 2009-06-17 00:35:25 |
| spring_lecture39_outline.txt Path: Washington >> PSYCH >> 400 Fall, 2009 Description: Lecture 39 Outline I. Evidence for the importance of contiguity of response and reinforcer in operant conditioning A. Detrimental effects of introducing a delay between the response and the reinforcer in T-maze studies 1. Wolfe (1934) stu... Date Added: 2009-06-17 00:35:59 |
| ln_anis_examples.pdf Path: BYU >> ECE >> 560 Fall, 2009 Description: ... Date Added: 2009-06-17 00:36:04 |
| TheProjectGutenbergEtext.The_Secret_Garden.modified.docx Path: UNC >> INLS >> 261 Fall, 2008 Description: THE SECRET GARDEN BY FRANCES HODGSON BURNETT Table of Contents 2 THE SECRET GARDEN CHAPTER I THERE IS NO ONE LEFT When Mary Lennox was sent to Misselthwaite Manor to live with her uncle everybody said she was the most disagreeable-looking child e... Date Added: 2009-06-17 00:37:07 |
| courseList_h.txt Path: CSU Chico >> CSCI >> 151 Fall, 2009 Description: /* / / Filename : courselist_h / Programmer : John Doe / / This is the specification file for the doubly-linked list courseList / / /** PSEUDOCODE FOR SPECIFICATION FILE courselist.h class courseList private members courseNode *headPtr ... Date Added: 2009-06-17 00:38:25 |
| Sem3v212ch3revu.ppt Path: Youngstown >> CSIS >> 3783 Spring, 2008 Description: <?xml version=\"1.0\" encoding=\"UTF-8\"?> <Error><Code>NoSuchKey</Code><Message>The specified key does not exist.</Message><Key>4157a4802066f55a67e94c58fcee128adbb72d6b.ppt</Key><RequestId>F 5AF2063099E6AE0</RequestId><HostId>/CIgXC51IwUxXCo2hpS06ORE25Y... Date Added: 2009-06-17 00:39:04 |
| xrt.txt Path: Berkeley >> ASTRO >> 00278854 Fall, 2009 Description: <?xml version=\"1.0\" encoding=\"UTF-8\"?> <Error><Code>NoSuchKey</Code><Message>The specified key does not exist.</Message><Key>41cc33cb76206da26d2a7783d4492940840e8d06.txt</Key><RequestId>67729C3A5A7D3CE0</RequestId><HostId>Eiqluuw2hdQO1Rs5r1Y02H66GY9o... Date Added: 2009-06-17 00:40:55 |
| ps3.pdf Path: University of Illinois, Urbana Champaign >> ECON >> 102 Fall, 2008 Description: Economics 102 Principles of Microeconomics Introduction to Economics Juha Seppl aa Fall 2003 Problem Set 3 Due Tuesday, November 4 in class! Each question is worth 5 points. 1. Mankiw (2004), Question 10.5 2. Mankiw (2004), Question 11.8 3. Mankiw ... Date Added: 2009-06-17 00:41:26 |
| lect-SQL3.pdf Path: W. Alabama >> UWCS >> 338 Fall, 2009 Description: SQL Part 3: Where Subqueries and other Syntactic Sugar Part 4: Unknown Values and NULLs University of Waterloo 1-1 List of Slides 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 More on \"where\" conditions Esoteric Predicates: Exa... Date Added: 2009-06-17 00:45:10 |
| T0399.t2k.dssp-ehl2-logo.pdf Path: UCSC >> T >> 0399 Fall, 2009 Description: T0399.t2k DSSP-EHL2 2 1 1 10 20 30 40 H 2 1 T T H 51 60 70 80 90 T 2 1 E T H E T E 101 110 120 130 140 T S E 2 1 T E H T T S H T H 151 160 170 180 190 E 2 1 T E T S T E T E 201 TQ K DLE T 200 VE K LG... Date Added: 2009-06-17 00:45:52 |
| HW_Eigen_functions.pdf Path: UMass (Amherst) >> ECE >> 697 Fall, 2009 Description: Janaswamy University of MassachusettsAmherst Electrical & Computer Engineering ECE 697OO HW#5, Due 5/28/09 Eigenfunctions and Green\'s Functions 1 (50+50 points) 1. Consider the transformation defined by L = -d2 /dx2 and the boundary conditions u(0... Date Added: 2009-06-17 00:49:45 |
| Lec1.pdf Path: UCSC >> CMPE >> 163 Fall, 2008 Description: Department of Computer Engineering University of California at Santa Cruz CMPE 163 Multimedia Processing and Applications Hai Tao Dept. of Computer Engineering Univ. of California, Santa Cruz Department of Computer Engineering University of Califo... Date Added: 2009-06-17 00:50:23 |
| YDR466W.t2k.alpha-logo.pdf Path: UCSC >> YDR >> 466 Fall, 2009 Description: YDR466W.t2k ALPHA 3 2 1 H E XXXXXXXXXXSXXXABSX X X X X E H 1 10 20 30 40 E 3 2 1 H B E B H E B A D B A D S D E A E A E A E S G S B E B H H H X X 51 60 70 80 90 B H 3 2 1 B S E H S E A E A G S E A E B G S B H HHH X X X ... Date Added: 2009-06-17 00:50:59 |
| hymn-ifIcan.pdf Path: Ill. Chicago >> PHYS >> 511 Fall, 2008 Description: ... Date Added: 2009-06-17 00:52:56 |
| NetworkedBasedEvidence.ppt Path: Santa Clara >> COEN >> 252 Fall, 2009 Description: <?xml version=\"1.0\" encoding=\"UTF-8\"?> <Error><Code>NoSuchKey</Code><Message>The specified key does not exist.</Message><Key>4192d919652a97d2d40bf68d1de0e18357430c81.ppt</Key><RequestId>B 8C607FC240FE1E4</RequestId><HostId>NVKxMELxwmT3x5D5Zug/HsR8/+A... Date Added: 2009-06-17 00:53:22 |
| NTFSFS.ppt Path: Santa Clara >> COEN >> 252 Fall, 2009 Description: vti_encoding:SR|utf8-nl vti_timelastmodified:TR|13 Nov 2004 06:42:00 -0000 vti_extenderversion:SR|5.0.2.6417 vti_backlinkinfo:VX|TS\\ Main/coen252_04/ln.html vti_author:SR|BOBADILLA\\Thomas Schwarz vti_modifiedby:SR|BOBADILLA\\Thomas Schwarz vti_timecre... Date Added: 2009-06-17 00:53:22 |
| 143Ct3soln.pdf Path: Calvin >> M >> 143 Spring, 2000 Description: ... Date Added: 2009-06-17 00:54:04 |
| 1.2.pdf Path: N.C. State >> MA >> 114 Fall, 2008 Description: Multiplication of matrices. How do you do it? COPYRIGHT 2006 by LAVON B. PAGE \"!1 2% \"3 7% \" !3 14% $ \'$ \'($ \' $ 2 4\' $2 2\' $ 4 8 \' # # 7% $ \' 3 !1 2 $... Date Added: 2009-06-17 00:54:57 |
| Succession and Stability.pdf Path: Wyoming >> BIOL >> 3400 Fall, 2008 Description: Succession and Stability (Chapter 20) I. Ecological succession -proceeds through a sequence of communities called _ Forests: Primary Succession: starts with Secondary Succession: starts with Example of Primary Succession: Glacier Bay, Alaska Yea... Date Added: 2009-06-17 00:55:14 |
| YHR208W.t2k.alpha-logo.pdf Path: UCSC >> YHR >> 208 Fall, 2009 Description: YHR208W.t2k ALPHA 4 3 2 1 H I S HIC I I I I I S X X X X X X X X 10 20 30 40 H 4 3 2 1 B H I H B S E H B S B H B E A B E B H B I H S E H B S E D B H B B E AA E ECES I S E I BBFBICB C AATBB A BTCB A A I BB A AXG XXXXXXXXXXXXXXXXXXXXTEXXXX... Date Added: 2009-06-17 00:55:22 |
| YHR216W.t2k.stride-ebghtl-logo.pdf Path: UCSC >> YHR >> 216 Fall, 2009 Description: YHR216W.t2k EBGHTL 3 2 1 C C H HCCCC X X HX G T C T T X X X X XTTCTTTTXH X X X X X X HHHHHHHHHH X HH C H X X E E C C C T C C H C C C C E C C C T T C C T T T T C T T E T T C C T T C T C X X X X X X X X X X X X X X X X X X X X X X X X X X X X... Date Added: 2009-06-17 00:55:43 |
| tr608.ps Path: Carnegie Mellon >> TR >> 608 Fall, 2009 Description: %!PS-Adobe-2.0 %Creator: dvips 5.47 Copyright 1986-91 Radical Eye Software %Title: 608techreport.dvi %Pages: 27 1 %BoundingBox: 0 0 612 792 %EndComments %BeginProcSet: texc.pro /TeXDict 200 dict def TeXDict begin /N /def load def /B{bind def}N /S /ex... Date Added: 2009-06-17 01:01:54 |
| plot2.5003.ps Path: NMSU >> BOX >> 120 Fall, 2009 Description: ... Date Added: 2009-06-17 01:02:11 |
| INFS7006 S1 2009 Seminar 6 - 1pp.pdf Path: Allan Hancock College >> INFS >> 7006 Fall, 2009 Description: INFS7006 Information Systems & Communication Technologies Semester 1 - 2009 Seminar 6 Textbook Chapter 6 Local Area Networks 1 1 Chapter 6: Outline LAN Components Traditional Ethernet (IEEE 802.3) Switched Ethernet Best Practice LAN design Improv... Date Added: 2009-06-17 01:02:51 |
| INFS7006 S1 2008 - 2007 Final Exam.pdf Path: Allan Hancock College >> INFS >> 7006 Fall, 2009 Description: THE AUSTRALIAN NATIONAL UNIVERSITY School of Accounting and Business Information Systems Final Examination, Semester Two 2007 INFORMATION SYSTEMS AND COMMUNICATION TECHNOLOGIES ( INFS7006 ) Writing period : 3 Hours duration Study period : 15 Minute... Date Added: 2009-06-17 01:02:55 |
| spreadsheet.xls Path: E. Kentucky >> COURSE >> 770 Fall, 2009 Description: OnlineDictionariesandTranslators Answers.com 16 yes yes no yes yes no yesAudioandphonetic unlimited free yes yes yes NumberofLanguages Accurate GivesDefinitions Translateswholetext GivesIdioms&CommonUsage ListsPartofSpeech OnlineForum PronunciationGu... Date Added: 2009-06-17 01:04:28 |
| MA1135 Syllabus Spring 2007 -- Rev.2.pdf Path: Mich Tech >> MA >> 1135 Fall, 2008 Description: MA1135 Calculus for Life Sciences Spring 2007 Instructor Name: Office: Office Phone: Office Hours: Email: Todd King 213 Fisher 487-1990 MWF: 1 2 pm trking@mtu.edu T: 10am noon Text: Applied Calculus (Fourth Edition) by Berresford/Rockett, publis... Date Added: 2009-06-17 01:05:16 |
| Section 1.2.pdf Path: Mich Tech >> MA >> 1135 Fall, 2008 Description: ... Date Added: 2009-06-17 01:05:16 |
| 15-ShortestPathx6.pdf Path: Berkeley >> EE >> 122 Spring, 2006 Description: Why Does Routing Matter? We need good end-to-end performance Find the shortest/best path Propagation delay, throughput, packet loss EE 122: Shortest Path Routing Ion Stoica (and Brighten Godfrey) TAs: Lucian Popa, David Zats and Ganesh Ananthanaraya... Date Added: 2009-06-17 01:06:18 |
| Zhao_AMCsurvey03.pdf Path: Stetson >> SYS >> 863 Fall, 2009 Description: Face Recognition: A Literature Survey W. ZHAO Sarnoff Corporation R. CHELLAPPA University of Maryland P. J. PHILLIPS National Institute of Standards and Technology AND A. ROSENFELD University of Maryland As one of the most successful applications... Date Added: 2009-06-17 01:06:21 |
| multi.pdf Path: Old Dominion >> CS >> 355 Spring, 2008 Description: CPU CPU memory ... Date Added: 2009-06-17 01:06:54 |
| spra518.pdf Path: Allan Hancock College >> ARM >> 920 Fall, 2009 Description: Application Report SPRA518 TMS320C6x Code Development Flow Digital Signal Processing Solutions Abstract This document descibes the process used to develop and compile C code for the Texas Instruments (TI) TMS320C6x digital signal processor (DSP). ... Date Added: 2009-06-17 01:12:13 |
| 2006_06_21_DNR_10.pdf Path: UWI Mona >> SECTION >> 1310 Fall, 2009 Description: Legislative Fiscal Bureau One East Main, Suite 301 Madison, WI 53703 (608) 266-3847 Fax: (608) 267-6873 June 21, 2006 TO: Members Joint Committee on Finance Bob Lang, Director FROM: SUBJECT: Natural Resources: Local Highway Project Review - A... Date Added: 2009-06-17 01:15:17 |
| Exam 4.doc Path: Christendom >> GSB >> 701 Fall, 2009 Description: Dominican University Department of Accounting GSB 701 Mr. Pollastrini Final Exam Fall, 2006 Problem I II III IV V Total Possible Points 20 50 35 30 _15 150 Name_ _Solution_ Actual Points I. The Green Company manufactures a single product. The per ... Date Added: 2009-06-17 01:16:38 |
| T0469.t06.w0.5-logo.pdf Path: UCSC >> T >> 0469 Fall, 2009 Description: T0469.t06 w0.5 4 3 2 1 1 10 20 30 40 T 4 3 2 1 H T H T T H T 51 H 60 GL N VEDIL RDLNALA T 50 MT Q KFTKD MTFAQALQTHPGVAGVLRS Y NL G CI G C MG A Q N ES L E Q GA N A H ... Date Added: 2009-06-17 01:17:20 |
| music-1.xls Path: Penn State >> ALC >> 5082 Fall, 2009 Description: Monthly Sales Ska Rocksteady Ragga Boston Kansas Portland San Diego Lovers Rock Dub Poetry Dub Dancehall $2,000 $3,000 $4,000 $5,000 $6,000 $7,000 $8,000 $9,000 $10,000 Reggae Music Company Monthly Sales Dancehall Dub Dub Poetry Lov... Date Added: 2009-06-17 01:17:31 |
| lec20.pdf Path: Washington >> CS >> 527 Fall, 2009 Description: CSE 527 Phylogeny Nothing in biology makes sense, except in the light of evolution\" - Dobzhansky Modeling Sequence Evolution Simple but useful models; assume: Independen... Date Added: 2009-06-17 01:19:39 |
| notes07.pdf Path: Washington >> CS >> 527 Fall, 2009 Description: Libby MacKinnon CSE 527 notes Lecture 7, October 17, 2007 MLE and EM Review of Maximum Likelihood Estimators MLE is one of many approaches to parameter estimation. The likelihood of independent observations is expressed as a function of the unknown ... Date Added: 2009-06-17 01:21:58 |
| lect12-notes.pdf Path: CUNY Baruch >> CS >> 1007 Fall, 2009 Description: CS1007 lecture #12 notes news. midterm #2 changed to: TUE APRIL 9 news due Thu Mar 7 check web page and bulletin board for hw updates arrays references comparing Strings reading: ch 5.1, 6.1-6.2 arrays (1). arrays (2). ... Date Added: 2009-06-17 01:21:58 |
| hw4.pdf Path: Washington >> CS >> 417 Winter, 2009 Description: CSE 417 HW#4: RNA \"folding\" Due: Friday, 2/16/2007 To briefly summarize section 6.5 and my lecture on RNA structure prediction, aka RNA folding, RNA molecules often fold back on themselves, forming stable double-helix structures akin to the famous DN... Date Added: 2009-06-17 01:22:10 |
| lecture4.ppt Path: Washington >> CS >> 444 Fall, 2009 Description: The Relational Data Model Database Model (ODL, E/R) Relational Schema Physical storage ODL definitions Diagrams (E/R) Tables: row names: attributes rows: tuples Complex file organization and index structures. Terminology Attribute names Name gizm... Date Added: 2009-06-17 01:22:27 |
| lec5.pdf Path: Washington >> CS >> 303 Fall, 2009 Description: \' $ CSE 303: Concepts and Tools for Software Development Hal Perkins Autumn 2007 Lecture 5- Regular Expressions (and more), grep, other utilities & CSE303 Autumn 2007, Lecture 5 1 % \' $ Where are We We are done learning this bizarre pseudo-p... Date Added: 2009-06-17 01:22:42 |
| ps5.pdf Path: Washington >> CS >> 531 Fall, 2009 Description: CSE 531: Computability and Complexity Problem Set #5 Due on Wednesday, December 10, 2003. Instructions: Same as Problem Set 1. Autumn 2003 Instructor: Venkatesan Guruswami 1. Prove that LOGSPACE = TIME(n2 ). 2. Prove that every language in BPP has ... Date Added: 2009-06-17 01:22:48 |
| hw2.pdf Path: Washington >> CS >> 341 Fall, 2009 Description: CSE 341, Fall 2004, Assignment 2 Due: Monday 18 October, 9:00AM Version 1 You will write 10 SML functions having to do with \"Tetris moves\" and \"Tetris pieces\". Your solutions must use pattern-matching. You may not use the functions null, hd, or tl, n... Date Added: 2009-06-17 01:23:09 |
| hw5worksheet.doc Path: Washington >> CS >> 341 Fall, 2009 Description: CSE 341 Homework 5 Worksheet Name: Section: Part I See the code for the points during execution to evaluate the following statements: 1) After the statement val E set1 = createEmployee(11.00, 50.0, false): Evaluate (#getPay set1) (); Ans: _ Evaluate ... Date Added: 2009-06-17 01:25:46 |
| lec2.pdf Path: Washington >> CS >> 341 Fall, 2009 Description: \' $ CSE 341: Programming Languages Winter 2006 Lecture 2- ML functions, pairs, and lists & CSE341 Winter 2006, Lecture 2 1 % \' $ What is a programming language? Here are separable concepts for defining and evaluating a language: syntax: how ... Date Added: 2009-06-17 01:25:48 |
| courseorg.pdf Path: Washington >> CS >> 531 Fall, 2009 Description: CSE 531 Automata, Computability, Complexity Course Organization Fall 1996 W. L. Ruzzo Handout 1 1 Oct 96 Instructor Larry Ruzzo 415 Sieg 543-6298 ruzzo@cs.washington.edu TA Nitin Sharma nitin@cs.washington.edu Class Place & Time: Sieg 224, TuTh 1... Date Added: 2009-06-17 01:26:27 |
| ml-intro.ppt Path: Washington >> CS >> 473 Fall, 2009 Description: Machine Learning 1 Why Machine Learning Flood of data WalMart 25 Terabytes WWW 1,000 Terabytes Speed of computation versus slowness of programming highly complex systems (telephone switching systems) = 1 line code @ day @ programmer Desire f... Date Added: 2009-06-17 01:26:45 |
| l9.ps Path: Washington >> CS >> 544 Spring, 2009 Description: %!PS-Adobe-2.0 %DocumentFonts: Courier Times-Bold %Title: l9.ps (mpage) %Creator: mpage 2.4 September 1996 %CreationDate: Thu Apr 27 18:57:05 2000 %Orientation: Portrait %DocumentMedia: Letter 612 792 %BoundingBox: 18 18 594 774 %Pages: (atend) %EndC... Date Added: 2009-06-17 01:29:09 |
| lec26.pdf Path: Washington >> CS >> 341 Fall, 2009 Description: \' $ CSE 341: Programming Languages Winter 2005 Lecture 26- Static Overloading; Subtype vs. Parametric Polymorphism; Bounded Quantification & CSE341 Winter 2005, Lecture 26 1 % \' $ Static Overloading Many OO languages allow methods in the same... Date Added: 2009-06-17 01:30:05 |
| hw6.pdf Path: Washington >> STAT >> 322 Spring, 2008 Description: G0 GGX(9 GG)b)\"gGG) p mSB q H pn Y D HHB pn HIH pn D U GooEo2{0)p 6 I q vS s v HISHBa v BSH x q vS xBHH B F I m s Y vI v HISHBa v H U rYwvrvGrYEGyErYy0wYrvwvGus EG27#D7)GwqrYEGyErYop irvwvv n YHI HBH BSH xI q vS v I m s Y vI H U \"E... Date Added: 2009-06-17 01:30:51 |
| YJL210W.t2k.w0.5-logo.pdf Path: UCSC >> YJL >> 210 Fall, 2009 Description: YJL210W.t2k w0.5 5 4 3 2 1 V A I L RV Q D K E Q XX L XX A I L X N L A X XX E K R D A S IN E VS M G G F S X I EV V L I F I XXXXXXXXXXXXXXX E I N V Q L L LD L L E L D S A K M K E F F L V Y I V N L L Y F P L L M E V L D Q V K X X... Date Added: 2009-06-17 01:32:10 |
| YBL060W.t2k.dssp-ebghstl-logo.pdf Path: UCSC >> YBL >> 060 Fall, 2009 Description: YBL060W.t2k EBGHSTL 3 2 1 CC T X 10 20 30 40 H 3 2 1 HH G T H T T H H XX H X HHCC HXXXX X C HHHHHHHHHHHXXH HH T T T T C C C C C C C C X X X X X X X X X T HXXX H H X X SCCT SSH HHHTSTTGHCC H S T XXXXXXH X X CC S CTT 80 T G X H... Date Added: 2009-06-17 01:32:24 |
| YIL156W-B.t2k.stride-ebghtl-logo.pdf Path: UCSC >> YIL >> 156 Fall, 2009 Description: YIL156W-B.t2k EBGHTL 3 2 1 C TTHHTX H T H T H H X X X 10 20 30 40 H 3 2 1 C T C T H G T H E H H C E E T H X X X X X X X X HH HHH 51 60 H T 70 NL GES VYDYSVAT CGSSTYFARK HHHHHHH X X X X X G H E T E C T H H C T C C G X X X X X X ... Date Added: 2009-06-17 01:34:40 |
| YJR094W-A.t2k.w0.5-logo.pdf Path: UCSC >> YJR >> 094 Fall, 2009 Description: YJR094W-A.t2k w0.5 5 4 3 2 1 L M I V F XX L K X R GKF RF G XXXXXXXXXXXXXXXX L R Y K T K R V N A I G YG A S W H K V A S L T XXX S A L XXXXXXXXXXXXXXXXXXXXXX R R E K I L V L K R K F M E V Q C C A R V L S T V L I M K R K Q E Y ... Date Added: 2009-06-17 01:35:14 |
| YIL109C.t2k.alpha-logo.pdf Path: UCSC >> YIL >> 109 Fall, 2009 Description: YIL109C.t2k ALPHA 3 2 1 B B B B B C C C C B B E E E E E E E E C C S B B B S B BB C S BB G BC BB BBB B C B CCBB CCB C C C C E C B E E E E E XXXXXXXXXXXXXXEXXXXXXXXXXXXXXEXXXXXXXXXXXXXXXXXXXX X X A E C B I C B E E B E E H B H C B B E E E B E S B... Date Added: 2009-06-17 01:35:32 |
| YMR297W.t2k.dssp-ehl2-logo.pdf Path: UCSC >> YMR >> 297 Fall, 2009 Description: YMR297W.t2k DSSP-EHL2 2 1 H X C CCCCCCCCCCCCCCCCCCHC X X X X X X X X X X X X X X X X X X 1 10 20 30 40 H 2 1 H G H T H HHH 51 H H C H H H C C C C CCCHCHCCCCCCCCCCHHHHHC H X X X X 60 70 80 90 H 2 1 C T T E X H 2 1 H E E H H T ... Date Added: 2009-06-17 01:36:28 |
| YJL114W.t2k.dssp-ebghstl-logo.pdf Path: UCSC >> YJL >> 114 Fall, 2009 Description: YJL114W.t2k EBGHSTL 3 2 1 CC E B X C T S E E ECCC H S C E S S E S E H H T H X X X X X X X XCXXXECCH X X X X X CCCC S T S EEECTT SH H H X X C H H H H H H X X X X E X X E EC S T C S T T T S S T E X X X X X X X E T CCCCS C X C S H XSHGX... Date Added: 2009-06-17 01:36:58 |
| peereval.doc Path: SMU - Cox School of Business >> ITOM >> 6218 Fall, 2008 Description: ITOM 6218 - Peer Evaluation Form Project Name: Date: Project: _ _ _ Name attended all meetings got tasks accomplished on time took on difficult tasks contributed ideas on a regular basis contributed with project-related specialized skills or knowledg... Date Added: 2009-06-17 01:37:08 |
| BlankSolution.doc Path: Berkeley >> EE >> 129 Fall, 2009 Description: Midterm Part B Date: Name: _ Task 1: Design considerations: . Template: A= Network settings Input Initial State Boundary Condition . Examples: . B= z= Simulator settings Running time Time step Output sampling ... Date Added: 2009-06-17 01:37:53 |
| Phys1401-Lab-CircularMotion.pdf Path: Texas A&M University, Corpus Christi >> PHYS >> 1401 Fall, 2008 Description: YOUR NAME: Group Member Names _ Date_ 1)_ 2) _ 3) _ Phys 1401 - Pre-Lab: Circular Motion Merry-go-rounds, satellites, cars on a loop, airplanes doing a loop, the earth spinning,. They are all objects that are undergoing circular motion. To make... Date Added: 2009-06-17 01:38:44 |
| Phys2426-SoundWaves.pdf Path: Texas A&M University, Corpus Christi >> PHYS >> 2426 Fall, 2008 Description: OUR AME _ Date_ Group Member Names 1)_ 2) _ 3) _ Physics 2426-Pre-Lab: Sound Waves When a tuning fork or a speaker vibrates near a tube, there are certain frequencies of sound at which the tube will resonate (vibrate at the same frequency or multiple... Date Added: 2009-06-17 01:39:04 |
| TrigonometryReview.pdf Path: Texas A&M University, Corpus Christi >> PHYS >> 2425 Fall, 2008 Description: TRIGONOMETRY Department of Physics, University of Guelph During this tutorial you will be asked to perform calculations involving trigonometric functions. You will need a calculator to proceed. The purpose of this tutorial is to review with you the... Date Added: 2009-06-17 01:39:17 |
| Halophiles of the Great Salt Lake.docx Path: Uni. Westminster >> AP >> 0524 Fall, 2009 Description: <?xml version=\"1.0\" encoding=\"UTF-8\"?> <Error><Code>NoSuchKey</Code><Message>The specified key does not exist.</Message><Key>418be88efc16f98ea133a25d9d1ec7b6b68644c2.docx</Key><RequestId> 50EF75C6A4705F27</RequestId><HostId>5HmENCVv0fOU9+i+01mPOk+agF... Date Added: 2009-06-17 01:42:01 |
| slides15.ps Path: UCSC >> CMPS >> 180 Winter, 2008 Description: %!PS-Adobe-3.0 %Title: (slides15.ppt) %Creator: (Microsoft PowerPoint: LaserWriter 8 8.7) %CreationDate: (8:03 AM Monday, December 31, 2001) %For: (Arthur M. Keller) %Routing: (mailto:\00arthur@kellers.org) %Pages: 20 %DocumentFonts: Times-Roman Zap... Date Added: 2009-06-17 01:42:04 |
| 53.pdf Path: Penn State >> ASPRING >> 471 Fall, 2009 Description: Trick for proving the converse theorems. It works whenever you know that some property is unique. Example: Theorem: Instructor comes to the class unshaved. If instructor then unshaved. Converse: If somebody comes to the class unshaved then this perso... Date Added: 2009-06-17 01:42:42 |
| SolomonsChapter 3.pdf Path: FIU >> CHM >> 2210 Fall, 2008 Description: There are 4 types of Organic Reactions SUBSTITUTION: X Y + A X A + Y Chapter 3 An Introduction to Organic Reactions: Acids and Bases Example ADDITION: A B + X Y A X B Y Example There are 4 Types of Organic Reactions ELIMINATION Interm... Date Added: 2009-06-17 01:43:02 |
| slac-pub-1698.pdf Path: Stanford >> PUBS >> 1500 Fall, 2009 Description: SLAC-PUB-1698 December 1975 (T !E) PRODUCTION PROPERTIES OF Q MESONS IN K*p - K*r\'np AT 13 GeV * G. W. Brandenburg?, R. K. Carnegieft, R. J. Cashmorettt, M. Davierz, W. M. Dunwoodie, T. A. Lasinski, D. W. G. S. Leith, J.A. J. Matthews$, P. Walde... Date Added: 2009-06-17 01:44:08 |
| lecture19[2].ppt Path: Georgia Tech >> CS >> 1321 Fall, 2008 Description: CS 1321 CS1321: Introduction to Programming Georgia Institute of Technology College of Computing Lecture 19 March 19, 2002 Today\'s Menu 1. Generative Recursion: QuickSort 2. Generative Recursion: Fractals Last time: Generative Recursion Up until t... Date Added: 2009-06-17 01:45:31 |
| Tracking.doc Path: RIT >> P >> 08003 Fall, 2009 Description: Tracking System Design Circuit Schematic: Page 1 of 5 Page 2 of 5 Page 3 of 5 Page 4 of 5 Page 5 of 5 ... Date Added: 2009-06-17 01:45:51 |
| YIL172C.t2k.str2-logo.pdf Path: UCSC >> YIL >> 172 Fall, 2009 Description: YIL172C.t2k STR2 5 4 3 2 1 CC X CC S XXXXXXT H H H H H S S S C H H H C S X X X ZZ CS STCAQQQQZZSG SC C C C ZYSSC CSHSHTCCTCSMYYYPYTTCCTSCS C T M C H B H S TT CCCTBS Y Z T T T H G T H S G X X X X X X CCC 10 Q C P H G G X PAA C APPAC MM Z MC C ... Date Added: 2009-06-17 01:46:50 |
| YIL133C.t2k.alpha-logo.pdf Path: UCSC >> YIL >> 133 Fall, 2009 Description: YIL133C.t2k ALPHA 2 1 B B E S A A B XX 1 10 20 30 40 E 2 1 A S B S B A H S H A I D S B E A I G E D H HHHHHH I X XXXX I 51 60 70 80 90 S B H S 2 1 E I H S E H S E H B H S B H SE I B HA X X X S E H E 2 1 G S B H I H B ... Date Added: 2009-06-17 01:46:54 |
| TheProjectGutenbergEtext.The_Secret_Garden.modified.docx Path: UNC >> INLS >> 461 Fall, 2008 Description: THE SECRET GARDEN BY FRANCES HODGSON BURNETT Table of Contents 2 THE SECRET GARDEN CHAPTER I THERE IS NO ONE LEFT When Mary Lennox was sent to Misselthwaite Manor to live with her uncle everybody said she was the most disagreeable-looking child e... Date Added: 2009-06-17 01:48:32 |
| ecans.pdf Path: N. Illinois >> SEC >> 229 Fall, 2009 Description: Math 229 Section 1 Extra Credit Solutions Name: 1. Let f (x) = x2 sin(1/x) 0 if x = 0, if x = 0. Give a limit that is slope of the tangent line to y = f (x) at x = 0. In general, f (0) = lim x0 f (x) - f (0) . x In our case f (0) = 0, and since ... Date Added: 2009-06-17 01:51:21 |
| 0.5 brochure.doc Path: N. Georgia >> KDSPEN >> 3802 Fall, 2009 Description: Calendar of Events August 30 First Day of School Sept. 6 Labor Day, No School Oct. 5 School Pictures Nov. 6 Harvest Festival Nov. 24 Thanksgiving Parties Dec. 16 Christmas Program Dec. 17 Christmas Parties Jan. 3 Classes Resume Jan. 24-28 Spi... Date Added: 2009-06-17 01:52:32 |
| initloop.txt Path: UNC >> PHYS >> 006 Fall, 2009 Description: #INIT_LOOP A 8 -155.0 155.0 -65.0 140.0-140.0 70.0-110.0 15.0 -75.0 -15.0 -60.0 -40.0 45.0 50.0 65.0 15.0 B 0 C 9 -165.0 165.0-115.0 145.0 -65.0 140.0-130.0 100.0-110.0 15.0 -85.0 -10.0 -60.0 -30.0 50.0 55.0 70.0 25.0 D 10 -70... Date Added: 2009-06-17 01:53:32 |
| MapGenClassics.pdf Path: UCSB >> G >> 232 Fall, 2009 Description: Map Generalization: Classic papers Buttenfield, B.P., 1985. \"Treatment of the Cartographic Line,\" Cartographica 22(2):1-26. Buttenfield, Barbara P. and Robert B. McMaster (eds). 1991. Map Generalization: Making Rules for Knowledge Representation. Lon... Date Added: 2009-06-17 01:54:40 |
| questions.txt Path: Michigan >> PERSONAL >> 641 Fall, 2009 Description: Questions asked and answered by e-mail about Econ 641, Winter 2008 None yet <end of file>... Date Added: 2009-06-17 01:54:54 |
| supp.pdf Path: Sanford-Brown Institute >> CS >> 224 Fall, 2009 Description: Poisson Image Editing Extended - Supplemental Material (poster 0216) Daniel Leventhal1 Bernard Gordon2 Peter G. Sibley3 Brown University Figure 1: Alpha Interpolation with Luminance Rescaling run with = .2, = .7, = .7 and = .9 respectively. As ... Date Added: 2009-06-17 01:54:57 |
| lab2_early-submissions.txt Path: UT Arlington >> CSE >> 3320 Fall, 2008 Description: snu9191_lab2.tar jdc9496_lab2.tar jwe7114_lab2.tar kks8142_lab2.tar jdk0879_lab2.tar bdl8654_lab2.tar oxs3164_lab2.tar nlw9893_lab2.tar cga7926_lab2.tar hxc0850_lab2.tar axs9253_lab2.tar awe6852_lab2.tar axt7652_lab2.tar sxc7392_lab2.tar tqt9209_lab2... Date Added: 2009-06-17 01:55:02 |
| ch3a.pdf Path: UT Arlington >> CSE >> 3322 Fall, 2008 Description: Exercise 3.9 Answer: Code before optimization Loop: add add add lw bne add j Exit: $t1, $s3, $s3 $t1, $t1, $t1 $t1, $t1, $s6 $t0, 0($t1) $t0, $s5, Exit $s3, $s3, $s4 Loop # Temp reg $t1 = 2 * i # Temp reg $t1 = 4 * i # $t1 = address of save[i] # Temp... Date Added: 2009-06-18 19:33:50 |
| 2748.txt Path: UNC >> DOCS >> 2748 Fall, 2009 Description: CELEBRATED CRIMES, COMPLETE BY ALEXANDRE DUMAS, PERE IN EIGHT VOLUMES DERUES One September afternoon in 1751, towards half-past five, about a score of small boys, chattering, pushing, and tumbling over one another like a covey of partridges... Date Added: 2009-06-18 19:34:30 |
| Writing Project 1.pdf Path: UNC Greensboro >> E >> 380 Fall, 2009 Description: Writing Project 1 Econ 380 Policy Summary Five of the biggest current environmental policy issues are about: 1) Ratifying the Kyoto Protocol 2) Drilling in ANWR (the Artic National Wildlife Refuge) 3) Raising the CAFE standards 4) Tightening arsenic ... Date Added: 2009-06-18 19:36:18 |
| HectorEtAl2000Science.pdf Path: UConn >> EEB >> 302 Fall, 2009 Description: TECHNICAL COMMENT No Consistent Effect of Plant Diversity on Productivity Hector et al. (1) reported on BIODEPTH, a major international experiment on the response of plant productivity to variation in the number of plant species. They found \"an over... Date Added: 2009-06-18 19:36:59 |
| Huston et al. 2000.pdf Path: UConn >> EEB >> 302 Fall, 2009 Description: TECHNICAL COMMENT No Consistent Effect of Plant Diversity on Productivity Hector et al. (1) reported on BIODEPTH, a major international experiment on the response of plant productivity to variation in the number of plant species. They found \"an over... Date Added: 2009-06-18 19:37:00 |
| T0486.t04.o_notor-logo.pdf Path: UCSC >> T >> 0486 Fall, 2009 Description: T0486.t04 o_notor 4 3 2 1 M HH H H H H S S G VD L G TE N L YF Q S MG A GR R E S E P RP T S AR Q L DG I R NI V L SN P K K R NT L S L A M L K S L Q SD I L H D A D SN D L K V I I IS A E G P V F SS G H D L K E LT 10 20 30 40 50 60 70 80 90 1 N 4 3 2 1 ... Date Added: 2009-06-18 19:37:34 |
| 2README.ps Path: Georgia Tech >> CS >> 2430 Fall, 2009 Description: %!PS-Adobe-1.0 %Creator: cleon:jkg (Jim Greenlee) %Title: stdin %CreationDate: Mon May 4 08:35:28 1998 %DocumentFonts: Times-Roman Times-Italic Times-Bold Symbol Times-Roman DIThacks %Pages: (atend) %EndComments % Start of pscat.pro - prolog for trof... Date Added: 2009-06-18 19:40:13 |
| February-1991-Lake-Hefner-Master-Plan.pdf Path: Southern Oregon >> ARCH >> 3554 Fall, 2009 Description: ... Date Added: 2009-06-18 19:40:54 |
| Prelab1_2007.pdf Path: Idaho >> ME >> 451 Fall, 2008 Description: ME451/551 Flow Visualization Lab Friday, January 19 Let\'s meet in EP103 for this lab and then move to EP109. Lab Section 1 - 7:30 to 8:15 Lab Section 2 - 8:30 to 9:15 PREPARATORY EXERCISES You are welcome to work individually or in groups on the ... Date Added: 2009-06-18 19:42:02 |
| ACC01 Final Project.ppt Path: Villanova >> ACC >> 1001 Fall, 2009 Description: ACC01 Final Project By Brian Benway Objectives To Summerize Ratio Analysis of the Denver Manufacturing Company by\" Displaying the ratios of each division as well as the company as a whole Analyzing each division and the company highlighting str... Date Added: 2009-06-18 19:42:47 |
| YOR008W-B.t2k.dssp-ehl2-logo.pdf Path: UCSC >> YOR >> 008 Fall, 2009 Description: YOR008W-B.t2k DSSP-EHL2 1 CC 1 C H X X X X X X CCC H H C C X X X X H X C X X X H H E E E E C C C C C C C C C C C H H H X X X X X EE EE H C X X H H H X X X X C C X C X X C 10 20 H E H 30 MA TKG NLKRQTKY FSTIAYTETRGEAT L R A N... Date Added: 2009-06-18 19:43:45 |
| YOR027W.t2k.dssp-ebghstl-logo.pdf Path: UCSC >> YOR >> 027 Fall, 2009 Description: YOR027W.t2k EBGHSTL 3 2 1 C X C H C C C T X X X X X X HH 1 10 20 30 40 H 3 2 1 T H T H HHTTCHHHHHHHHHHHHH CTT HHHHHHHHHHHHHTTC HHHHHHHHHH X X X T H S HS CH X X X X X C X X X X X X X S T T S X X X X X X X H C X X HHH GC TTSGSSC... Date Added: 2009-06-18 19:44:12 |
| Course Packet Contents.doc Path: SUNY Albany >> ENG >> 6349 Fall, 2009 Description: vti_encoding:SR|utf8-nl vti_timelastmodified:TR|11 Jan 2005 17:39:27 -0000 vti_extenderversion:SR|6.0.2.5516 vti_author:SR|ALIENWARE-BLUE\\Dan vti_modifiedby:SR|ALIENWARE-BLUE\\Dan vti_timecreated:TR|24 Dec 2004 07:33:50 -0000 vti_title:SR|Contents vti... Date Added: 2009-06-18 19:44:27 |
| lzk12z.txt Path: University of Illinois, Urbana Champaign >> ATMOS >> 20090308 Fall, 2009 Description: UPPER AIR CALCULATIONS AND PLOTTING (Ver 5.49-LINUX-X11) Current filename: /mnt/noaaport/nwstg/convert/09030800_upa.wxp Date: 0000Z 8 MAR 09 Searching for KLZK. Searching the city database file for: KLZK . Date:0000Z 8 MAR 09 Station: KLZK W... Date Added: 2009-06-18 19:44:47 |
| Suggestedexercises.pdf Path: UWO >> MATHEMATIC >> 310 Fall, 2009 Description: Mathematics 310a Suggested Exercises from Niven, Zuckerman, Montgomery The following lists of suggested exercises is, no doubt, too long if you try to solve them all in detail. Some of the exercises in this book (those marked with one or to stars) ar... Date Added: 2009-06-18 19:45:49 |
| Query Processing and Optimization.ppt Path: Gonzaga >> WEEK >> 421 Fall, 2009 Description: Query Processing and Optimization 1 Steps in the Process SQL query Query Tree Scan into tokens Parse for syntactic correctness Validate attribute and relation names Develop intermediate representation: query tree Pass through the query... Date Added: 2009-06-18 19:46:01 |
| eecs348-reading.doc Path: North-West Uni. >> EECS >> 348 Fall, 2009 Description: CS 348: Introduction to Artificial Intelligence Independent Reading Assignment Select a (non-fiction) book you are interested in that is about Artificial Intelligence. Here are some acceptable examples. If you don\'t pick an example off the list, you ... Date Added: 2009-06-18 19:46:56 |
| YFR024C.t2k.str2-logo.pdf Path: UCSC >> YFR >> 024 Fall, 2009 Description: YFR024C.t2k STR2 4 3 2 1 ZYAAAY CAZYZA CY AZCZ Y XXX S QQZ HH Q C S Y Q M H E C C H A B A C T E S E T B H A Z T C M M H Z S E C B G T C XXXYESXXXZ X X X X X X X X XZXTSCCCGXT X X X X X X X X C M T C Z ZSSA C TTYZYZ ZGGG YZ M SCSZ Z C AAACCCTTZ... Date Added: 2009-06-18 19:47:18 |
| Day24-TheoryOfComputation.ppt Path: Wisconsin Milwaukee >> CS >> 131 Fall, 2009 Description: Theory of Computation Day 24 CSci 131 Nov. 28, 2006 06/08/09 1 Outline Introduction History The Halting Problem Time Complexity Classes of Problems 06/08/09 2 Introduction Theory of computation seeks to answer Theory of com... Date Added: 2009-06-18 19:47:52 |
| user-levelThreadsIPC.ps Path: Maryland >> ENEE >> 647 Fall, 2008 Description: %!PS-Adobe-2.0 %Creator: dvips 5.47 Copyright 1986-91 Radical Eye Software %Title: paper.dvi %Pages: 19 1 %BoundingBox: 0 0 612 792 %EndComments %BeginProcSet: tex.pro /TeXDict 200 dict def TeXDict begin /N /def load def /B{bind def}N /S /exch load d... Date Added: 2009-06-18 19:48:29 |
| spring_break_hw.doc Path: CSU Northridge >> AES >> 15831 Fall, 2009 Description: Emailed on Saturday, March 16, 2008 Dearest Physics Students, I hope that you all are enjoying a much deserved spring break. I just took a 5 hour long physics test yesterday so my spring break begins today! Cross your fingers for me in hopes tha... Date Added: 2009-06-18 19:48:30 |
| Oral Presentations(rev).doc Path: Bridgeport >> INSTC >> 101 Fall, 2009 Description: University of Bridgeport Department of Computer Science and engineering INTST C101B Ethical Issues in Computing Schedule of Oral Presentations (Revision*) Names Date Zlatin Zlatko Monik Svetla Rania Chiril Kadir James Dalal Marylyn Andrea Gintare B... Date Added: 2009-06-18 19:50:57 |
| Develop.doc Path: N. Arizona >> MES >> 227 Fall, 2009 Description: During this class I learned how to become a better reader. I was always really bad at reading comprehension as told in my narrative essay. During this class I learned how to analyze readings more academically. My writing also improved academically co... Date Added: 2009-06-18 19:51:26 |
| limit_review.pdf Path: Fayetteville State University >> MAC >> 2311 Fall, 2009 Description: 1 ... Date Added: 2009-06-18 19:51:34 |
| F08C107_8Water2.ppt Path: S.F. State >> C >> 107 Fall, 2009 Description: Questions of the Day . TRUE or FALSE? Salts (ionic compounds) generally dissolve better in warm water than in cold water Gases (like oxygen, nitrogen) dissolve better in warm water than in cold water Help Needed! at ACS Family Science Night at Oa... Date Added: 2009-06-18 19:52:21 |
| Chapter 12.doc Path: CUNY Baruch >> PHYSICS >> 207 Fall, 2009 Description: vti_encoding:SR|utf8-nl vti_timelastmodified:TR|30 Oct 2007 16:07:30 -0000 vti_extenderversion:SR|4.0.2.7802 vti_cacheddtm:TX|30 Oct 2007 16:07:30 -0000 vti_filesize:IR|366080 vti_cachedlinkinfo:VX| vti_cachedsvcrellinks:VX| vti_cachedtitle:SR|P12 vt... Date Added: 2009-06-18 19:53:19 |
| Test 1 with Solutions and Marking Scheme.pdf Path: St. Mary MD >> STATS >> 20082009 Fall, 2009 Description: ... Date Added: 2009-06-18 19:54:18 |
| Particle Acceleration Notes 4.doc Path: Acton School of Business >> ASTR >> 554 Fall, 2008 Description: ASTR554 FALL 2007 LECTURE NOTES SECTION V: Particle Acceleration IV Stochastic acceleration Example 2: Cascading turbulence model (Miller 2000) Distinction between ions and electrons in solar flare observations Electrons: 1036-37 electrons s-1 ... Date Added: 2009-06-18 19:55:21 |
| list_ch12.doc Path: U. Memphis >> POLS >> 4510 Summer, 2008 Description: Chapter 12 The Theory of the Powers of Production and the Theory of Values Adam Smith\'s celebrated work is entitled, \'The Nature and Causes of the Wealth of Nations.\' The founder of the prevailing economical school has therein indicated the double po... Date Added: 2009-06-18 19:55:24 |
| lecture chapter 2_part1.pdf Path: S.F. State >> PHY >> 111 Fall, 2009 Description: Clupturz. One Dinw\"l*rt (nSjl.Ar n . lt k)neznott\'cS / t () Q!17 a trae. 00Je^5 n5 po)fts ainA Mb,sS. n0/13 - Ft\'t \\Po4{,\'*< stE ; Delrre pm,t;ved,reod.^s and Orgin, Dov4 da,ye tlen G\",-qL: lositins. 7 /.;\'pba-\"t. X, - X; = o7 \'t\"J di\'t^,n: d=... Date Added: 2009-06-18 19:56:06 |
| TOX 707 - Coag 2007ed.ppt Path: UNC >> TOXC >> 707 Fall, 2006 Description: Hemostasis/Coagulation Gregory S. Travlos, DVM, DACVP National Institute of Environmental Health Sciences Research Triangle Park, NC 27709 919-541-0653 Travlos@niehs.nih.gov Hemostasis The process by which bleeding is arrested. It is a series of ph... Date Added: 2009-06-18 19:57:05 |
| disc7_560.doc Path: Mt. Mercy >> INBS >> 560 Fall, 2009 Description: Lisa Capetola 1. Research the concepts of engineering economics. Define it and describe its basic precepts. When is it used? What problems does it solve? What problems does it not solve? (What are its limitations?) Engineering economics is the applic... Date Added: 2009-06-18 19:59:54 |
| web lesson plan.doc Path: N. Georgia >> LCSHAW >> 6403 Fall, 2009 Description: Web-Based Lesson Plan Lesson Plan Title: Developed by: Subject Area: Grade Level: Purpose of the Activity: Learning Objectives (include at least one Georgia Performance Standard or Georgia QCC): Lesson URL(s): Equipment Needed: How will you accommoda... Date Added: 2009-06-18 20:02:43 |
| OCD_Fa07a_T04_v0.21.pdf Path: USC >> CSCI >> 577 Fall, 2009 Description: 2007 O p e r a tio n a l C o n c e p t D e s c r ip tio n (O C D ) C O IN C O M O 2 .0 T h e O p e r a tio n a l C o n c e p t D e s c r ip tio n c o n ta in s th e s h a r e d v is io n o f th e p r o je c t, d e s c r ib e s h o w th e p r o d u c... Date Added: 2009-06-18 20:03:31 |
| OCD_Fa07a_T04_v0.18.doc Path: USC >> CSCI >> 577 Fall, 2009 Description: 2007 Operational Concept Description (OCD) COINCOMO 2.0 The Operational Concept Description contains the shared vision of the project, describes how the product will operate in its environment and provides the highlevel context for the Success Cr... Date Added: 2009-06-18 20:03:33 |
| Ch3 Product and Process Desgin - Part 2 pb 4.ppt Path: CSU Northridge >> SOM >> 306 Summer, 2008 Description: Product & Process Design Part 2: Process Design Chapter 3 Product vs. Process Design Which comes first: The answer is ? Design of process or Design of product? Product Strategy Once a company decides to produce a given product or... Date Added: 2009-06-18 20:04:23 |
| YBL095W.t2k.w0.5-logo.pdf Path: UCSC >> YBL >> 095 Fall, 2009 Description: YBL095W.t2k w0.5 4 3 2 1 L V X 1 10 20 30 40 H 4 3 2 1 W L I F V Y S H G T E S T P E XXX S 51 60 70 80 90 H 4 3 2 1 E E D K N L T S T G H H E T X XXXXX XXXXXXX A S Q L H TP F S L L G L I L A L G G X XX XXXXXX P M... Date Added: 2009-06-18 20:04:44 |
| YBL057C.t2k.dssp-ebghstl-logo.pdf Path: UCSC >> YBL >> 057 Fall, 2009 Description: YBL057C.t2k EBGHSTL 3 2 1 CC X CCH H H H S H T T T X X X XX H C X H H H X X X E H E T E E E E X X X X X X X X X X X X XXXEXXXXXTXH X X C E E EHEHHHH H E H H 1 10 20 30 40 H 3 2 1 C C H H H H X X X X X X C H H H H E H H X X X H S... Date Added: 2009-06-18 20:05:02 |
| YBL057C.t2k.CB_burial_14_7-logo.pdf Path: UCSC >> YBL >> 057 Fall, 2009 Description: YBL057C.t2k CB_BURIAL_14_7 3 2 1 AAAAAA X 1 10 20 30 40 A 3 2 1 F A F D A A A AAB B A A A A D B B B B BBB D C C C B CCCCCCCCCCCCCCCCCCCCCCC CDXDDDDDDDDDDDDDDDDDDDXDDDCXDDDDDDBBDDDDDCFFEE C CCCCCDDCCCCCED C C C D D X X X X X X X X X AABAAA... Date Added: 2009-06-18 20:05:02 |
| interrupt.pdf Path: Toledo >> CSC >> 258 Fall, 2009 Description: INTERRUPT INT IR.op interrupt signal from channel detect start of EXECUTE detect start of FETCH PC ROM control memory next instruction address sba dba ... Date Added: 2009-06-18 20:07:16 |
| 07-Interest-Analysis.pdf Path: Ill. Chicago >> ACTG >> 593 Fall, 2008 Description: Weyerhaeuser Weyerhaeuser Operating income Interest expense and other: Times Interest Earned Operating income Interest expense and other: Interest expense (net) Equity in income (loss) of affiliates (Note 3) Interest expense Times Interest Earned Ope... Date Added: 2009-06-18 20:07:33 |
| Normalcy.rtf Path: UF >> AMH >> 2020 Fall, 2008 Description: WW1 ISSUES 1. The idea of \"Normalcy\" 2. Legacies of World War One 3. Intolerance in the 1920s 4. Partial eclipse of Progressivism Warren Gamaliel Harding `Not nostrums, but normalcy\' H.L. Mencken, `Gamalielese... Date Added: 2009-06-18 20:10:33 |
| APPENDIX B Title - Rev H.doc Path: Caltech >> M >> 960001 Fall, 2009 Description: APPENDIX B Laser System Registration Form ... Date Added: 2009-06-18 20:10:43 |
| Appendix F - Rev H.doc Path: Caltech >> M >> 960001 Fall, 2009 Description: <?xml version=\"1.0\" encoding=\"UTF-8\"?> <Error><Code>NoSuchKey</Code><Message>The specified key does not exist.</Message><Key>414b34ef25b2e6628db258126da08e38549146f9.doc</Key><RequestId>F 48493CE72EBD14D</RequestId><HostId>gydGOVFNjJf4yU7ONFzjDtrc8c+... Date Added: 2009-06-18 20:10:45 |
| references.ps Path: UCSC >> AMS >> 207 Fall, 2008 Description: %!PS-Adobe-2.0 %Creator: dvips(k) 5.86 Copyright 1999 Radical Eye Software %Title: references.dvi %Pages: 1 %PageOrder: Ascend %BoundingBox: 0 0 612 792 %EndComments %DVIPSWebPage: (www.radicaleye.com) %DVIPSCommandLine: dvips references.dvi %DVIPSPa... Date Added: 2009-06-18 20:10:50 |
| map.pdf Path: Delaware >> ANTHRO >> 101 Fall, 2009 Description: ... Date Added: 2009-06-18 20:11:56 |
| exam04.pdf Path: Rutgers >> PHYSICS >> 381 Fall, 2008 Description: ... Date Added: 2009-06-18 20:12:32 |
| January Summary.ppt Path: Benjamin Franklin Institute of Technology >> MY >> 4291 Fall, 2009 Description: MAE 4292: AEROSPACE ENGINEERING DESIGN II January Project Updates: Comments and Feedback January 28, 2009 Mechanical and Aerospace Engineering Department Florida Institute of Technology D. R. Kirk JANUARY COMMENTS: OVERVIEW Overall comment about P... Date Added: 2009-06-18 20:13:07 |
| AutomaticDerivationofThesauri.ppt Path: TCNJ >> CSC >> 485 Fall, 2009 Description: Automatic Derivation of Thesauri (Thesauri Construction) Source: Use of Syntactic Context to Produce Term Association Lists for Text RetrievalGregory Grefenstette (Part I) Building a Lexical Domain Map From Text Corpora-Tomek Strzalkowski (Part II) ... Date Added: 2009-06-18 20:13:37 |
| class7.ppt Path: TCNJ >> CSC >> 485 Fall, 2009 Description: Text Representations for IR Text Compression Data & File Structures Access Algorithms Clustering Algorithms 10/18/2000 CSI660 1 Text Compression Purpose: reduce amount of storage required Problem: allow IR system work on compressed data No... Date Added: 2009-06-18 20:13:41 |
| 2272homework4s.pdf Path: Pittsburgh >> MATH >> 072 Fall, 2009 Description: Homework 4 Solutions, 2/2/7 Question 1 Given that the number a is such that the following limit L exists, determine a and L: x3 - a . L = lim 2 x3 x - 7x + 12 We notice that the denominator x2 - 7x + 12 factorizes as (x - 3)(x - 4), so goes to zero ... Date Added: 2009-06-18 20:15:03 |
| radvt.txt_dtot_haar_mod.txt Path: Berkeley >> ASTRO >> 00150314 Fall, 2009 Description: tmin 2.9165473e-05 tmin 0.00016213325 ... Date Added: 2009-06-18 20:18:02 |
| Wavelength.doc Path: UF >> CLAS >> 3032 Fall, 2009 Description: Answer the following questions without the use of a calculator. Questions marked * are slightly more challenging. 1. What is the wavelength of a sound with a frequency of 20 Hz? a. 34 m b. 340 m c. 17 m d. 1700 m 2. Two waves A and B have the same fr... Date Added: 2009-06-18 20:19:19 |
| YOL097C.t2k.alpha-logo.pdf Path: UCSC >> YOL >> 097 Fall, 2009 Description: YOL097C.t2k ALPHA 3 2 1 S B C S E EBB SB C B XXXXXXXCXXXXXXXXXXXXX X B C E C E I CEB B E A E H E S B T H B B A E A C E E D E H H H H H I B E B H E H X X X SEE EBEH B A B XAACIHXXXXXAXX XX XX X T B C D S E D B E B E C A X I H E E ... Date Added: 2009-06-18 20:19:22 |
| Law 3010 Manufacturers strict liability in USA.doc Path: Laurentian >> MGT >> 3010 Fall, 2009 Description: Strict liability of manufacturers in the USA. Source http:/www.west.net/~smith/strict.htm Note that the foregoing describes United States law which is statutory that is created by legislation. A defendant manufacturer can be strictly liable for inju... Date Added: 2009-06-18 20:19:52 |
| homework4sol.pdf Path: Cornell >> ECE >> 407 Fall, 2009 Description: ECE407 Homework 4 Solutions (By Farhan Rana) Problem 4.1 (1D lattice) a) See plot below. a) V1=0.2 eV and V2 = 0.0 eV b) The size of the bandgap that opens at ka= is approximately 0.4 eV which equals 2V1 as predicted by the nearly free electron mode... Date Added: 2009-06-18 20:20:00 |
| CDS_3.pdf Path: Acton School of Business >> CHEM >> 122 Fall, 2009 Description: Concept Development Study #3 The Structure of an Atom I. Foundation We begin as a starting point with the atomic molecular theory. We thus assume that most of the common elements have been identified, and that each element is characterized as consist... Date Added: 2009-06-18 20:20:19 |
| A3_sols.pdf Path: Allan Hancock College >> MATH >> 237 Fall, 2009 Description: MATH237 Semester 1 2009 - Assignment 3 solutions 1. Let n be a fixed natural number. Show that m r=0 n+r-1 r = n+m m (a) using a combinatorial argument; (b) by induction (on m). Solution: (a) The term at the right corresponds with the number of ... Date Added: 2009-06-18 20:23:29 |
| Hashing.txt Path: UNF >> CIS >> 6930 Fall, 2008 Description: # Program to hash an integer to a position where the key is the mod 10 of that number h=Hash.new #creating an emty hash print(\"Enter an integer that you want to hash and store:\") str=gets #The no. entered throug... Date Added: 2009-06-18 20:24:09 |
| Cmip.doc Path: Stevens >> TM >> 624 Fall, 2009 Description: OSI Management Kornel Terplan, Subhendu Ghosh Stevens Institute of Technology OSI Management Model 1. OSI network management follows an object-oriented model physical or logical real resources are managed through abstractions known as Management ob... Date Added: 2009-06-18 20:24:37 |
| ethics.ppt Path: Sveriges lantbruksuniversitet >> CS >> 320 Fall, 2009 Description: Ethics How do we judge what\'s right and wrong? Where do we derive our ethics? Ans. Religion, law, inner voice?, ethical theories such as Kantism, Utilitarianism, etc. Three main parts of ethics: normative ethics, metaethics, and moral psychology. Nor... Date Added: 2009-06-18 20:24:52 |
| Class Timeline.doc Path: N. Georgia >> JDORM >> 4155 Fall, 2009 Description: Class Timeline Fill in Birth/Death Date & other Important Dates ... Date Added: 2009-06-18 20:25:01 |
| Chapter 10 Part 7.pdf Path: Mt. Marty >> PH >> 1726 Fall, 2009 Description: Chapter 10 Part 7 Sample Size and Power Goodness-of-Fit Test February 5, 2009 Homework 4 is on the last page. Goal: To make it very clear that you can\'t calculate a reasonable sample size unless you can establish what a medically important differenc... Date Added: 2009-06-18 20:26:01 |
| Lab 10 Presentation - Robot Exchange.ppt Path: Carnegie Mellon >> CS >> 16311 Fall, 2009 Description: Robot Exchange Student Defined Lab Demo Date: April 29, 2009 The Task A team of two robots must enter an exchange zone, exchange a golf ball, and exit the environment. Enter the Exchange Zone One team member (Robot A) starts with a golf ball... Date Added: 2009-06-18 20:26:18 |
| c221lab6.ps Path: CSU Bakersfield >> CS >> 221 Fall, 2009 Description: %!PS-Adobe-2.0 %Creator: dvips(k) 5.92b Copyright 2002 Radical Eye Software %Title: c221lab6.dvi %Pages: 1 %PageOrder: Ascend %BoundingBox: 0 0 612 792 %EndComments %DVIPSWebPage: (www.radicaleye.com) %DVIPSCommandLine: dvips c221lab6 %DVIPSParameter... Date Added: 2009-06-18 20:28:12 |
| gdb.ps Path: CSU Bakersfield >> CS >> 221 Fall, 2009 Description: #%-12345X@PJL JOB @PJL SET RESOLUTION = 600 @PJL SET BITSPERPIXEL = 2 @PJL SET ECONOMODE = OFF @PJL ENTER LANGUAGE = POSTSCRIPT %!PS-Adobe-3.0 %Title: http:/www.cs.dal.ca/studentser.PDF %Creator: PScript5.dll Version 5.2 %CreationDate: 9/22/2006 12:9... Date Added: 2009-06-18 20:28:16 |
| c376rv1.ps Path: CSU Bakersfield >> CS >> 376 Fall, 2009 Description: %!PS-Adobe-2.0 %Creator: dvipsk 5.58f Copyright 1986, 1994 Radical Eye Software %Title: c376rv1.dvi %Pages: 1 %PageOrder: Ascend %BoundingBox: 0 0 612 792 %DocumentPaperSizes: Letter %EndComments %DVIPSCommandLine: dvips c376rv1 %DVIPSParameters: dpi... Date Added: 2009-06-18 20:29:11 |
| c321lab5.ps Path: CSU Bakersfield >> CS >> 321 Fall, 2009 Description: %!PS-Adobe-2.0 %Creator: dvipsk 5.58f Copyright 1986, 1994 Radical Eye Software %Title: c321lab5.dvi %Pages: 1 %PageOrder: Ascend %BoundingBox: 0 0 612 792 %DocumentPaperSizes: Letter %EndComments %DVIPSCommandLine: dvips c321lab5 %DVIPSParameters: d... Date Added: 2009-06-18 20:29:26 |
| 21_application_gaussian_quadrature.ps Path: N.C. State >> MA >> 427 Fall, 2008 Description: %!PS-Adobe-2.0 %Creator: dvipsk 5.58f Copyright 1986, 1994 Radical Eye Software %Title: 21_application_gaussian_quadrature.dvi %Pages: 2 %PageOrder: Ascend %BoundingBox: 0 0 612 792 %DocumentPaperSizes: Letter %EndComments %DVIPSCommandLine: dvips 21... Date Added: 2009-06-18 20:30:08 |
| reading12.pdf Path: Montana >> AGEC >> 445 Spring, 2008 Description: ... Date Added: 2009-06-18 20:32:21 |
| Solutions1.pdf Path: Midwestern State University >> ECONS >> 323 Fall, 2009 Description: EconS 323 Labor Economics Solutions to assignment 1 1. (50 pts.) Suppose that the labor supply curve for school teachers is LS = -30,000 + 320W and the demand curve for school teachers is LD = 90,000 - 280W where L = # of school teachers and W = dail... Date Added: 2009-06-18 20:35:56 |
| C025RequirementConcepts.ppt Path: UNF >> CEN >> 6016 Fall, 2008 Description: The Trouble with Requirements From Use Cases Requirements in Context Second Edition 1 Traditional Activities Typical development activities include: business modeling requirements gathering, analysis and design, construction, testing, ... Date Added: 2009-06-18 20:37:15 |
| grad590d_07_notes07.pdf Path: Purdue >> GRAD >> 590 Fall, 2009 Description: ... Date Added: 2009-06-18 20:38:57 |
| Phy151_3.ppt Path: Penn State >> PHYSICS >> 151 Fall, 2009 Description: ... Date Added: 2009-06-18 20:39:36 |
| lecture13.ppt Path: University of Illinois, Urbana Champaign >> MATSE >> 346 Fall, 2009 Description: Properties and Selection of Engineering Materials Lecture 13 13.1. Review of yielding limited selection Case Spring Flywheel (vol efficient) Fan Elastic hinge MatSE 346, Y Q Sun, UIUC, Fall 1999 P y2/E y y/ y/E 1 Flywheel (mass efficient) y/ ... Date Added: 2009-06-18 20:39:46 |
| Finalttk.doc Path: Iowa State >> ECON >> 101 Fall, 2008 Description: Economics 101 Spring 2002 Section 5 -Alley Things to Know for the Final Exam Old Stuff: Know definitions. Calculating and interpreting elasticities Working with supply and demand (i.e. finding equilibrium, moving curves) Finding an optimum consumptio... Date Added: 2009-06-18 20:40:18 |
| lect_11_mem.pdf Path: Harvard >> CS >> 148 Fall, 2009 Description: Lecture 11 MOS Memory and y Array Subsystems Gu-Yeon Wei School of Engineering and Applied Sciences Harvard University guyeon@eecs.harvard.edu CS148/CS248 1 O e e Overview Reading Weste & Harris Chapter 11 I t d ti Introduction Memories are one... Date Added: 2009-06-18 20:42:33 |
| slides02.pdf Path: Neumont >> IFT >> 1010 Fall, 2009 Description: Chapitre 2: Objets et Types de base Prsentation pour Java Software Solutions Foundations of Program Design Deuxime Edition par John Lewis et William Loftus Java Software Solutions publi par by Addison-Wesley Presentation slides are copyright 2000 b... Date Added: 2009-06-18 20:42:36 |
| Lab03.pdf Path: Allan Hancock College >> COMP >> 1100 Fall, 2009 Description: COMP1100-2005-04 The Australian National University 1 Faculty of Engineering & Information Technology Department of Computer Science COMP1100-2005-04 Notes for Laboratory Session 03 1 Objectives Laboratory session 02 provided a basic introductio... Date Added: 2009-06-18 20:43:05 |
| using_voyager_skygazer.pdf Path: Washington >> ASTRO >> 190 Fall, 2009 Description: Name _ Date _ Getting Acquainted with the Planetarium Program \"Voyager Sky Gazer\" Steps to take within \"Voyager\": Control: Set time Set location Set horizon Time, Display, Location Panels Data panel Decide how much instant control you want on the s... Date Added: 2009-06-18 20:43:54 |
| Carroll_et_al_2004.pdf Path: Washington >> ARCHY >> 403 Winter, 2008 Description: Journal of Archaeological Method and Theory, Vol. 11, No. 1, March 2004 ( C 2004) Prologue: Toward an Archaeology of Place Brenda J. Bowser1 KEY WORDS: archaeology of place; landscape archaeology. The ability to understand multiple perspectives on ... Date Added: 2009-06-18 20:44:09 |
| 9table7.pdf Path: Oregon State >> SR >> 1061 Fall, 2009 Description: Table 7. Rattail fescue response in chemical fallow in Oregon, 2004. Weed control Pendleton Treatment Rate fl oz /acre Untreated check glyphosate glyphosate glyphosate glyphosate Surefire glyphosate glyphosate glyphosate glyphosate Surefire glyphosat... Date Added: 2009-06-18 20:44:48 |
| chap4.pdf Path: Western Michigan >> ECON >> 202 Fall, 2009 Description: Chapter4 Supply and demand are the two words that economists use most often. Supply and demand are the forces that make market economies work. DEMAND Quantity demanded is the amount of a good that buyers are willing and able to purchase. Law of ... Date Added: 2009-06-18 20:44:56 |
| iln00z.txt Path: University of Illinois, Urbana Champaign >> ATMOS >> 20081118 Fall, 2009 Description: UPPER AIR CALCULATIONS AND PLOTTING (Ver 5.48.1-LINUX-X11) Current filename: /mnt/noaaport/nwstg/convert/08111812_upa.wxp Date: 1200Z 18 NOV 08 Searching for KILN. Searching the city database file for: KILN . Date:1200Z 18 NOV 08 Station: KILN... Date Added: 2009-06-18 20:45:12 |
| e3.pdf Path: SUNY Albany >> M >> 301 Fall, 2009 Description: w yw yw yw yw yxw yw yxw yw yw 1Pr PPv1Pw PP11Pr 1P s P1w P11Pr 1P G Iq e c e G k x i qYIaIq i W Iq Ra I iqrI QI e R c T T R I X vp1fR6fr1R s fYv`p`dfTjPfp1pPhgpB1ss1x6l G a Iq R Ia I Xq U I i I r Ia IY W Xq Y R I wa e Y R I q Ia R Ya R I g F ... Date Added: 2009-06-18 20:46:51 |
| HW 8 Soln Sp09.pdf Path: Mich Tech >> CM >> 3120 Spring, 2008 Description: ... Date Added: 2009-06-18 20:47:25 |
| coding.pdf Path: WVU >> EE >> 591 Fall, 2009 Description: ... Date Added: 2009-06-18 20:48:38 |
| Sonnert-Who Succeeds in Science-Selections.pdf Path: Wesleyan >> SOC >> 244 Spring, 2009 Description: ... Date Added: 2009-06-18 20:50:27 |
| chap10-a.pdf Path: Minnesota >> STAT >> 8053 Fall, 2008 Description: togram of as.vector(cor(data[1:13 10 20 30 0 0.0 Frequency 0.4 0.8 as.vector(cor(data[1:13, 1:13]) ... Date Added: 2009-06-18 20:51:00 |
| f0622.pdf Path: Laurentian >> BIOL >> 2200 Fall, 2009 Description: 22 Community Development Outline Concepts Secondary Succession Patterns & Mechanisms Species involved Applications Community Fig. 21.4 Structure Function Time Snapshot Progression Community Development Why do co... Date Added: 2009-06-18 20:51:41 |
| soyinkasg1.doc Path: Shepherd >> SUENG >> 209 Fall, 2009 Description: ENG 209-Baker Name:_ Study Guide Soyinka, Death and the King\'s Horseman, Scenes one and two 1) What is the setting for the first scene? What are its possible implications? 2) What is the \"other side\" to which the PraiseSinger refers? 3) What is ... Date Added: 2009-06-18 20:51:48 |
| cs2200pres02_processors.ppt Path: Georgia Tech >> CS >> 2200 Fall, 2008 Description: CS2200 Presentation 2 Processors Our Road Map Processor Memory Hierarchy I/O Subsystem Parallel Systems Networking Five Classic Components Processor C ontrol Me ory m Datapath I nput Output What does the processor do? Knows where it is in pr... Date Added: 2009-06-18 20:53:13 |
| tg1431_Sullivan_Fall2005.doc Path: Georgia Perimeter >> MATH >> 1431 Summer, 2008 Description: GEORGIA PERIMETER COLLEGE MATHEMATICS ACADEMIC GROUP TEACHING GUIDE - MATH 1431 I. Title: Introduction to Statistics (Math 1431) II. Prerequisite: Math 1101 (Introduction to Mathematical Modeling), or Math 1111 (College Algebra), or Math 1113 (Preca... Date Added: 2009-06-18 20:53:47 |
| YBR288C.t2k.dssp-ebghstl-logo.pdf Path: UCSC >> YBR >> 288 Fall, 2009 Description: YBR288C.t2k EBGHSTL 3 2 1 C EEEEEE TTS EEEE X 1 10 20 30 40 E 3 2 1 CTT CC G X T S E T H H TGSS H X X T S E S G H H CCEC S CCCSE SXXXXXXESC X X X C C CE 51 60 70 80 90 T 3 2 1 E T E T E T H HHH X X X T S C E SSBEGGGX... Date Added: 2009-06-18 20:55:44 |
| Invent-Intro.pdf Path: S.F. State >> BUS >> 786 Fall, 2008 Description: INVENTORY MANAGEMENT Professor Robert Saltzman Operations Analysis Robert Saltzman 2005 Inventory What is it? Idle goods, waiting to be used or sold Inventory can take many forms: Finished Goods: Food, clothes, cars, electronics, . Unfinished G... Date Added: 2009-06-18 20:58:08 |
|
|
Get Started With Course Hero Today!
Get study guides, join study groups, and more!
Sign up in seconds with your Facebook account!
Course Hero is a Facebook Application Partner.
Click below to sign-up for FREE.
Our Social Learning Network was built to provide students and key learning partners like professors a platform to share, meet and collaborate while accelerating their comprehension of course-related theories and concepts. We are committed to providing you immediate access to a growing wealth of study materials and an unparalleled academic network of students, professors and other key partners. Why do you care? Because you want the best grade possible and at times need a 24/7 resource that’s responsive to your needs. |
|
What People Are Saying About Course Hero
|
|||
|
|||
|
Explore the benefits of joining Course Hero's social learning network.
|
|||
![]() |
Get millions of study materials now!Need lecture notes for a missed class or want insightful explanation of the theories and concepts you learn in class? Look no further, Course Hero’s Study Materials empowers you to find a broad and deep set of materials that can help you right now!
Click below to sign-up for FREE.
|
||
![]() |
Get over 200,000 textbook solutions now!Having difficulty with your homework and need documents that are relevant for your Textbook? Don't be frustrated. Course Hero's Textbook Help presents you study materials from many college courses.
Click below to sign-up for FREE.
|
||
![]() |
Meet over 300,000 students and your fellow classmates now!Want to meet your current classmates or those that took the class last year? Don’t worry or have anxiety. Course Hero’s Study Groups gives you the seamless opportunity to develop both anonymous or direct relationships with those classmates whom you want to meet and get help from right now!
Click below to sign-up for FREE.
|
||


