Course Solutions And Notes - international 46
| fifo0.txt Path: Wisconsin >> DRM >> 1800 Fall, 2009 Description: dead 094e 0165 0000 223f b48e 0ac4 07b7 0a40 08d8 06d7 0c54 0740 0acc 071b 0b0b 0684 0a28 0784 0997 0694 07cb 0aff 0753 0cc7 05a4 0baf 05eb 09cb 0794 0814 0917 0697 0c30 05d7 0b2c 07c4 092f 07d3 0923 0af0 0708 0a9b 062b 0a3f 07a3 0945 07c7 08a8 09af ... Date Added: 2009-06-24 06:26:23 |
| midterm_sol103.pdf Path: Texas >> CS >> 354 Fall, 2008 Description: CS354 Name: Email: Midterm Examination 1 Solutions Fall 2003 Each problem section is worth the indicated number of points. There are 5 questions in total that are each worth 20 points. 1. You have discovered (for better or worse) that you are an ... Date Added: 2009-06-24 06:27:59 |
| PROCESSEUR.ppt Path: CUNY Queens >> DB >> 840 Fall, 2009 Description: RSEAU ET PROCESSEUR REDONDANT ET NON REDONDANT Deux noeuds rseau redondant Deux noeuds rseau et contrle redondant. ... Date Added: 2009-06-24 06:29:19 |
| 91305.pdf Path: Texas A&M University, Corpus Christi >> FACULTY >> 1470 Fall, 2009 Description: ... Date Added: 2009-06-24 06:29:26 |
| HeatTransfer_7.ppt Path: Embry-Riddle FL/AZ >> ES >> 403 Fall, 2009 Description: Radiation Basics Light properties Remember that light is composed of photons which behave as both particles and waves. As waves, we can define the type of radiation by its wavelength, ( m), or frequency, (hz), which are related by: v = c ... Date Added: 2009-06-24 06:30:27 |
| final-guide.pdf Path: Binghamton >> CLAS >> 214 Fall, 2009 Description: Final Exam 5/12/08 STUDY GUIDE GREEK DRAMA TO SUMMARIZE: Parts 1 and 2 focus on texts and discussion from 3-Apr (Oedipus at Colonus) through 8-May (Grouch). Part 3 is comprehensive (whole-semester) in scope, with special attention to readings assi... Date Added: 2009-06-24 06:31:02 |
| sample01.pdf Path: Washington >> M >> 309 Fall, 2009 Description: Sample Test I for M309 (1a) There are two tanks, with pipes carrying salt water as shown: 4 gal/day, 1 lbs salt/gal ? 2 gal/day T1 T2 1 gal/day of mixture in T2 ? 1 gal/day 3 gal/day of mixture in T1 ? T1 holds 10 gallons of salt water; T2 hold... Date Added: 2009-06-24 06:32:13 |
| RE122WTSys1.ppt Path: Benjamin Franklin Institute of Technology >> MY >> 4300 Fall, 2009 Description: 12.2 Wind Turbine Systems Wind Turbine Theory Frank R. Leslie, B. S. E. E., M. S. Space Technology, LS IEEE 3/10/2009, Rev. 2.0.1 fleslie @fit.edu; (321) 674-7377 www.fit.edu/~fleslie Crude oil ~$47.46 on 3/10/2009 In Other News . . . Space Shutt... Date Added: 2009-06-24 06:32:28 |
| ProbSheet5.pdf Path: Allan Hancock College >> MECH >> 3400 Fall, 2009 Description: ... Date Added: 2009-06-24 06:32:36 |
| CS182W3L2Iteration.pdf Path: MSOE >> CS >> 182 Fall, 2009 Description: CS182 W0203 LectureW3L2 12/19/2002 Program Control Using Iteration Constructs CS-182 Computer Programming Lillian Witzke Decision Branching if construct FALSE Condition TRUE Multiple Decisions if else if construct Case 1 Case 2 . Case n ... Date Added: 2009-06-24 06:32:59 |
| syllabus.ppt Path: San Diego State >> GS >> 340 Fall, 2009 Description: ... Date Added: 2009-06-24 06:33:09 |
| 1substitute_custodial_study.ppt Path: Wisconsin >> ENGR >> 476 Fall, 2009 Description: Assessing the Need for Substitute Custodians in the Madison Metro School District Natalia Davis Kelly O\'Brien May 9, 2003 Project First, we met with Doug Pearson. He changed our project to assessing the need for more substitute custodians. ... Date Added: 2009-06-24 06:33:22 |
| baumberg00reliable.pdf Path: Georgia Tech >> ECE >> 4006 Fall, 2008 Description: Reliable Feature Matching Across Widely Separated Views Adam Baumberg Canon Research Centre Europe Ltd 1 Occam Court, Surrey Research Park Guildford, Surrey GU2 5YJ United Kingdom adamb@cre.canon.co.uk Abstract In this paper we present a robust meth... Date Added: 2009-06-24 06:33:34 |
| TeamsOf2or3ProsCons.doc Path: Arizona >> CS >> 335 Fall, 2009 Description: vti_encoding:SR|utf8-nl vti_timelastmodified:TR|31 Oct 2002 17:44:10 -0000 vti_extenderversion:SR|4.0.2.6513 vti_backlinkinfo:VX| vti_cacheddtm:TX|31 Oct 2002 17:44:10 -0000 vti_filesize:IR|20992 vti_cachedlinkinfo:VX| vti_cachedsvcrellinks:VX| vti_c... Date Added: 2009-06-24 06:34:31 |
| 1026-small.pdf Path: Trinity U >> CS >> 4320 Fall, 2009 Description: CSCI 4320 October 26, 2007 Administrivia As mentioned in e-mail - Homework 4 on Web, due next Friday. Slide 1 One More Memory Management Strategy - Segmentation Idea - make program address \"two-dimensional\" / separate address space To map virt... Date Added: 2009-06-24 06:34:38 |
| T0473.dssp-ehl2-logo.pdf Path: UCSC >> T >> 0473 Fall, 2009 Description: T0473 dssp-ehl2 2 1 10 20 30 40 H 2 1 H H 51 H 60 DA D KLVKE LNEYFEKKEV 50 1 MK I TKDMI IADVLQMDRGTAPIFINNG M HC L GC P S SM G E S IE D A C AV H G I ... Date Added: 2009-06-24 06:35:01 |
| Sean-Davis-paper.pdf Path: Georgia Tech >> ATOC >> 5235 Fall, 2009 Description: Characterizations of Atmospheric Seeing Conditions at Mauna Loa Solar Observatory Sean M. Davis PAOS/LASP ATOC 5235 4/27/2003 1 Introduction: The quality of images taken from Solar imaging telescopes, such as the Precision Solar Photometric Telesco... Date Added: 2009-06-24 06:35:20 |
| C5BSF04.pdf Path: Illinois State >> CHE >> 232 Fall, 2008 Description: Chapter 5 Bonus Bonus Page 1) Indicate all the chiral carbons in the structures shown below. Some structures may have no chiral centers! a) b) c) d) 2) Indicate whether the chiral centers in the following molecules are R or S. a) H Cl b) H H H H c)... Date Added: 2009-06-24 06:35:56 |
| BEATOV~1.DOC Path: N. Illinois >> Z >> 114156 Fall, 2009 Description: Patrick Yeagle Overview 11/13/2007 International Student Beat This is a somewhat unique beat because it essentially covers a department of the college. It relies heavily on data and interviews from the Office of International Admissions. This fact ca... Date Added: 2009-06-24 06:39:42 |
| T0402.t04.bys-logo.pdf Path: UCSC >> T >> 0402 Fall, 2009 Description: T0402.t04 bys 4 3 2 1 10 20 30 40 H 4 3 2 1 G P E P T G E P E P E G T G E P H G P H 4 3 2 1 G D H G E Y E G P T P E Y E P E P H 101 110 120 G P H G P H G E P H E P H G P H G E H P H P S 130 KD W FQGED SPSFVVIKIVPEQIRILNS D... Date Added: 2009-06-24 06:46:39 |
| ssfuser.pdf Path: University of Illinois, Urbana Champaign >> ECE >> 541 Fall, 2008 Description: Parallel Real-time Immersive Modeling Environment (PRIME) Scalable Simulation Framework (SSF) V ERSION 1.0 USERS MANUAL JASON L IU Florida International University School of Computing and Information Sciences Miami, FL 33199 November 26, 2007 DIS... Date Added: 2009-06-24 06:53:02 |
| Ch 13.doc Path: Idaho >> ME >> 345 Fall, 2008 Description: ... Date Added: 2009-06-24 06:53:51 |
| 212a_HW1Sol_s09.pdf Path: City College SF >> CHEM >> 212 Fall, 2009 Description: HovW.\'-c,lr\'9|.r.c$^vz \\t rrrz,rl\\1 , Iats .s*,rLV ci \'-:oY\"1ii n-ov\' .wrdlor ;-.-rt>@.N rt\\-. -rh\" *l:, ?: d\': r\\1 n\'/\"f -rt\"{\'tn ;:T:.:\":JJ;:L:* I o w on\' \\.\' \" l^\'as avr a\",-^t ^* \'\" fn\" 9-f4aat\"ra Jva\'v\'tn $-ot* a$rr-3... Date Added: 2009-06-24 06:54:21 |
| Memory.ppt Path: Buffalo State >> FACULTY >> 415 Fall, 2009 Description: The Development of Infant Memory PSY 415 Dr. Schuetze Food for thought Can infants form memories? What do infant memories look like? If infants can form memories, why don\'t adults remember things that happened to them when they were in... Date Added: 2009-06-24 06:55:32 |
| RevisionQuestions.pdf Path: Allan Hancock College >> STAT >> 3002 Fall, 2009 Description: STAT3002 Applied Statistics: Revision questions 1. Consider the normal linear model defined by Y N (X, 2 I). (a) State the maximum likelihood estimate of (, 2 ). You do not need to derive the MLE, just write down the answer. [2 marks] (Write you... Date Added: 2009-06-24 07:01:58 |
| SequenceLocks.ps Path: Michigan State University >> CSE >> 470 Fall, 2009 Description: %!PS-Adobe-3.0 %Creation Date: December 4, 2001 5:47:50 pm %Creator: DoME by Honeywell Technology Center, Honeywell Inc. %DocumentFonts: Helvetica %EndComments %BeginSetup /LS {show} def /CS {dup stringwidth [ -0.5 0 0 -0.5 0 0 ] transform rmoveto sh... Date Added: 2009-06-24 07:03:42 |
| 03-CmpE202-Pattern-Proj3-Reqs-Spr08.doc Path: San Jose State >> CMPE >> 202 Spring, 2008 Description: CmpE 202 Software Systems Engineering Team Project #3: Pattern Assignments Due Date: Check the due date schedule for pattern assignments due date. Major Tasks: 1. Use traditional model to model the concepts definitions (Meta models) 2. Use software ... Date Added: 2009-06-24 07:05:36 |
| vietnam1.doc Path: Ill. Chicago >> HIST >> 300 Fall, 2008 Description: Model Student paper (hist 300; final paper) Soviet Representations of U.S. Involvement in Vietnam: 1968, 1973 INTRODUCTION The role of the Soviet Union in the Vietnam War is usually overlooked in spite of being of its monumental significance. This wa... Date Added: 2009-06-24 07:07:41 |
| Summer 2007 Ch 20.pdf Path: Colorado >> CHEM >> 1111 Fall, 2008 Description: Chapter 20 Thermodynamics: Entropy, Free Energy, and the Direction of Chemical Reactions Limitations of the First Law of Thermodynamics E = q + w Euniverse = Esystem + Esurroundings Esystem = -Esurroundings Esystem + Esurroundings = 0 = Euniverse Th... Date Added: 2009-06-24 07:07:57 |
| Ivanek3.doc Path: Stanford >> MSANDE >> 237 Fall, 2009 Description: Follow-up of July 11lecture FIXED BROADBAND WIRELESS ACCESS (BWA): ALTERNATIVES TO WIRELINE BROADBAND ACCESS SELECTING FREQUENCY BANDS FOR FIXED BROADBAND WIRELESS ACCESS (BWA) Stanford MS&E 237 Summer 2002 1 Ferdo Ivanek July 18, 2002 BASIC SEL... Date Added: 2009-06-24 07:08:38 |
| qsolution13~.pdf Path: Solano Community College >> MATH >> 108 Fall, 2008 Description: ... Date Added: 2009-06-24 07:10:37 |
| ClassNotes7.pdf Path: Harvard >> MATHE >> 311 Fall, 2009 Description: ... Date Added: 2009-06-24 07:15:18 |
| lecture17.pdf Path: UWO >> STATS >> 120 Fall, 2009 Description: Statistics 120 Mosaic Plots First Prev Next Last Go Back Full Screen Close Quit Who Listens To Classical Music? The following table of values shows a sample of 2300 music listeners classified by age, education and whether they listen to classical m... Date Added: 2009-06-24 07:15:29 |
| log2.txt Path: Foothill College >> CIS >> 068 Fall, 2009 Description: Garcia Apr 3 11:04 vi Smith Apr 3 Smith cc Ueda Apr 3 12:36 ls Smith Apr 4 12:45 ls Smith Apr 4 12:47 cat Ueda Apr 4 12:56 ls Smith Apr 4 13:55 cat Smith Apr 4 14:00 vi Chang Apr 4 14:05 cc Garcia Apr 4 14:07 vi Ueda Apr 5 00:05 cat Ueda Apr 5 00:30 ... Date Added: 2009-06-24 07:15:36 |
| lab9.txt Path: Foothill College >> CIS >> 068 Fall, 2009 Description: Script started on Sat Jun 13 12:50:01 2009 sh-2.05b$ ls -l ~ total 350 -rw-r- 1 owenjohn cs68a04w 0 Jun 6 14:50 ! drwx-r-x 2 owenjohn cs68a04w 512 Jun 1 22:11 Archives drwx-r-x 2 owenjohn cs68a04w 2048 Jun 1 22:28 Docum dr... Date Added: 2009-06-24 07:15:53 |
| Test_2_Solutions.pdf Path: Southern Illinois University, Carbondale >> MATH >> 140 Summer, 2008 Description: ... Date Added: 2009-06-24 07:19:59 |
| Ch3_Practice.pdf Path: Cuyamaca College >> MATH >> 170 Fall, 2008 Description: Chapter 3 Practice Problems Directions: Place all work and answers on another piece of paper. Be sure to write neatly and circle you answers. 1. Name the reference angle: 135 2. Name the reference angle: 280 40 Use a calculator to find each of the f... Date Added: 2009-06-24 07:20:04 |
| slides_algebra.pdf Path: Ohlone >> MATH >> 111 Fall, 2008 Description: Systems of Equations . Unique Solutions Generalized Solve . Systems of linear equations were introduced in beginning { 6x + 5y = 7 algebra and look like . 8x + 6y = -2 To solve such a system in MATLAB , set up a matrix of coefficients and a matrix ... Date Added: 2009-06-24 07:20:53 |
| 6 - fibers.ppt Path: BYU >> IT >> 443 Fall, 2008 Description: Glass structure Glass composition Glass ingredients FIGURE 6-2 Soot deposition inside a fused-silica tube. Jeff Hecht Understanding Fiber Optics, 4e Copyright 2002 by Pearson Education, Inc. Upper Saddle River, New Jersey 07458 All rights reser... Date Added: 2009-06-24 07:24:37 |
| hw3rans.ps Path: Maryland >> CMSC >> 250 Fall, 2007 Description: %!PS-Adobe-2.0 %Creator: dvips(k) 5.86 Copyright 1999 Radical Eye Software %Title: hw3rans.dvi %Pages: 2 %PageOrder: Ascend %BoundingBox: 0 0 612 792 %EndComments %DVIPSWebPage: (www.radicaleye.com) %DVIPSCommandLine: dvips -t letter -o hw3rans.ps hw... Date Added: 2009-06-24 07:31:14 |
| P07014-LA.pdf Path: Cuyamaca College >> DOCS >> 081017 Fall, 2009 Description: ERIC GIBSON INTERIM DIRECTOR County of San Diego DEPARTMENT OF PLANNING AND LAND USE 5201 RUFFIN ROAD, SUITE B, SAN DIEGO, CALIFORNIA 92123-1666 INFORMATION (858) 694-2960 TOLL FREE (800) 411-0017 www.sdcounty.ca.gov/dplu NOTICE OF INTENT TO ADOPT ... Date Added: 2009-06-24 07:33:28 |
| T0497.t06.n_notor2-logo.pdf Path: UCSC >> T >> 0497 Fall, 2009 Description: T0497.t06 n_notor2 3 2 1 1 10 20 30 40 N 3 2 1 H N H N P B N B N B N B A B A B N B 51 60 70 80 90 N 3 2 1 S G N H G N P B N B N B A B N B N S H 101 110 120 130 N H N G N S G A B N G B N 140 NP Y VAAWY EG... Date Added: 2009-06-24 07:36:09 |
| Precalculus001.pdf Path: Lake County >> ENG >> 504 Fall, 2009 Description: Syllabus for Precalculus MTH 144 Section 001 Spring 2006 M/T/W/R/F 8:00 8:50 Room A124 Instructor: Phone: Email: Web Address: Office: Hours*: Time Byron Hunter (847) 543-2910 bhunter@clcillinois.edu http:/clcpages.clcillinois.edu/home/eng504 A140 ... Date Added: 2009-06-24 07:48:45 |
| 3_ecology.pdf Path: Canada College >> BIOL >> 101 Fall, 2009 Description: Word list 3 Biology 101 Biomes & Environments Remember to practice with the study questions on the BIOL 101 web site. Annual Autotroph Biomass Carnivore Climate Consumer Deciduous Decomposer Ecology Ecosystems Evergreen Feral Food web Herbivore 1. ... Date Added: 2009-06-24 07:49:15 |
| nutrient.pdf Path: Canada College >> BIOL >> 215 Fall, 2009 Description: BIOL 215 Nutrient Procurement Consumers Producers Decomposers Nutrients available Abiotic b) primary consumers; c) secondary consumers; d) decomposers. Stinkhorn Earth... Date Added: 2009-06-24 07:49:27 |
| RAH0InfoGrading.doc Path: University of Illinois, Urbana Champaign >> ECE >> 110 Fall, 2008 Description: Research Activities Handout 0 (M.-C. Brunet) General Claim, Deadlines and Grading Scheme FALL 2007 Revised August 14, 2007 General Claim The ECE 110 Research Activities have been designed to allow students to make individual choices regarding their l... Date Added: 2009-06-24 07:52:25 |
| lect13.pdf Path: Sonoma >> BIOL >> 333 Fall, 2008 Description: announcements greenhouse data assigned reading pg 267-272, 344-346 Lecture 13: keystone species, biodiversity & ecosystem function keystone species concept proposed by R. T. Paine in 1966, 1969 species with disproportionately large influences ... Date Added: 2009-06-24 07:54:26 |
| tth_spring_08.pdf Path: Orange Coast College >> CHEM >> 221 Fall, 2008 Description: CHEMISTRY 221 Spring 2008 JOHN CONGLETON Week 1 2 Date 1/29 2/5 Tuesday Introduction, Safety, Lab Notebook Lab 01: Melting Point Lab 02: Solubility (Expt. 2, Parts A, B, and D) Lab 03: Crystallization Lab 04: Extraction (Expt. 4, Part B and D) Lab 05... Date Added: 2009-06-24 07:57:57 |
| assign4.pdf Path: Clemson >> MATH >> 129 Fall, 2009 Description: MthSc 129 - Goddard - Spring09 Assignment 4 1. From Scheinerman do: Section 15: 1, 2, 7, 8, 12 Section 16: 1, 2, 3, 5, 7, 8, 14, 20 Section 19: 1, 4, 7, 8 2. Attach Labs 10 and 11. Due Wednesday 25 February. ... Date Added: 2009-06-24 07:58:33 |
| math471Assignments2.xls Path: University of South Dakota >> MATH >> 471 Fall, 2009 Description: Sheet1 vti_encoding:SR|utf8-nl vti_author:SR|njiang vti_modifiedby:SR|njiang vti_timecreated:TR|02 May 2006 01:27:53 -0000 vti_timelastmodified:TR|02 May 2006 01:27:53 -0000 vti_filesize:IR|15360 vti_extenderversion:SR|4.0.2.3015 vti_backlinkinfo:VX|... Date Added: 2009-06-24 07:59:41 |
| ToStudent4math123S09hw.xls Path: University of South Dakota >> MATH >> 123 Spring, 2008 Description: Sheet1 vti_encoding:SR|utf8-nl vti_author:SR|njiang vti_modifiedby:SR|njiang vti_timecreated:TR|07 May 2009 15:01:43 -0000 vti_timelastmodified:TR|07 May 2009 15:08:14 -0000 vti_filesize:IR|53760 vti_extenderversion:SR|4.0.2.3015 vti_backlinkinfo:VX|... Date Added: 2009-06-24 07:59:53 |
| HJ09a.pdf Path: SD State >> BIOL >> 204 Fall, 2009 Description: Chapter 9 The Molecular Mechanisms of Gene Regulation Gene regulation Coordinate regulation Negative regulation Repressor Inducible transcription Inducer Repressible transcription Aporepressor Co-repressor Transcriptional activator protein Autoregul... Date Added: 2009-06-24 08:01:32 |
| StackImpTest.txt Path: NJIT >> ASS >> 602 Fall, 2009 Description: import junit.framework.*; import mylist.List; import mylist.StackImp; public class StackImpTest extends TestCase { public static StackImp instance = new StackImp(); public StackImpTest(String testName) { super(testName); ... Date Added: 2009-06-24 08:02:27 |
| Invertebrates2.pdf Path: El Paso CC >> BIOL >> 212 Fall, 2009 Description: Invertebrates (con\'t) b. Phylum Rotifera Multicellular, microscopic, aquatic Freshwater Jaws, organ systems, mouth and anus Pseudocoelomates Parthenogenesis some species all female c. Phylum Nemertea: ribbon worms Mostly marine, some freshwater, som... Date Added: 2009-06-24 08:03:27 |
| maya.pdf Path: North-West Uni. >> EARTH >> 438 Fall, 2009 Description: Slides with black outlines from: Snowballearth.org Maintained by Paul Hoffman, Harvard University Overview What is the Snowball Earth Hypothesis? Evidence for Snowball Earth How did it start? How did it stop? Controversies What factors specifi... Date Added: 2009-06-24 08:04:12 |
| Alismataceae.pdf Path: Iowa State >> BIO >> 366 Fall, 2009 Description: ALISMATALES Alismataceae Water Plantain Family Aquatic and marshy herbs with basal leaves Flowers usually whorled, perianth in distinct calyx and corolla Genus to Know: Sagittaria Ovary position: superior Number of stamen: 6, 9 or many Fruit type: ... Date Added: 2009-06-24 08:06:12 |
| straindensity.txt Path: Michigan >> PHYSICS >> 1200 Spring, 2009 Description: 1.3697056396e-21 1.25031526902e-21 1.20972237615e-21 1.19644735805e-21 1.19086890676e-21 1.19765643923e-21 1.20134875927e-21 1.19766794611e-21 1.19687166005e-21 1.19966826915e-21 1.20071683491e-21 1.20000129633e-21 1.20428722634e-21 1.20366787461e-21... Date Added: 2009-06-24 08:07:12 |
| MICE0195.pdf Path: Illinois Tech >> MICE >> 0195 Fall, 2009 Description: LBNL-63804 MICE Note-195 AC Losses in the MICE Channel Magnets Is This a Curse or a Blessing? M. A. Greena, H. Wub, L. Wangb, L. L. Kaib, L. X. Jiab, and S. Q. Yangc a) Lawrence Berkeley National Laboratory, Berkeley CA 94720, USA b) Institute of Cr... Date Added: 2009-06-24 08:07:43 |
| hwk10C.pdf Path: UCCS >> MATH >> 135 Fall, 2008 Description: 4.3 Derivatives and the Shapes of Graphs 2. (a) 1(;/) = Xl - ;1\' - 1 > (b) 4.1\"- 1 =} fix) = 41\'\" - 4 =} =0 .J(.);:I - 1) = 4(J; - 1)(;r~ + T + 1). So .t(x) > 0 :;> [4 (x 2 + :1\' + 1) > 0] :r > 1. Thus. I i, increasing 0n (1,0:) ... Date Added: 2009-06-24 08:16:31 |
| solutionsunit6.pdf Path: Richland Community College >> PHIL >> 100 Fall, 2009 Description: Unit Six Solutions Practice Exercise 1: 1. 2. 3. 4. 5. 6. 7. 8. 9. 10. If (Harold umpires the ball game,) then <it will be honestly called.> <Kevin will try out for the play> if (Martha tries out also.) (Threatening to use nuclear weapons is immoral)... Date Added: 2009-06-24 08:16:58 |
| grading criteria spring 2003.doc Path: ASU >> MTE >> 484 Fall, 2009 Description: GRADING CRITERIA DUE DATES: All materials being turned in are due at the beginning of class (no later than 9 am) on the assigned due date (with the exception of Collabra). Materials turned in late but within 24 hours of the due date will be accepted... Date Added: 2009-06-24 08:21:05 |
| mte484syllabus-spring2002.doc Path: ASU >> MTE >> 484 Fall, 2009 Description: MTE 484 Time and place: Instructor: Phone: E-Mail: Textbook: Prerequisites: MW 8:40 - 11:30 and F 9:40 10:30 in ED 238 Dr. Beth Jones 480-965-0549 bjones@asu.edu Spring 2002 Office: PSA 208 Office Hours: TTh 1:40-2:30, F 10:40-11:30 and by appt. W... Date Added: 2009-06-24 08:21:10 |
| wl 6 -different written codes.pdf Path: Johns Hopkins >> COG >> 311 Fall, 2008 Description: Written language processing in different written language codes Written language processing in other languages and orthographic codes General question: Do all languages have similar cognitive processes and representations for reading and spelling?... Date Added: 2009-06-24 08:24:22 |
| Tub toys and Ocean Circulation.doc Path: Western Washington >> ENVR >> 325 Fall, 2009 Description: Tub toys and Ocean Circulation http:/en.wikipedia.org/wiki/Friendly_Floatees ... Date Added: 2009-06-24 08:24:24 |
| Ch8.pdf Path: National Taiwan University >> ECON >> 444 Fall, 2009 Description: Perfect versus Imperfect Multicollinearity The Consequences of Multicollinearity Remedies of Multicollinearity Chapter 8 Multicollinearity Masao Ogaki Department of Economics, Ohio State University November 17, 2007 Masao Ogaki Chapter 8 Multico... Date Added: 2009-06-24 08:26:50 |
| Design a machine inputs A and B with output Z that is 1 if.doc Path: FIU >> WEB >> 3712 Fall, 2009 Description: Design a machine inputs A and B with output Z that is 1 if: A had the same value at the two previous ticks B has been 1 since the last time the above was true ... Date Added: 2009-06-24 08:36:42 |
| McKee_ExecutiveSummary_2.pdf Path: Penn State >> BCM >> 159 Fall, 2009 Description: BRANDON C. McKEE CONSTRUCTION MANAGEMENT AMBRIDGE AREA HIGH SCHOOL AMBRIDGE, PENNSYLVANIA ADVISOR: DR. JOHN MESSNER TECHNICAL ASSIGNMENT 2 EXECUTIVE SUMMARY This technical report provides an introductory analysis to the execution of construction at ... Date Added: 2009-06-24 08:40:30 |
| 232_Exam1StudyGuide.pdf Path: University of Hawaii - Hilo >> MATH >> 232 Spring, 2008 Description: Exam 1 Study Guide Dr. Brian Wissman Math 232 Spring 2009 The first exam will cover sections 13.1-13.5 and 13.8. More specifically, to do well on the exam you should at least know how to: Evaluate a double integral over a rectangular region Describ... Date Added: 2009-06-24 08:44:04 |
| q4a_solution.pdf Path: Wilfrid Laurier >> CPSC >> 313 Fall, 2009 Description: CPSC 313 - Fall, 2003 Solutions for Selected Lab Exercises Question 4(a) on Lab Exercise #3 In this question you were asked to produce a deterministic finite automaton that is equivalent to (that is, that has the same language as) the NFA N1 , which ... Date Added: 2009-06-24 08:44:17 |
| 101.autumn05.notes.10.17.05.pdf Path: National Taiwan University >> SOC >> 101 Fall, 2009 Description: Definitions October 17 and 19, 2005 Sociology 101 Race and Ethnicity Social Construction of Race the process by which people come to define a group as a race based in part on physical characteristics, by also on historical, cultural, or economic fa... Date Added: 2009-06-24 08:47:38 |
| 101.autumn05.notes.10.26.05.pdf Path: National Taiwan University >> SOC >> 101 Fall, 2009 Description: Sexuality in Society Sociology 101 Definitions 10.26.05 Transexuals people who feel they are one sex even though biologically they are another Transgendered people who disregard conventional ideas about how females and males should look and behave ... Date Added: 2009-06-24 08:47:38 |
| frayer_template.doc Path: CSU Northridge >> VCEED >> 002 Fall, 2009 Description: Frayer chart TERM Definition Characteristics Examples Non-examples ... Date Added: 2009-06-24 08:49:23 |
| 3b9b0b15.pdf Path: Wisconsin >> WILL >> 0014 Fall, 2009 Description: ... Date Added: 2009-06-24 08:50:20 |
| 3b9b0bcd.pdf Path: Wisconsin >> WILL >> 0014 Fall, 2009 Description: ... Date Added: 2009-06-24 08:50:44 |
| 3b9b0c9c.pdf Path: Wisconsin >> WILL >> 0014 Fall, 2009 Description: ... Date Added: 2009-06-24 08:50:59 |
| 3b9b22a9.pdf Path: Wisconsin >> WILL >> 0031 Fall, 2009 Description: ... Date Added: 2009-06-24 08:52:03 |
| 4876e83c.pdf Path: Wisconsin >> WILL >> 0070 Fall, 2009 Description: ... Date Added: 2009-06-24 08:55:48 |
| 4876e879.pdf Path: Wisconsin >> WILL >> 0070 Fall, 2009 Description: ... Date Added: 2009-06-24 08:56:25 |
| 48770a2e.pdf Path: Wisconsin >> WILL >> 0078 Fall, 2009 Description: ... Date Added: 2009-06-24 08:57:40 |
| 487706af.pdf Path: Wisconsin >> WILL >> 0078 Fall, 2009 Description: ... Date Added: 2009-06-24 08:57:53 |
| 487733d2.pdf Path: Wisconsin >> WILL >> 0090 Fall, 2009 Description: ... Date Added: 2009-06-24 08:59:48 |
| 487773f0.pdf Path: Wisconsin >> WILL >> 0109 Fall, 2009 Description: ... Date Added: 2009-06-24 09:01:18 |
| 487774e3.pdf Path: Wisconsin >> WILL >> 0109 Fall, 2009 Description: ... Date Added: 2009-06-24 09:01:35 |
| 2a53.pdf Path: Wisconsin >> WILL >> 0062 Fall, 2009 Description: ... Date Added: 2009-06-24 09:02:01 |
| 28f5.pdf Path: Wisconsin >> WILL >> 0062 Fall, 2009 Description: ... Date Added: 2009-06-24 09:03:01 |
| 487723d0.pdf Path: Wisconsin >> WILL >> 0086 Fall, 2009 Description: ... Date Added: 2009-06-24 09:03:36 |
| 487724ce.pdf Path: Wisconsin >> WILL >> 0086 Fall, 2009 Description: ... Date Added: 2009-06-24 09:03:58 |
| 487725e2.pdf Path: Wisconsin >> WILL >> 0086 Fall, 2009 Description: ... Date Added: 2009-06-24 09:04:27 |
| 487725f6.pdf Path: Wisconsin >> WILL >> 0086 Fall, 2009 Description: ... Date Added: 2009-06-24 09:04:31 |
| solinclass10.pdf Path: Elmhurst >> CHEM >> 101 Fall, 2009 Description: Chemistry 101 Solutions to In-Class Assignment 10 (Due by Nov. 12th) Acids and Bases 1. Calculate the pH\'s of the following solutions and identify whether the solutions are acidic or basic: (a) [H3 O+ ] = 8.8 10-3 M pH = -log[H3 O+ ] = -log8.8 10-3... Date Added: 2009-06-24 09:04:41 |
| 4877244c.pdf Path: Wisconsin >> WILL >> 0086 Fall, 2009 Description: ... Date Added: 2009-06-24 09:05:06 |
| 487787cc.pdf Path: Wisconsin >> WILL >> 0115 Fall, 2009 Description: ... Date Added: 2009-06-24 09:06:12 |
| 487789b1.pdf Path: Wisconsin >> WILL >> 0115 Fall, 2009 Description: ... Date Added: 2009-06-24 09:06:49 |
| 3b9acd4d.pdf Path: Wisconsin >> WILL >> 0002 Fall, 2009 Description: ... Date Added: 2009-06-24 09:07:11 |
| 3b9acdff.pdf Path: Wisconsin >> WILL >> 0002 Fall, 2009 Description: ... Date Added: 2009-06-24 09:07:50 |
| 3b9ace5b.pdf Path: Wisconsin >> WILL >> 0002 Fall, 2009 Description: ... Date Added: 2009-06-24 09:07:58 |
| 3b9b3e9e.pdf Path: Wisconsin >> WILL >> 0039 Fall, 2009 Description: ... Date Added: 2009-06-24 09:08:56 |
| 3b9b3e63.pdf Path: Wisconsin >> WILL >> 0039 Fall, 2009 Description: ... Date Added: 2009-06-24 09:09:08 |
| 48776aa7.pdf Path: Wisconsin >> WILL >> 0106 Fall, 2009 Description: ... Date Added: 2009-06-24 09:12:14 |
| 48774e90.pdf Path: Wisconsin >> WILL >> 0098 Fall, 2009 Description: ... Date Added: 2009-06-24 09:12:36 |
| 48774f02.pdf Path: Wisconsin >> WILL >> 0098 Fall, 2009 Description: ... Date Added: 2009-06-24 09:12:58 |
| 3b9b469b.pdf Path: Wisconsin >> WILL >> 0041 Fall, 2009 Description: ... Date Added: 2009-06-24 09:14:47 |
| 3b9b33f4.pdf Path: Wisconsin >> WILL >> 0036 Fall, 2009 Description: ... Date Added: 2009-06-24 09:16:36 |
| 3b9b336c.pdf Path: Wisconsin >> WILL >> 0036 Fall, 2009 Description: ... Date Added: 2009-06-24 09:17:15 |
| 3b9b61ed.pdf Path: Wisconsin >> WILL >> 0049 Fall, 2009 Description: ... Date Added: 2009-06-24 09:18:08 |
| 3b9b62aa.pdf Path: Wisconsin >> WILL >> 0049 Fall, 2009 Description: ... Date Added: 2009-06-24 09:18:12 |
| 3b9b63e6.pdf Path: Wisconsin >> WILL >> 0049 Fall, 2009 Description: ... Date Added: 2009-06-24 09:18:36 |
| 3b9b64e5.pdf Path: Wisconsin >> WILL >> 0049 Fall, 2009 Description: ... Date Added: 2009-06-24 09:18:51 |
| 3b9afa1f.pdf Path: Wisconsin >> WILL >> 0009 Fall, 2009 Description: ... Date Added: 2009-06-24 09:20:07 |
| 3b9afb2d.pdf Path: Wisconsin >> WILL >> 0024 Fall, 2009 Description: ... Date Added: 2009-06-24 09:21:13 |
| 3b9afbf2.pdf Path: Wisconsin >> WILL >> 0024 Fall, 2009 Description: ... Date Added: 2009-06-24 09:21:28 |
| 3b9afc76.pdf Path: Wisconsin >> WILL >> 0024 Fall, 2009 Description: ... Date Added: 2009-06-24 09:21:39 |
| 3b9afd10.pdf Path: Wisconsin >> WILL >> 0024 Fall, 2009 Description: ... Date Added: 2009-06-24 09:21:50 |
| 3b9afe59.pdf Path: Wisconsin >> WILL >> 0024 Fall, 2009 Description: ... Date Added: 2009-06-24 09:22:04 |
| 4876eba2.pdf Path: Wisconsin >> WILL >> 0071 Fall, 2009 Description: ... Date Added: 2009-06-24 09:22:16 |
| 4876ece4.pdf Path: Wisconsin >> WILL >> 0071 Fall, 2009 Description: ... Date Added: 2009-06-24 09:23:13 |
| 3b9acb41.pdf Path: Wisconsin >> WILL >> 0001 Fall, 2009 Description: ... Date Added: 2009-06-24 09:24:34 |
| 48770baf.pdf Path: Wisconsin >> WILL >> 0079 Fall, 2009 Description: ... Date Added: 2009-06-24 09:26:08 |
| 48770bff.pdf Path: Wisconsin >> WILL >> 0079 Fall, 2009 Description: ... Date Added: 2009-06-24 09:26:22 |
| 487738ea.pdf Path: Wisconsin >> WILL >> 0091 Fall, 2009 Description: ... Date Added: 2009-06-24 09:27:25 |
| 487739f7.pdf Path: Wisconsin >> WILL >> 0091 Fall, 2009 Description: ... Date Added: 2009-06-24 09:27:44 |
| 315e.pdf Path: Wisconsin >> WILL >> 0065 Fall, 2009 Description: ... Date Added: 2009-06-24 09:29:12 |
| 487720bd.pdf Path: Wisconsin >> WILL >> 0085 Fall, 2009 Description: ... Date Added: 2009-06-24 09:29:40 |
| 4877225d.pdf Path: Wisconsin >> WILL >> 0085 Fall, 2009 Description: ... Date Added: 2009-06-24 09:30:52 |
| 487786db.pdf Path: Wisconsin >> WILL >> 0114 Fall, 2009 Description: ... Date Added: 2009-06-24 09:31:56 |
| 3b9b42c3.pdf Path: Wisconsin >> WILL >> 0040 Fall, 2009 Description: ... Date Added: 2009-06-24 09:33:16 |
| 3b9b43bf.pdf Path: Wisconsin >> WILL >> 0040 Fall, 2009 Description: ... Date Added: 2009-06-24 09:33:32 |
| 3b9b43d7.pdf Path: Wisconsin >> WILL >> 0040 Fall, 2009 Description: ... Date Added: 2009-06-24 09:33:36 |
| 3b9b426a.pdf Path: Wisconsin >> WILL >> 0040 Fall, 2009 Description: ... Date Added: 2009-06-24 09:34:01 |
| 4876ff7d.pdf Path: Wisconsin >> WILL >> 0076 Fall, 2009 Description: ... Date Added: 2009-06-24 09:34:27 |
| 487701e9.pdf Path: Wisconsin >> WILL >> 0076 Fall, 2009 Description: ... Date Added: 2009-06-24 09:35:30 |
| 4877003e.pdf Path: Wisconsin >> WILL >> 0076 Fall, 2009 Description: ... Date Added: 2009-06-24 09:35:38 |
| 4877012e.pdf Path: Wisconsin >> WILL >> 0076 Fall, 2009 Description: ... Date Added: 2009-06-24 09:35:48 |
| 48776d7c.pdf Path: Wisconsin >> WILL >> 0107 Fall, 2009 Description: ... Date Added: 2009-06-24 09:36:07 |
| 487753a6.pdf Path: Wisconsin >> WILL >> 0099 Fall, 2009 Description: ... Date Added: 2009-06-24 09:37:04 |
| 3b9ad8d5.pdf Path: Wisconsin >> WILL >> 0016 Fall, 2009 Description: ... Date Added: 2009-06-24 09:37:20 |
| 3b9adb98.pdf Path: Wisconsin >> WILL >> 0016 Fall, 2009 Description: ... Date Added: 2009-06-24 09:38:30 |
| 3b9adbe3.pdf Path: Wisconsin >> WILL >> 0016 Fall, 2009 Description: ... Date Added: 2009-06-24 09:38:35 |
| 3b9b37df.pdf Path: Wisconsin >> WILL >> 0037 Fall, 2009 Description: ... Date Added: 2009-06-24 09:39:15 |
| 3b9b38b1.pdf Path: Wisconsin >> WILL >> 0037 Fall, 2009 Description: ... Date Added: 2009-06-24 09:39:24 |
| 11e8.pdf Path: Wisconsin >> WILL >> 0056 Fall, 2009 Description: ... Date Added: 2009-06-24 09:40:30 |
| 12a7.pdf Path: Wisconsin >> WILL >> 0056 Fall, 2009 Description: ... Date Added: 2009-06-24 09:40:37 |
| 3b9af3a1.pdf Path: Wisconsin >> WILL >> 0008 Fall, 2009 Description: ... Date Added: 2009-06-24 09:42:04 |
| 3b9b10e9.pdf Path: Wisconsin >> WILL >> 0027 Fall, 2009 Description: ... Date Added: 2009-06-24 09:43:17 |
| 3b9b11b7.pdf Path: Wisconsin >> WILL >> 0027 Fall, 2009 Description: ... Date Added: 2009-06-24 09:43:26 |
| 3b9b11b9.pdf Path: Wisconsin >> WILL >> 0027 Fall, 2009 Description: ... Date Added: 2009-06-24 09:43:26 |
| 48771b2a.pdf Path: Wisconsin >> WILL >> 0084 Fall, 2009 Description: ... Date Added: 2009-06-24 09:44:25 |
| 48771d65.pdf Path: Wisconsin >> WILL >> 0084 Fall, 2009 Description: ... Date Added: 2009-06-24 09:44:52 |
| 48771de6.pdf Path: Wisconsin >> WILL >> 0084 Fall, 2009 Description: ... Date Added: 2009-06-24 09:45:11 |
| 3b9b5e5c.pdf Path: Wisconsin >> WILL >> 0048 Fall, 2009 Description: ... Date Added: 2009-06-24 09:47:17 |
| 2d73.pdf Path: Wisconsin >> WILL >> 0064 Fall, 2009 Description: ... Date Added: 2009-06-24 09:48:25 |
| 2e67.pdf Path: Wisconsin >> WILL >> 0064 Fall, 2009 Description: ... Date Added: 2009-06-24 09:49:15 |
| 48773a58.pdf Path: Wisconsin >> WILL >> 0092 Fall, 2009 Description: ... Date Added: 2009-06-24 09:50:20 |
| 48773b75.pdf Path: Wisconsin >> WILL >> 0092 Fall, 2009 Description: ... Date Added: 2009-06-24 09:51:09 |
| 3b9b5acf.pdf Path: Wisconsin >> WILL >> 0047 Fall, 2009 Description: ... Date Added: 2009-06-24 09:51:56 |
| 3b9b5b0c.pdf Path: Wisconsin >> WILL >> 0047 Fall, 2009 Description: ... Date Added: 2009-06-24 09:52:02 |
| 3b9b5bff.pdf Path: Wisconsin >> WILL >> 0047 Fall, 2009 Description: ... Date Added: 2009-06-24 09:52:42 |
| 3b9b5c5a.pdf Path: Wisconsin >> WILL >> 0047 Fall, 2009 Description: ... Date Added: 2009-06-24 09:52:48 |
| 48779a1e.pdf Path: Wisconsin >> WILL >> 0120 Fall, 2009 Description: ... Date Added: 2009-06-24 09:52:59 |
| 48779add.pdf Path: Wisconsin >> WILL >> 0120 Fall, 2009 Description: ... Date Added: 2009-06-24 09:53:37 |
| 48779b3e.pdf Path: Wisconsin >> WILL >> 0120 Fall, 2009 Description: ... Date Added: 2009-06-24 09:53:50 |
| 487702a1.pdf Path: Wisconsin >> WILL >> 0077 Fall, 2009 Description: ... Date Added: 2009-06-24 09:54:26 |
| 4877035a.pdf Path: Wisconsin >> WILL >> 0077 Fall, 2009 Description: ... Date Added: 2009-06-24 09:55:43 |
| 487762df.pdf Path: Wisconsin >> WILL >> 0104 Fall, 2009 Description: ... Date Added: 2009-06-24 09:56:12 |
| 487763b4.pdf Path: Wisconsin >> WILL >> 0104 Fall, 2009 Description: ... Date Added: 2009-06-24 09:56:22 |
| 3b9af0cb.pdf Path: Wisconsin >> WILL >> 0007 Fall, 2009 Description: ... Date Added: 2009-06-24 09:57:43 |
| 3b9b0e7e.pdf Path: Wisconsin >> WILL >> 0026 Fall, 2009 Description: ... Date Added: 2009-06-24 09:59:05 |
| 16a3.pdf Path: Wisconsin >> WILL >> 0057 Fall, 2009 Description: ... Date Added: 2009-06-24 10:00:23 |
| 48777cd1.pdf Path: Wisconsin >> WILL >> 0111 Fall, 2009 Description: ... Date Added: 2009-06-24 10:03:05 |
| 37a9.pdf Path: Wisconsin >> WILL >> 0067 Fall, 2009 Description: ... Date Added: 2009-06-24 10:03:24 |
| 48771a7d.pdf Path: Wisconsin >> WILL >> 0083 Fall, 2009 Description: ... Date Added: 2009-06-24 10:04:57 |
| 48771a16.pdf Path: Wisconsin >> WILL >> 0083 Fall, 2009 Description: ... Date Added: 2009-06-24 10:05:02 |
| 48771bec.pdf Path: Wisconsin >> WILL >> 0083 Fall, 2009 Description: ... Date Added: 2009-06-24 10:06:18 |
| 3b9adf38.pdf Path: Wisconsin >> WILL >> 0017 Fall, 2009 Description: ... Date Added: 2009-06-24 10:07:26 |
| 3b9ae0c4.pdf Path: Wisconsin >> WILL >> 0017 Fall, 2009 Description: ... Date Added: 2009-06-24 10:08:00 |
| 3b9b2c37.pdf Path: Wisconsin >> WILL >> 0034 Fall, 2009 Description: ... Date Added: 2009-06-24 10:08:35 |
| 3b9b2c55.pdf Path: Wisconsin >> WILL >> 0034 Fall, 2009 Description: ... Date Added: 2009-06-24 10:08:38 |
| 3b9b2cb0.pdf Path: Wisconsin >> WILL >> 0034 Fall, 2009 Description: ... Date Added: 2009-06-24 10:08:49 |
| 3b9b2d87.pdf Path: Wisconsin >> WILL >> 0034 Fall, 2009 Description: ... Date Added: 2009-06-24 10:09:29 |
| 3b9b2db4.pdf Path: Wisconsin >> WILL >> 0034 Fall, 2009 Description: ... Date Added: 2009-06-24 10:09:35 |
| 48773e5e.pdf Path: Wisconsin >> WILL >> 0093 Fall, 2009 Description: ... Date Added: 2009-06-24 10:10:26 |
| 48773e33.pdf Path: Wisconsin >> WILL >> 0093 Fall, 2009 Description: ... Date Added: 2009-06-24 10:10:35 |
| 48773ed5.pdf Path: Wisconsin >> WILL >> 0093 Fall, 2009 Description: ... Date Added: 2009-06-24 10:10:58 |
| 3b9ae1c0.pdf Path: Wisconsin >> WILL >> 0018 Fall, 2009 Description: ... Date Added: 2009-06-24 10:12:13 |
| 3b9ae2ab.pdf Path: Wisconsin >> WILL >> 0018 Fall, 2009 Description: ... Date Added: 2009-06-24 10:12:26 |
| 3b9ae3b2.pdf Path: Wisconsin >> WILL >> 0018 Fall, 2009 Description: ... Date Added: 2009-06-24 10:12:47 |
| 3b9b66d0.pdf Path: Wisconsin >> WILL >> 0050 Fall, 2009 Description: ... Date Added: 2009-06-24 10:15:50 |
| 3b9b68df.pdf Path: Wisconsin >> WILL >> 0050 Fall, 2009 Description: ... Date Added: 2009-06-24 10:16:28 |
| 4877a0b3.pdf Path: Wisconsin >> WILL >> 0121 Fall, 2009 Description: ... Date Added: 2009-06-24 10:17:07 |
| merggame.pdf Path: MO St. Louis >> DOCS >> 252 Fall, 2009 Description: IV Highway Merge Lanes During Rush Hour-A Prisoner\'s Dilemma Model This is a drastic oversimplification, but let us pretend we can project the results of interacting strategies by representing populations on the highway as two people in a prisoner\'s... Date Added: 2009-06-24 10:18:25 |
| lernapc.pdf Path: MO St. Louis >> DOCS >> 252 Fall, 2009 Description: IV APC company has been using the same process to manufacture a protein solution since 1946. The process takes 72 hours in stable production. The Engineers developed an \"improved\" technique projected to reduce process time to 54 hr. Implementation in... Date Added: 2009-06-24 10:18:25 |
| 48779e11.pdf Path: Wisconsin >> WILL >> 0121 Fall, 2009 Description: ... Date Added: 2009-06-24 10:18:45 |
| 4876f7cf.pdf Path: Wisconsin >> WILL >> 0074 Fall, 2009 Description: ... Date Added: 2009-06-24 10:18:58 |
| 4876f72b.pdf Path: Wisconsin >> WILL >> 0074 Fall, 2009 Description: ... Date Added: 2009-06-24 10:19:47 |
| 1b2b.pdf Path: Wisconsin >> WILL >> 0058 Fall, 2009 Description: ... Date Added: 2009-06-24 10:21:18 |
| 3b9ade5d.pdf Path: Wisconsin >> WILL >> 0006 Fall, 2009 Description: ... Date Added: 2009-06-24 10:22:07 |
| 3b9ae9e5.pdf Path: Wisconsin >> WILL >> 0006 Fall, 2009 Description: ... Date Added: 2009-06-24 10:22:28 |
| 3b9ae997.pdf Path: Wisconsin >> WILL >> 0006 Fall, 2009 Description: ... Date Added: 2009-06-24 10:22:49 |
| 3b9aee3f.pdf Path: Wisconsin >> WILL >> 0021 Fall, 2009 Description: ... Date Added: 2009-06-24 10:24:07 |
| 355b.pdf Path: Wisconsin >> WILL >> 0066 Fall, 2009 Description: ... Date Added: 2009-06-24 10:26:32 |
| 487716bb.pdf Path: Wisconsin >> WILL >> 0082 Fall, 2009 Description: ... Date Added: 2009-06-24 10:26:40 |
| 487716c4.pdf Path: Wisconsin >> WILL >> 0082 Fall, 2009 Description: ... Date Added: 2009-06-24 10:26:42 |
| 487740dd.pdf Path: Wisconsin >> WILL >> 0094 Fall, 2009 Description: ... Date Added: 2009-06-24 10:28:21 |
| 487740f2.pdf Path: Wisconsin >> WILL >> 0094 Fall, 2009 Description: ... Date Added: 2009-06-24 10:28:25 |
| 487743e5.pdf Path: Wisconsin >> WILL >> 0094 Fall, 2009 Description: ... Date Added: 2009-06-24 10:29:15 |
| 3b9afc03.pdf Path: Wisconsin >> WILL >> 0010 Fall, 2009 Description: ... Date Added: 2009-06-24 10:30:08 |
| 3b9afcb7.pdf Path: Wisconsin >> WILL >> 0010 Fall, 2009 Description: ... Date Added: 2009-06-24 10:30:25 |
| 3b9afcd5.pdf Path: Wisconsin >> WILL >> 0010 Fall, 2009 Description: ... Date Added: 2009-06-24 10:30:31 |
| 3b9b31e6.pdf Path: Wisconsin >> WILL >> 0035 Fall, 2009 Description: ... Date Added: 2009-06-24 10:32:15 |
| 3b9b32bc.pdf Path: Wisconsin >> WILL >> 0035 Fall, 2009 Description: ... Date Added: 2009-06-24 10:32:23 |
| 4876fb00.pdf Path: Wisconsin >> WILL >> 0075 Fall, 2009 Description: ... Date Added: 2009-06-24 10:34:25 |
| 4876fc50.pdf Path: Wisconsin >> WILL >> 0075 Fall, 2009 Description: ... Date Added: 2009-06-24 10:35:42 |
| 3b9ae6f1.pdf Path: Wisconsin >> WILL >> 0019 Fall, 2009 Description: ... Date Added: 2009-06-24 10:38:15 |
| 3b9ae77d.pdf Path: Wisconsin >> WILL >> 0019 Fall, 2009 Description: ... Date Added: 2009-06-24 10:38:51 |
| 3e1e.pdf Path: Wisconsin >> WILL >> 0069 Fall, 2009 Description: ... Date Added: 2009-06-24 10:39:29 |
| 3b9b6b68.pdf Path: Wisconsin >> WILL >> 0051 Fall, 2009 Description: ... Date Added: 2009-06-24 10:42:10 |
| 3b9b6b80.pdf Path: Wisconsin >> WILL >> 0051 Fall, 2009 Description: ... Date Added: 2009-06-24 10:42:12 |
| 3b9b6c12.pdf Path: Wisconsin >> WILL >> 0051 Fall, 2009 Description: ... Date Added: 2009-06-24 10:42:33 |
| 3b9b6c16.pdf Path: Wisconsin >> WILL >> 0051 Fall, 2009 Description: ... Date Added: 2009-06-24 10:42:33 |
| 23b5.pdf Path: Wisconsin >> WILL >> 0061 Fall, 2009 Description: ... Date Added: 2009-06-24 10:42:40 |
| 23d0.pdf Path: Wisconsin >> WILL >> 0061 Fall, 2009 Description: ... Date Added: 2009-06-24 10:42:45 |
| 25b1.pdf Path: Wisconsin >> WILL >> 0061 Fall, 2009 Description: ... Date Added: 2009-06-24 10:43:17 |
| 3b9add49.pdf Path: Wisconsin >> WILL >> 0005 Fall, 2009 Description: ... Date Added: 2009-06-24 10:47:16 |
| 3b9ae7cc.pdf Path: Wisconsin >> WILL >> 0020 Fall, 2009 Description: ... Date Added: 2009-06-24 10:47:33 |
| 3b9ae894.pdf Path: Wisconsin >> WILL >> 0020 Fall, 2009 Description: ... Date Added: 2009-06-24 10:48:44 |
| Web_Requirements_Outline.doc Path: Cal Poly Pomona >> CIS >> 311 Fall, 2009 Description: Requirements Outline for [Project Name] Student Name Version 1.0 [Date] Version History Version 1.0 Date 1/16/06 Changes Made Initial Release, Posted to Your Web Site 1.0 Project Overview Overview of the purpose and scope of the Project. 1.1 Busine... Date Added: 2009-06-24 10:48:45 |
| 3b9b27b6.pdf Path: Wisconsin >> WILL >> 0032 Fall, 2009 Description: ... Date Added: 2009-06-24 10:49:40 |
| 3b9b263e.pdf Path: Wisconsin >> WILL >> 0032 Fall, 2009 Description: ... Date Added: 2009-06-24 10:50:09 |
| 3b9b52d0.pdf Path: Wisconsin >> WILL >> 0045 Fall, 2009 Description: ... Date Added: 2009-06-24 10:50:49 |
| 3b9b540d.pdf Path: Wisconsin >> WILL >> 0045 Fall, 2009 Description: ... Date Added: 2009-06-24 10:51:52 |
| 3b9b550a.pdf Path: Wisconsin >> WILL >> 0045 Fall, 2009 Description: ... Date Added: 2009-06-24 10:52:03 |
| 487796c8.pdf Path: Wisconsin >> WILL >> 0119 Fall, 2009 Description: ... Date Added: 2009-06-24 10:52:27 |
| 487796f7.pdf Path: Wisconsin >> WILL >> 0119 Fall, 2009 Description: ... Date Added: 2009-06-24 10:52:35 |
| 487744d8.pdf Path: Wisconsin >> WILL >> 0095 Fall, 2009 Description: ... Date Added: 2009-06-24 10:53:09 |
| 487747c1.pdf Path: Wisconsin >> WILL >> 0095 Fall, 2009 Description: ... Date Added: 2009-06-24 10:53:59 |
| 487792fb.pdf Path: Wisconsin >> WILL >> 0118 Fall, 2009 Description: ... Date Added: 2009-06-24 10:56:10 |
| 4877134b.pdf Path: Wisconsin >> WILL >> 0081 Fall, 2009 Description: ... Date Added: 2009-06-24 10:58:13 |
| 3b9b14b6.pdf Path: Wisconsin >> WILL >> 0028 Fall, 2009 Description: ... Date Added: 2009-06-24 10:58:31 |
| 3b9b15ad.pdf Path: Wisconsin >> WILL >> 0028 Fall, 2009 Description: ... Date Added: 2009-06-24 10:58:43 |
| 48772fc3.pdf Path: Wisconsin >> WILL >> 0089 Fall, 2009 Description: ... Date Added: 2009-06-24 11:00:45 |
| 48772fc9.pdf Path: Wisconsin >> WILL >> 0089 Fall, 2009 Description: ... Date Added: 2009-06-24 11:00:47 |
| 487730c0.pdf Path: Wisconsin >> WILL >> 0089 Fall, 2009 Description: ... Date Added: 2009-06-24 11:01:03 |
| 487730d1.pdf Path: Wisconsin >> WILL >> 0089 Fall, 2009 Description: ... Date Added: 2009-06-24 11:01:06 |
| 4876f0b1.pdf Path: Wisconsin >> WILL >> 0072 Fall, 2009 Description: ... Date Added: 2009-06-24 11:02:12 |
| 4876f097.pdf Path: Wisconsin >> WILL >> 0072 Fall, 2009 Description: ... Date Added: 2009-06-24 11:02:57 |
| 48775e9b_x1a.pdf Path: Wisconsin >> WILL >> 0103 Fall, 2009 Description: ... Date Added: 2009-06-24 11:03:09 |
| 48775ea9.pdf Path: Wisconsin >> WILL >> 0103 Fall, 2009 Description: ... Date Added: 2009-06-24 11:03:23 |
| 48775eaa_x1a.pdf Path: Wisconsin >> WILL >> 0103 Fall, 2009 Description: ... Date Added: 2009-06-24 11:03:23 |
| 48775ed8_x1a.pdf Path: Wisconsin >> WILL >> 0103 Fall, 2009 Description: ... Date Added: 2009-06-24 11:03:42 |
| 48775f3e_x1a.pdf Path: Wisconsin >> WILL >> 0103 Fall, 2009 Description: ... Date Added: 2009-06-24 11:04:10 |
| 3a75.pdf Path: Wisconsin >> WILL >> 0068 Fall, 2009 Description: ... Date Added: 2009-06-24 11:04:30 |
| 3a77.pdf Path: Wisconsin >> WILL >> 0068 Fall, 2009 Description: ... Date Added: 2009-06-24 11:04:30 |
| 3a89.pdf Path: Wisconsin >> WILL >> 0068 Fall, 2009 Description: ... Date Added: 2009-06-24 11:04:32 |
| 3b12.pdf Path: Wisconsin >> WILL >> 0068 Fall, 2009 Description: ... Date Added: 2009-06-24 11:05:06 |
| 1b.pdf Path: Wisconsin >> WILL >> 0052 Fall, 2009 Description: ... Date Added: 2009-06-24 11:05:56 |
| 5c.pdf Path: Wisconsin >> WILL >> 0052 Fall, 2009 Description: ... Date Added: 2009-06-24 11:07:02 |
| 1f8e.pdf Path: Wisconsin >> WILL >> 0060 Fall, 2009 Description: ... Date Added: 2009-06-24 11:07:38 |
| 22c6.pdf Path: Wisconsin >> WILL >> 0060 Fall, 2009 Description: ... Date Added: 2009-06-24 11:09:06 |
| 22fb.pdf Path: Wisconsin >> WILL >> 0060 Fall, 2009 Description: ... Date Added: 2009-06-24 11:09:17 |
| 487781de.pdf Path: Wisconsin >> WILL >> 0113 Fall, 2009 Description: ... Date Added: 2009-06-24 11:09:42 |
| 3b9b2b87.pdf Path: Wisconsin >> WILL >> 0033 Fall, 2009 Description: ... Date Added: 2009-06-24 11:13:05 |
| 3b9b28dc.pdf Path: Wisconsin >> WILL >> 0033 Fall, 2009 Description: ... Date Added: 2009-06-24 11:13:28 |
| 3b9b4fae.pdf Path: Wisconsin >> WILL >> 0044 Fall, 2009 Description: ... Date Added: 2009-06-24 11:14:01 |
| 3b9b50c8.pdf Path: Wisconsin >> WILL >> 0044 Fall, 2009 Description: ... Date Added: 2009-06-24 11:14:26 |
| 3b9b508a.pdf Path: Wisconsin >> WILL >> 0044 Fall, 2009 Description: ... Date Added: 2009-06-24 11:15:01 |
| 3b9b03fc.pdf Path: Wisconsin >> WILL >> 0012 Fall, 2009 Description: ... Date Added: 2009-06-24 11:16:08 |
| 3b9b0574.pdf Path: Wisconsin >> WILL >> 0012 Fall, 2009 Description: ... Date Added: 2009-06-24 11:16:38 |
| 3b9ad5dc.pdf Path: Wisconsin >> WILL >> 0004 Fall, 2009 Description: ... Date Added: 2009-06-24 11:18:24 |
| 3b9ad7be.pdf Path: Wisconsin >> WILL >> 0004 Fall, 2009 Description: ... Date Added: 2009-06-24 11:18:49 |
| 3b9ad8f3.pdf Path: Wisconsin >> WILL >> 0004 Fall, 2009 Description: ... Date Added: 2009-06-24 11:19:06 |
| 3b9af7dd.pdf Path: Wisconsin >> WILL >> 0023 Fall, 2009 Description: ... Date Added: 2009-06-24 11:20:13 |
| 3b9af68f.pdf Path: Wisconsin >> WILL >> 0023 Fall, 2009 Description: ... Date Added: 2009-06-24 11:20:42 |
| 48774b17.pdf Path: Wisconsin >> WILL >> 0096 Fall, 2009 Description: ... Date Added: 2009-06-24 11:22:26 |
| 48774b15.pdf Path: Wisconsin >> WILL >> 0096 Fall, 2009 Description: ... Date Added: 2009-06-24 11:22:26 |
| 4877483c.pdf Path: Wisconsin >> WILL >> 0096 Fall, 2009 Description: ... Date Added: 2009-06-24 11:22:59 |
| 48770a47.pdf Path: Wisconsin >> WILL >> 0080 Fall, 2009 Description: ... Date Added: 2009-06-24 11:23:09 |
| 48770eb5.pdf Path: Wisconsin >> WILL >> 0080 Fall, 2009 Description: ... Date Added: 2009-06-24 11:23:16 |
| 48770eb1.pdf Path: Wisconsin >> WILL >> 0080 Fall, 2009 Description: ... Date Added: 2009-06-24 11:23:16 |
| 48770f6f.pdf Path: Wisconsin >> WILL >> 0080 Fall, 2009 Description: ... Date Added: 2009-06-24 11:23:43 |
| 6aa.pdf Path: Wisconsin >> WILL >> 0053 Fall, 2009 Description: ... Date Added: 2009-06-24 11:25:14 |
| 8b4.pdf Path: Wisconsin >> WILL >> 0053 Fall, 2009 Description: ... Date Added: 2009-06-24 11:25:59 |
| 48772be7.pdf Path: Wisconsin >> WILL >> 0088 Fall, 2009 Description: ... Date Added: 2009-06-24 11:27:22 |
| 4876f3a0.pdf Path: Wisconsin >> WILL >> 0073 Fall, 2009 Description: ... Date Added: 2009-06-24 11:28:10 |
| 4876f40b.pdf Path: Wisconsin >> WILL >> 0073 Fall, 2009 Description: ... Date Added: 2009-06-24 11:29:36 |
| 4876f44e.pdf Path: Wisconsin >> WILL >> 0073 Fall, 2009 Description: ... Date Added: 2009-06-24 11:29:41 |
| 3b9b4c7c.pdf Path: Wisconsin >> WILL >> 0043 Fall, 2009 Description: ... Date Added: 2009-06-24 11:30:46 |
| 3b9b4c9c.pdf Path: Wisconsin >> WILL >> 0043 Fall, 2009 Description: ... Date Added: 2009-06-24 11:30:48 |
| 3b9b4cbf.pdf Path: Wisconsin >> WILL >> 0043 Fall, 2009 Description: ... Date Added: 2009-06-24 11:31:12 |
| 2aed.pdf Path: Wisconsin >> WILL >> 0063 Fall, 2009 Description: ... Date Added: 2009-06-24 11:32:06 |
| 2b24.pdf Path: Wisconsin >> WILL >> 0063 Fall, 2009 Description: ... Date Added: 2009-06-24 11:32:25 |
| 2c1d.pdf Path: Wisconsin >> WILL >> 0063 Fall, 2009 Description: ... Date Added: 2009-06-24 11:33:00 |
| 487755f9.pdf Path: Wisconsin >> WILL >> 0100 Fall, 2009 Description: ... Date Added: 2009-06-24 11:33:26 |
| 3b9b1da8.pdf Path: Wisconsin >> WILL >> 0030 Fall, 2009 Description: ... Date Added: 2009-06-24 11:34:15 |
| 3b9b1e27.pdf Path: Wisconsin >> WILL >> 0030 Fall, 2009 Description: ... Date Added: 2009-06-24 11:34:32 |
| 3b9b1e93.pdf Path: Wisconsin >> WILL >> 0030 Fall, 2009 Description: ... Date Added: 2009-06-24 11:34:41 |
| 3b9b1eb1.pdf Path: Wisconsin >> WILL >> 0030 Fall, 2009 Description: ... Date Added: 2009-06-24 11:34:45 |
| 3b9b1f3c.pdf Path: Wisconsin >> WILL >> 0030 Fall, 2009 Description: ... Date Added: 2009-06-24 11:34:58 |
| 48774b82.pdf Path: Wisconsin >> WILL >> 0097 Fall, 2009 Description: ... Date Added: 2009-06-24 11:35:49 |
| 48774d1e.pdf Path: Wisconsin >> WILL >> 0097 Fall, 2009 Description: ... Date Added: 2009-06-24 11:37:09 |
| 487770a8.pdf Path: Wisconsin >> WILL >> 0108 Fall, 2009 Description: ... Date Added: 2009-06-24 11:37:33 |
| 3b9b084e.pdf Path: Wisconsin >> WILL >> 0013 Fall, 2009 Description: ... Date Added: 2009-06-24 11:39:17 |
| 48772a40.pdf Path: Wisconsin >> WILL >> 0087 Fall, 2009 Description: ... Date Added: 2009-06-24 11:41:29 |
| 48772a96.pdf Path: Wisconsin >> WILL >> 0087 Fall, 2009 Description: ... Date Added: 2009-06-24 11:41:44 |
| 48772abd.pdf Path: Wisconsin >> WILL >> 0087 Fall, 2009 Description: ... Date Added: 2009-06-24 11:41:53 |
| 487727c6.pdf Path: Wisconsin >> WILL >> 0087 Fall, 2009 Description: ... Date Added: 2009-06-24 11:42:05 |
| 48777e46.pdf Path: Wisconsin >> WILL >> 0112 Fall, 2009 Description: ... Date Added: 2009-06-24 11:43:23 |
| 3b9ad46a.pdf Path: Wisconsin >> WILL >> 0003 Fall, 2009 Description: ... Date Added: 2009-06-24 11:46:11 |
| 3b9af5d3.pdf Path: Wisconsin >> WILL >> 0022 Fall, 2009 Description: ... Date Added: 2009-06-24 11:47:03 |
| 9b1.pdf Path: Wisconsin >> WILL >> 0054 Fall, 2009 Description: ... Date Added: 2009-06-24 11:48:06 |
| a66.pdf Path: Wisconsin >> WILL >> 0054 Fall, 2009 Description: ... Date Added: 2009-06-24 11:49:00 |
| 3b9b4ad4.pdf Path: Wisconsin >> WILL >> 0042 Fall, 2009 Description: ... Date Added: 2009-06-24 11:50:00 |
| 3b9b4b2b.pdf Path: Wisconsin >> WILL >> 0042 Fall, 2009 Description: ... Date Added: 2009-06-24 11:50:26 |
| T0431.t06.near-backbone-11-logo.pdf Path: UCSC >> T >> 0431 Fall, 2009 Description: T0431.t06 near-backbone-11 4 3 2 1 MAKKTSSRRRQTGEPPLENGLIPYLGCALQFGANPLEFLRANQRKHGHVFTCKLMGKYVHFITNPLSYHKVLCHGKYFDWKKFHFATSAKAFGHRSIDPM 1 10 20 30 40 50 60 70 80 90 GIG 4 3 2 1 DAG A IDIA GIGKJHIKG JGADIG GKF G GADKHDKGIKGDGIJ KJG AGKEDKG DA DIDG... Date Added: 2009-06-24 11:51:33 |
| YHL013C.t2k.alpha-logo.pdf Path: UCSC >> YHL >> 013 Fall, 2009 Description: YHL013C.t2k ALPHA 3 2 1 XXX E B E H H H H X X X X X H H XXXXI H I I I HH 1 10 20 30 40 EBEH 3 2 1 BHGS BH HHHHHHHHHHHHHHHHH I I I I I I I X X X X X X X X S H S S E B H S I H H I I I H I I I I I X X X X X X X X XXHHXXXX X X XXX X X ... Date Added: 2009-06-24 11:52:30 |
| lab6.pdf Path: SUNY Stony Brook >> PHY >> 300 Fall, 2008 Description: PHYSICS 300 SPRING 2006 LAB # 6 Michelson Interferometer Introduction The Michelson interferometer has great historical significance, for it is the instrument that Michelson and Morely used to try and measure the Doppler shift of light travelling... Date Added: 2009-06-24 11:52:45 |
| lect6-flow_4up.ps Path: Allan Hancock College >> CS >> 1021 Fall, 2009 Description: %!PS-Adobe-2.0 %Creator: dvips(k) 5.92b Copyright 2002 Radical Eye Software %Title: lect6-flow.dvi %Pages: 5 0 %PageOrder: Ascend %Orientation: Landscape %BoundingBox: 0 0 596 842 %DocumentFonts: Helvetica-Bold Times-Roman CMSY5 CMTT12 CMTT10 CMITT10... Date Added: 2009-06-24 11:54:01 |
| 112_Moll_I.pdf Path: UCSB >> EEMB >> 112 Fall, 2008 Description: Phylum Mollusca Adaptive Zone: Marine, freshwater Epibenthic, burrowing, pelagic Terrestrial Predators, filter feeders, grazers, some parasitic ~ 100,000 described species Body size: 0.5mm - 20m! Diverse body plans, vision, complex behavior, intellig... Date Added: 2009-06-24 11:54:31 |
| answer_key.pdf Path: Sinclair CC >> DEV >> 085 Fall, 2009 Description: Practice Test Unit 1 Answer Key: 1) 2) 3) 4) 5) 6) 7) 8) 9) 64,676 1,078 1,206 25 51 9,000 700-900 12) $267 13) 39 14) -30 15) 3 16) 63 17) -136 18) -78 19) 18 20) -$11 21) 10 22) Lost 42 lbs or -42 lbs 23) -2,154 ft 24) 1,125 25) 54 72 26) -54 27... Date Added: 2009-06-24 11:55:01 |
| pressure.pdf Path: Sinclair CC >> PHY >> 208 Fall, 2009 Description: Varying Pressure with Depth Materials: Universal Laboratory Interface Logger Pro Software Electronic Barometer Resonance Tube U-tube manometer, bulb syringe and T-connector (for calibration if needed) Flexible tubing Rubber Stoppers/glass tubing Rubb... Date Added: 2009-06-24 11:55:20 |
| Dell.doc Path: Uni. Westminster >> AAJ >> 1209 Fall, 2009 Description: Andrew Johnson Finance 307 Dell Inc. Industry: Personal Computers Sector: Technology Recommendation: Buy Dell, Inc. and its subsidiaries engage in the design, development, manufacture, marketing, sale, and support of a range of computer systems and s... Date Added: 2009-06-24 11:55:31 |
| ch21.pdf Path: Oregon State >> PH >> 203 Spring, 2008 Description: ... Date Added: 2009-06-24 11:56:25 |
| Inclass13.pdf Path: Kentucky >> PHY >> 228 Fall, 2008 Description: Consider a charged pion - at rest that decays to a muon plus antineutrino ( - + ). The mass of the pion is 273*mE, the mass of muon is 207mE and treat the mass of the anti-neutrino as < mE. 1) What is the Kinetic energy of the muon? 2) What is the e... Date Added: 2009-06-24 11:56:51 |
| Review2.pdf Path: CC Philadelphia >> FACULTY >> 102 Fall, 2009 Description: Finite Mathematics 1. For the numbers 360 and 1035 find a. Prime factorizations. Using these prime factorizations find next b. The greatest common factor. c. The least common multiple. Review 2 Solution. a. 360 = 2 180 = 2 2 90 = 2 2 2 45 = 2 ... Date Added: 2009-06-24 11:56:51 |
| hovercraft.pdf Path: Allan Hancock College >> Q >> 1122442 Fall, 2009 Description: My Prediction Engineers Notebook What happened Engineers Wanted! ... Date Added: 2009-06-24 11:57:05 |
| YMR176W.t2k.stride-ebghtl-logo.pdf Path: UCSC >> YMR >> 176 Fall, 2009 Description: TTTTTC CCCT CCC TTTCCCCCGGGCTT X X TTT G C C E T XXXXXXXXHHHXXXXXEEEXTTEXCCCGTHCX X CTTTCCEEECTGTHHH T CT CCCT HHT CC T T X C X X X X X X X X X X X X CH T T 3 2 1 G E G H H E EEECTTGTCCCC G CCCTC T E X GT G TCCEEEC C C GCXXXTTTXXX... Date Added: 2009-06-24 11:57:37 |
| YMR110C.t2k.CB_burial_14_7-logo.pdf Path: UCSC >> YMR >> 110 Fall, 2009 Description: YMR110C.t2k CB_BURIAL_14_7 3 2 1 AAAA X 10 20 30 40 A 3 2 1 B D B D A D A B D E E B E B A E B E D B B D A B D B A B A E D C B C E E D C BCEDDDDDB F A D E C C DDGECEFDEDDDDECCEECXEX A G X X X X X X X X 51 60 70 80 90 F 3 2 1 ... Date Added: 2009-06-24 11:58:23 |
| YMR151W.t2k.w0.5-logo.pdf Path: UCSC >> YMR >> 151 Fall, 2009 Description: YMR151W.t2k w0.5 2 1 M L V I I I I CLL PFLF LLY I II IFL I YLDC L L V G VP VLPGLV C G G FFP E XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX F L Y W W F L Y V V A M I L I S I T L V L H V L I V A L V I A V L H I V V V L Y I I I V V ... Date Added: 2009-06-24 11:59:07 |
| magic.ps Path: USC >> EE >> 577 Fall, 2009 Description: %!PS-Adobe-3.0 %BoundingBox: (atend) %Pages: (atend) %PageOrder: (atend) %DocumentFonts: (atend) %DocumentNeedsFonts: (atend) %DocumentSuppliedFonts: (atend) %Creator: Frame 5.5 %DocumentData: Clean7Bit %EndComments %BeginProlog % % Frame ps_prolog 5... Date Added: 2009-06-24 12:06:19 |
| 01Overview.pdf Path: St. Xavier >> MATH >> 316 Spring, 2009 Description: An Overview 1 Basic terminology cryptology science of executing secure communications across non-secure channels steganography secures communication by concealing messages, rather than altering them cryptography the design of algorithms for secure ... Date Added: 2009-06-24 12:06:57 |
| quiz2akey.pdf Path: Elmhurst >> MATH >> 325 Fall, 2009 Description: Math 325 Quiz 2-A Name KEY 1. Suppose that there were 56 jelly beans in a bowl. Peter, Jerry and Pam ate all of them. Peter had four times as many jelly beans as Jerry did and had 2 fewer jelly beans than Pam. How many jelly beans did Peter eat? M... Date Added: 2009-06-24 12:07:21 |
| Media_and_Minorities.ppt Path: Kentucky >> JAT >> 520 Fall, 2009 Description: Media in intergroup relations Implications for society Categorization Though rarely discussed, the first and necessary step in the development of group evaluations (including prejudice) is the definition/social construction of a group or category ... Date Added: 2009-06-24 12:08:29 |
| week7.pdf Path: Sveriges lantbruksuniversitet >> MATH >> 154 Fall, 2009 Description: Suppose that water is stored in a cylindrical tank of radius 5m. The water is drained at a rate of 0.25 cubic meter per minute. What is rate at which the level of the water inside the tank drops? (Note: the volume of a cylinder of radius r and height... Date Added: 2009-06-24 12:10:24 |
| assignment4_2008.pdf Path: Washington >> PBAF >> 527 Fall, 2009 Description: Public Affairs 527 Assignment 4 Moving from Populations to Samples This assignment is intended to help you make a transition from \"deductive reasoning\" (deducing information about subsamples of the population from information about the entire popul... Date Added: 2009-06-24 12:12:25 |
| GraphImplem.rtf Path: Eastern Washington University >> CSCD >> 327 Fall, 2009 Description: Class CGraph import java.io.*; /* * CGraph.java implementation Author - mixed adjacency matrix / adjacency list Details about class CGraph Supported public functions: constructor - default destructor only (empty graph) fillGraph receives the istream ... Date Added: 2009-06-24 12:17:20 |
| 9th_class.pdf Path: University of Iowa >> C >> 004211 Fall, 2009 Description: 4:211 Introduction to enzyme kinetics 10/3/01 The significance of enzyme kinetics Derivatisation of rapid equilibrium equations The steady state assumption and Derivation of the Briggs-Haldane equation Linear transformations and linear plots and t... Date Added: 2009-06-24 12:18:09 |
| syllabus.pdf Path: ASU >> STAT >> 272 Fall, 2009 Description: MAT 272 Syllabus Week 1 2 3 Date Tue Aug 26 Thu Aug 28 Tue Sep 02 Thu Sep 04 Tue Sep 09 Thu Sep 11 Tue Sep 16 Section 13.1 Three-Dimensional Coordinate Systems 13.2 Vectors 13.3 The Dot Product 13.4 The Cross Product 13.5 Equations of Lines and Plane... Date Added: 2009-06-24 12:22:36 |
| 12eigenvaluelinear.pdf Path: ASU >> STAT >> 342 Fall, 2009 Description: MAT 342 Linear Algebra John Quigg Eigenvalues of linear operators Exercises 1. In each part, decide whether u is an eigenvector of T , and if so determine the associated eigenvalue: (a) T (x) = Ax with A = 1 2 ,u= 1 0 1 1 1 2 1 0 2 1 Spring 2008 rev... Date Added: 2009-06-24 12:24:19 |
| groups.pdf Path: ASU >> STAT >> 444 Spring, 2009 Description: xgxxjj\'pjx #u 4 Xs~ b p P sY#Y #3 S bsqW 2Y 4gPyP u x q3jd#q3 X tq 3 o #u #x C~ 2sY#Y g P 3 o #u #x C~ 2Y Wop q P 3jd#q3 s x q... Date Added: 2009-06-24 12:26:02 |
| 07errata.pdf Path: ASU >> STAT >> 473 Fall, 2009 Description: MAT 473 Intermediate Real Analysis II John Quigg Corrections for Section 7 Page 2, beginning of proof: delete extraneous right parenthesis in D)x f (a)y Page 2, notation and terminology: Di1 ik f = Di1 Dij f should be Di1 ik f = Di1 Dik f Sprin... Date Added: 2009-06-24 12:26:31 |
| Section2_3.pdf Path: Iowa State >> STAT >> 226 Fall, 2008 Description: Section 2.3 Least-Squares Regression 1 Data Summary Plan 2 Statistical Modeling Statistical Model: An equation that fits the pattern between response variable and possible explanatory variables, accounting for deviations from the model Response... Date Added: 2009-06-24 12:36:36 |
| www.npl.co.uk-lmm-docs-stress.pdf Path: Wisconsin >> ENGR >> 433 Fall, 2009 Description: Guides to Good Practice in Corrosion Control Stress Corrosion Cracking The National Physical Laboratory is operated on behalf of the DTI by NPL Management Limited, a wholly owned subsidiary of Serco Group plc Stress Corrosion Cracking Contents 1.... Date Added: 2009-06-24 12:38:30 |
| quiz 2 Path: Middle East Technical University >> CE >> xxx Spring, 2009 Description: qz2q1 (2228x3090x2 tiff) ... Date Added: 2009-06-24 12:56:56 |
| assignment7.doc Path: Washington >> TCSS >> 343 Fall, 2009 Description: Computing and Software Systems 343, Winter 2005 Mathematical Principles of Computing II Assignment 7. Version 1.0. Due Wednesday, Mar. 9, 4:15 PM. Power Grid Learning Objectives Reading, understanding, and using the graph ADT Kruskal\'s algorithm ... Date Added: 2009-06-24 13:04:06 |
| YNL014W.t2k.str2-logo.pdf Path: UCSC >> YNL >> 014 Fall, 2009 Description: 5 4 3 2 1 HHHH CPC C C A Z CPTTCCZZZCC Y CC Y HH A Z C Y A Z Z H S C T T S T S H HHSSSSSCQQSESZYSYTSCSCAACH CC S HT C C C T G X X X X XCCCCXXXXXXXTTTTCHHHTX X X X X X X X X X X X X X X XXXHH X X X XXXXXXAX X H HHHHHH HHHH 110 H C TC C C TT ... Date Added: 2009-06-24 13:15:48 |
| YNL089C.t2k.w0.5-logo.pdf Path: UCSC >> YNL >> 089 Fall, 2009 Description: YNL089C.t2k w0.5 2 1 ML F L I V 1 10 20 30 40 EH 2 1 T E H CL FF P IG FL V GI GY XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX F Y L V I A PM L I V L I V CF A V W L L Y I I V M L A A T A I A V S S A T L V S S Y I I I V V... Date Added: 2009-06-24 13:16:18 |
| exam1.ps Path: Michigan State University >> PHY >> 231 Fall, 2008 Description: #%-12345X@PJL JOB @PJL SET RESOLUTION = 600 @PJL SET BITSPERPIXEL = 2 @PJL SET ECONOMODE = OFF @PJL ENTER LANGUAGE = POSTSCRIPT %!PS-Adobe-3.0 %Title: Microsoft Word - exam1.doc %Creator: PScript5.dll Version 5.2 %CreationDate: 9/26/2003 10:8:27 %For... Date Added: 2009-06-24 13:19:07 |
| YKL087C.t2k.dssp-ehl2-logo.pdf Path: UCSC >> YKL >> 087 Fall, 2009 Description: YKL087C.t2k DSSP-EHL2 2 1 CCC 1 H H E H H H E E E H C C C C X X X X X X X X X X 10 20 30 40 H 2 1 H E E E E X X X X X X X X X X X T G CCCCCCCCCCCCCCCCCCCCCCCCCCCEECCCHH E E CCE E E EE E E E X X X X X X X X X X X X X E EEE EEE E H E ... Date Added: 2009-06-24 13:25:57 |
| YKL044W.t2k.CB_burial_14_7-logo.pdf Path: UCSC >> YKL >> 044 Fall, 2009 Description: YKL044W.t2k CB_BURIAL_14_7 2 1 AA 1 A B BCAX C D X X X D A B C A X BBA A B BBB A D D D D D D D X X XCCCCCCCXX X X X X X X X B A C A AAAAAAA B FF F FGEGGF F E E E G E G B F D E D E E X X X X X X X XXXXXX E A C X B A C A B E E D D X X... Date Added: 2009-06-24 13:26:20 |
| chap-2.doc Path: Penn State >> CWC >> 5023 Winter, 2009 Description: Cody Clarke 09/09/08 MIS 204 1. Describe in your own words, \"The history of the Internet\" (a couple of paragraphs) The Internet derived from a networking project established by the ARPA (Pentagons Advanced Research Project Agency). There were two fun... Date Added: 2009-06-24 13:33:39 |
| decoding.pdf Path: Penn State >> RPS >> 0109 Fall, 2009 Description: Decoding Life\'s Instruction Book The 2001 Penn State Lectures on the Frontiers of Science A CABINET OF WONDERS DNA is an elegant molecule. Purified, it strings like spider silk. Glassy clear, it hides reams of secrets: though we know its code - ATGC... Date Added: 2009-06-24 13:35:51 |
| sp2.Intvw.S06.doc Path: UNC >> SPAN >> 0102 Fall, 2009 Description: Tuvidadepequeo Cmoeratucasacuandotenas7aos? Quineratumejoramigo/a? Qutegustabahacer? Ququerasserenelfuturo? Aquinadmirabas?Quineratuhroeoheroina? Ayudabasconlosquehaceresdelacasa? Sabasmontarenbicicleta?Quinteloense? Habasvistoelmar/lasmontaa... Date Added: 2009-06-24 13:38:01 |
| EX3_S06_SOLN.pdf Path: University of North Carolina, Wilmington >> CHM >> 475 Spring, 2008 Description: ... Date Added: 2009-06-24 13:43:14 |
| c10.pdf Path: UCSC >> ENGR >> 007 Winter, 2009 Description: Example 9.1 In a study by Hays & Marsh reported in the Canadian Journal of Zoology, 1997, 71 loggerhead sea turtles were captured and measured off the coast of Britain. One of the goals was to estimate the growth rate of juvenile turtles (turtles wit... Date Added: 2009-06-24 13:45:32 |
| CHM152PracticeExam2p2.pdf Path: Glendale Community College >> CHM >> 152 Fall, 2008 Description: CHEM 152: Exam 1 Practice Problems, Part II 1. Identify the strongest acid in each group below: A. HClO, HClO2, HClO3 B. HClO, HBrO, HIO C. HF, HCl, HBr Which of the following combinations cannot be a buffer? A. HCN and NaCN B. NH3 and NH4+ C. HNO3 a... Date Added: 2009-06-24 13:46:41 |
| INO_Handbook_AUG08.pdf Path: Illinois Springfield >> LNT >> 501 Fall, 2009 Description: A Student/Faculty Guide to the Liberal and Integrative Studies Program (formerly Individual Option Program) Revised 2008 Liberal and Integrative Studies (formerly INO) AY 2008-2009 Annette Van Dyke, Professor Director, Liberal and Integrative Studie... Date Added: 2009-06-24 14:00:31 |
| Winter 2009 Coms 342 Syllabus Meyer 01777 A01.doc Path: Bethel VA >> KM >> 327705 Fall, 2009 Description: COMS 342 Communication and Persuasion School of Communication Studies Call # 01777 (Section: A01) Room: GROV W109 Winter 2009 Dates R, 2:10 p.m. - 4:00 p.m. Instructor: Kevin R. Meyer Office: Lasher Hall 037 Phone: (740) 707-4617 E-Mai... Date Added: 2009-06-24 14:00:51 |
| handout02.1.pdf Path: Cornell >> PHYS >> 213 Fall, 2008 Description: C alorimetery A 40 g block of ice is cooled to -78 oC. It is added to 560 g of water in an 80 g copper calorimeter at a temperature of 25 oC. Determine the final temperature. The specific heat of ice is 0.500 cal/g and the heat of fusion of ice is 80... Date Added: 2009-06-24 14:01:17 |
| Sedra42021_ch02.ppt Path: FIU >> ENG >> 3303 Fall, 2009 Description: Operational Amplifiers 1 Figure 2.1 Circuit symbol for the op amp. Microelectronic Circuits - Fifth Edition Sedra/Smith Copyright 2004 by Oxford University Press, Inc. 2 Figure 2.2 The op amp shown connected to dc power supplies. Microelectronic ... Date Added: 2009-06-24 14:05:49 |
| YGL202W.t2k.dssp-ebghstl-logo.pdf Path: UCSC >> YGL >> 202 Fall, 2009 Description: YGL202W.t2k EBGHSTL 3 2 1 CC X 1 10 20 30 40 H 3 2 1 H T E S CHHHHHHHHHHH HCXXX X X X X X X 51 60 70 80 90 H 3 2 1 T T T S T E T G GG TC S X X T T CCHS CTCC S G T H HHTSSSTSSCH S C T XXXX E T C T X X C H H S C G X X X... Date Added: 2009-06-24 14:07:11 |
| MayaOverviewofInterface.pdf Path: Austin CC >> ART >> 138 Fall, 2009 Description: The Maya interface Now t hat Maya is running, you first need t o underst and what you are seeing. T here are a lot of it ems displayed in t he Maya user int erfac e. T he best way t o begin is t o learn t he fundament al t ools and t hen learn addit ... Date Added: 2009-06-24 14:09:30 |
| T0349.t04.w0.5-logo.pdf Path: UCSC >> T >> 0349 Fall, 2009 Description: T0349.t04 w0.5 2 1 M L I V F A K X XXXXXXXXX D K F E I EVVRTNN I S S G LL D P V X A VA LV M V F I A L X XXXXX XX M F L L I X L I I V L A F G E G S F E XX K XXXXXXXXXXX L D N S G L K D E Q M L N L V XXXXXX S E SVVDA M I T L F ... Date Added: 2009-06-24 14:14:12 |
| T0331.dssp-ehl2-logo.pdf Path: UCSC >> T >> 0331 Fall, 2009 Description: T0331 dssp-ehl2 2 1 HCCCCCCCHCHXE C C C H H X 1 10 20 30 40 H 2 1 H C E E E X X E C E X 51 60 70 80 90 H 2 1 H H C C X X E E H C C C C X X X X C X X C C C C H H X X X X X X CCC H C X X H X 101 110 120 130 H H 140 ... Date Added: 2009-06-24 14:14:40 |
| T0313.t2k.CB_burial_14_7-logo.pdf Path: UCSC >> T >> 0313 Fall, 2009 Description: T0313.t2k CB_burial_14_7 3 2 1 A B X A CD AA AB AA C DC D A A B BBC BB B B A B B C EEGEEFEE D C D CDCCBBFCDC CDDB D C DDE D F CCDCCCCDD D D D D D CXBDGXEGDXXCXDCDDDDCCXXEBXCCDCCDXBCCCDCDCDDXXXBXBX D D D X X XX X 1 10 20 30 40 AD 3 2 1 F ED ... Date Added: 2009-06-24 14:15:17 |
| 121_proj6.pdf Path: Glendale CC >> PHOTO >> 121 Fall, 2009 Description: Photo 121: Photoshop I Instructor : B. Bardens PROJECT 6 (FINAL PROJECT): COMMERCIAL ART PROJECT This project is similar to project 2, the CD cover, except th is time you are going to design a movie poster. The poster should be for a fictional movi... Date Added: 2009-06-24 14:15:36 |
| ch6.ppt Path: UCLA >> CS >> 131 Fall, 2008 Description: Arithmetic Expressions - Their evaluation was one of the motivations for the development of the first programming languages - Arithmetic expressions consist of operators, operands, parentheses, and function calls - Operator and operand evaluation or... Date Added: 2009-06-24 14:16:29 |
| CrossCulturalInterface.pdf Path: Washington >> TC >> 512 Fall, 2009 Description: August 31, 2000 The Effects of Cross Cultural Interface Design Orientation on World Wide Web User Performance Albert N. Badre Abstract: The electronic environment of the World Wide Web evolves daily, increasing the likelihood of international partic... Date Added: 2009-06-24 14:18:32 |
| Lindvall - Protests.pdf Path: East Los Angeles College >> POLF >> 0109 Fall, 2009 Description: A MODEL OF PROTESTS JOHANNES LINDVALL, UNIVERSITY OF OXFORD 1. Introduction This paper develops a theoretical analysis of conicts between governments and pressure groups. The papers main claim is that protests are most likely to occur in political s... Date Added: 2009-06-24 14:20:16 |
| Caryophyllaceae.pdf Path: Iowa State >> BIO >> 366 Fall, 2009 Description: Caryophyllaceae Carnation Family Opposite leaves with swollen nodes Flowers with notched petals Caryophyllales Genus to know: Dianthus Ovary position: superior Number of Stamen: 5 or 5+5 Fruit type: capsule Number of species: 2300 Economic/Cultura... Date Added: 2009-06-24 14:24:28 |
| Test1Sample.pdf Path: Delta MI >> MTH >> 097 Fall, 2009 Description: MTH 097 1. Sample Test 1 Sections: through 2.3 Give an example of a number that fits the description. If there is no such number write, \"Not Possible\" a) A rational number that is not an integer. b) An irrational number. 2. A person might do the ... Date Added: 2009-06-24 14:25:37 |
| Week 4.pdf Path: Cal Poly >> STAT >> 313 Fall, 2009 Description: Week 4 Stat 313 Chapters 5 Orthogonal xs Chapter 6 combining categorical and quantitative xs Quantitative Methods Designing experiments keeping it simple Designing experiments - keeping it simple Three principles of experimental design Replic... Date Added: 2009-06-24 14:31:43 |
| lec1.pdf Path: University of Illinois, Urbana Champaign >> CS >> 473 Fall, 2008 Description: CS 473ug: Algorithms Mahesh Viswanathan vmahesh@cs.uiuc.edu 3232 Siebel Center University of Illinois, Urbana-Champaign Spring 2006 Viswanathan CS473ug Sta, Oce Hours, and Resources Grading Scheme How to Perform Badly Part I Administrivia Viswa... Date Added: 2009-06-24 14:31:51 |
| 2001F-Lecture13.doc Path: Oakland University >> CPRE >> 211 Fall, 2009 Description: vti_encoding:SR|utf8-nl vti_timelastmodified:TR|05 Oct 2001 17:08:07 -0000 vti_extenderversion:SR|4.0.2.6513 vti_filesize:IR|143360 vti_title:SR|Cpr E 211 Lecture 13 vti_backlinkinfo:VX|portfolio/courses/cpre211.html vti_cacheddtm:TX|05 Oct 2001 17:... Date Added: 2009-06-24 14:33:56 |
| a05_cover_letter.doc Path: Washington >> ENGL >> 111 Fall, 2008 Description: University of Washington, WA December 12, 2005 Department of English University of Washington Lewis Annex, 202 Seattle, WA 98195 Dear Mr. Schenold: In this portfolio for English 111, I have selected five papers that demonstrate my progress over the q... Date Added: 2009-06-24 14:35:28 |
| hw2-solutions.pdf Path: University of Illinois, Urbana Champaign >> ECE >> 460 Fall, 2008 Description: ... Date Added: 2009-06-24 14:35:31 |
| T0419.t04.o_notor2-logo.pdf Path: UCSC >> T >> 0419 Fall, 2009 Description: T0419.t04 o_notor2 4 3 2 1 MFESAEVGHSIDKDTYEKAVIELREALLEAQFELKQQARFPVIILINGIEGAGKGETVKLLNEWMDPRLIEVQSFLRPSDEELERPPQWRFWRRLPPKGR 1 10 20 30 40 50 60 70 80 90 HN 4 3 2 1 H GN P N H N GN BN GN H GN GN TGIFFGNWYSQMLYARVEGHIKEAKLDQAIDAAERFERM... Date Added: 2009-06-24 14:37:55 |
| simtrade.xls Path: Colorado >> HOME >> 2223 Fall, 2009 Description: Turn 1 2 3 4 5 6 7 8 9 10 11 12 Oil Start Oil Finish Fish Start Fish Finish Minerals start Minerals Finish Penalty ... Date Added: 2009-06-24 14:38:58 |
| SCA_internships.doc Path: JMU >> ARCHIVE >> 0408 Fall, 2009 Description: They\'re ba-ack! Green internships again bring green awards SCA announces the return of AmeriCorps Education Awards! In addition to all the other upsides, qualified SCA interns can now gain at least $1,000 for college tuition or to repay school loans.... Date Added: 2009-06-24 14:42:36 |
| Internships.doc Path: JMU >> ARCHIVE >> 0408 Fall, 2009 Description: Internship Announcement In 2005, the US Fish and Wildlife Service and USDA Forest Service will sponsor 60-80 paid summer internships with a primary focus on recruiting and exposing freshman and sophomore Hispanic, African-American, Asian and Native A... Date Added: 2009-06-24 14:42:36 |
| snyder.pdf Path: UPenn >> COMM >> 360 Fall, 2009 Description: ... Date Added: 2009-06-24 14:43:24 |
| NRES 495 Lecture 19 2009.pdf Path: Nevada >> NRES >> 495 Fall, 2008 Description: NRES 496/695 Fire Ecology and Management 2009 Lecture 19: April 6 Teacher: Ashley Sparrow NRES @ UNR Previously, on NRES 495/695. Fire adaptations in their evolutionary context resprouting as a case study (Bellingham & Sparrow, 2000) considers fire... Date Added: 2009-06-24 14:50:49 |
| home3.pdf Path: NSC Henderson >> GEY >> 715 Fall, 2009 Description: Name GEY 715 Fall 2003 Homework No. 3 Basic Aquifer Simulation Using a Two-Dimensional Groundwater Model Introduction In GEY 674-Hydrogeology you were introduced to the concepts of well hydraulic and various analytic and graphic methods for estim... Date Added: 2009-06-24 14:51:54 |
| isis-duplicate-address.txt Path: Georgia Tech >> CS >> 7260 Fall, 2008 Description: The following routers have conflicting ISO addresses configured: The following routers have conflicting IPv4 addresses configured: The following routers have conflicting IPv6 addresses configured: ... Date Added: 2009-06-24 14:56:46 |
| Section 5_9 Path: N.C. State >> MA >> 241 Spring, 2009 Description: WebAssign Section 5.9 (Homework) About this Assignment Question Points 1 2 3456 2 4.25 3 3 2 2 Total 16.25/16.25 Description Approximate Integration The due date for this assignment is past. Your work can be viewed below, but no changes can be made... Date Added: 2009-06-24 14:57:01 |
| qtwo.pdf Path: Wisconsin Milwaukee >> IE >> 360 Fall, 2009 Description: Quiz # 2 Engineering Economic Analysis Name: _ Problem # 1 Mr. Smith borrows $10,000 for a new car from a bank which charges 8% compound interest. This loan is to be paid back in 10 equal annual installments with first payment at the end of the fir... Date Added: 2009-06-24 15:01:56 |
| ECE411-Spring2009-Syllabus.pdf Path: Lake County >> ECE >> 411 Fall, 2009 Description: ECE 411 Course Overview Spring 2009 Instructor: Constantine Polychronopoulos 463 C&SRL, phone: 244-4144, email: cdp@illinois.edu Office hours: Tuesdays 11am-1pm, and by appointment. Teaching Assistants: Daniel Manjjares Faycal Benmlih Nicolas Zea ma... Date Added: 2009-06-24 15:02:12 |
| hw1soln.pdf Path: Arizona >> ECE >> 425 Fall, 2008 Description: j y xy y y 9 u l 6 9 u e jl 9y p u v h ~h q h ph x v t e r Y{9y 1qgvzsq}|Y{ezsywusq o y flk p l k jd A 89y u y jl YpvsqrA|gesqds~ 9y uvqrqhigqciqYyqdqunq v p e e p vr g hee eh e r T I aYWURP ` XV T S Q ... Date Added: 2009-06-24 15:05:49 |
| L23_replication.pdf Path: Lake County >> ECE >> 428 Fall, 2009 Description: CS 425/ ECE 428 Distributed Systems Lecture 23 Replication Control Reading: Section 15.1-15.4 2002, M. T. Harandi and J. Hou (modified: I. Gupta and K.Nahrstedt) Replication Enhancing Services by replicating data Load Balancing Workload is share... Date Added: 2009-06-24 15:06:00 |
| EngineEva.doc Path: Washington >> ENGR >> 100 Fall, 2008 Description: Engine project: Team members evaluation Please print this page and do the following: a. Under Contribution, give your opinion of the importance of each member to the project. You may give everyone an equal rating to reflect a very well balanced team... Date Added: 2009-06-24 15:12:35 |
| cus.2up.pdf Path: University of Toronto >> CSC >> 2108 Fall, 2009 Description: ( wxx wv uu cc dd aa ee et et dd ss ( yxxw v y $ $ F F a a )\' ! 22 1 $ 1 0( \" g g e \" W \" g e \" W \" \" g \" \" g T e... Date Added: 2009-06-24 15:13:27 |
| assign4-summer.pdf Path: University of Toronto >> ECE >> 106 Fall, 2009 Description: ECE 106 Programming Fundamentals Lab Assignment #4: Inheritance Summer 2007 1. Objectives The objective of this assignment is to provide you with practice on the use of inheritance in C+ programming. This will be done in the context of re-implem... Date Added: 2009-06-24 15:14:02 |
| Homework7.pdf Path: Arizona >> ECE >> 459 Fall, 2008 Description: ECE 4591559 Fall 2008 Homework # 7 Assigned November 14,2008 1 . S h o ~hat in an isotropic, nonmagnetic, and inhomogeneous dielectric medium, t Maxwell\'s equations can be manipulated to yield the inhomogeneous wave equation: 2 . Assuming unit-ampli... Date Added: 2009-06-24 15:16:06 |
| ssfuser.pdf Path: Lake County >> ECE >> 541 Fall, 2009 Description: Parallel Real-time Immersive Modeling Environment (PRIME) Scalable Simulation Framework (SSF) V ERSION 1.0 USERS MANUAL JASON L IU Florida International University School of Computing and Information Sciences Miami, FL 33199 November 26, 2007 DIS... Date Added: 2009-06-24 15:18:40 |
| tp2hiv2008.pdf Path: Université du Québec à Montréal >> INFO >> 2170 Fall, 2009 Description: d % % % % % % % %T U W W S S a U S Y YU p Ys p S p Ue S W BXXtiBBVuUbcsXVWVUwwVUBVi3YwVUwUacauVUhs cUyethw`UgdcseB bVpcBi VU`S0@uU0y 0Vy@u8s`0BwU a U x i S Yi S a S a YsU SU { a U Ux p { U Ysx x std8VUytewX@UUwyetVUgyseB B@\'3Y... Date Added: 2009-06-24 15:22:31 |
| hw1.pdf Path: Lake County >> ECE >> 486 Fall, 2009 Description: ECE 486 Issued: January 23 Assignment # 1 Due: January 30, 2009 Reading Assignment: FPE 5th ed., Chapters 13 (ignoring subsections marked ). See also Belanger, Chapters 13, and Brogan, Chapters 3 & 5, or Chen Chapters 13. Problems: 1 (i) Compute ... Date Added: 2009-06-24 15:23:11 |
| s450t1sol.pdf Path: W. Alabama >> STAT >> 450 Fall, 2009 Description: ... Date Added: 2009-06-24 15:23:52 |
| MRI.Infosheet.pdf Path: Lake County >> ECE >> 498 Fall, 2009 Description: Dynamic Magnetic Resonance Imaging (MRI) Sam Stone, Haoran Yi Center for Reliable and High-Performance Computing, UIUC Introduction Magnetic resonance imaging (MRI) is a medical imaging technique that provides high resolution images of internal tissu... Date Added: 2009-06-24 15:24:28 |
| review_exam1.pdf Path: Glendale Community College >> PSY >> 101 Fall, 2008 Description: PSY101 Dr. Timothy Larey REVIEW FOR EXAM 1 I. INTRO PHILOSOPHY Georg ... Date Added: 2009-06-24 15:25:48 |
| CH14.ppt Path: San Diego State >> PEOPLE >> 690 Fall, 2009 Description: Chapter 14 Grounded Theory Designs Educational Research by John W. Creswell. Copyright 2002 by Pearson Education. All rights reserved. Slide 1 A Brief History of Grounded Theory Designs 1967 Glaser and Strauss book Discover of Grounded Theory 199... Date Added: 2009-06-24 15:28:36 |
| 203HW4.pdf Path: SUNY Stony Brook >> MAT >> 203 Summer, 2008 Description: Homework 4 - MAT 203 Due on 07/01/08 in class (1) Examine the function f (x, y ) = x3 y 3 2 for relative extrema. (2) Examine the function f (x, y ) = x2 + y 2 + 4x 4y + 3 for relative extrema, specifying if any is an absolute extrema. (3) A can o... Date Added: 2009-06-24 15:30:01 |
| s6.pdf Path: Paul Quinn >> MAT >> 328 Fall, 2009 Description: ... Date Added: 2009-06-24 15:31:21 |
| Man_app.ppt Path: Purdue >> ASM >> 222 Fall, 2008 Description: ASM 222 Crop Production Equipment: Manure Application Learning Objectives 1. Characteristics which influence handling 2. Methods, technologies and rates of Loading at the barn Delivery to fields Application in fields 3. Power Requirements 4. Roll... Date Added: 2009-06-24 15:37:44 |
| Quiz 2.doc Path: Oklahoma State >> ETM >> 5471 Fall, 2009 Description: Quiz # 2 Operationally define the following terms: Hazard Analysis Preliminary Hazard Analysis Fault Tree Analysis Critical Item Single Failure Point Extra Credit: Failure Mode and Effects Analysis Hazard Analysis: Plan of work to identify hazards an... Date Added: 2009-06-24 15:37:55 |
| Burch.pdf Path: SUNY Stony Brook >> AST >> 389 Fall, 2008 Description: 1 Noelle Burch AST/EGL: 389 8 May 2008 HOME I glanced nervously around the bright white room. Clearing my t hroat I began to speak. Good afternoon ladies and gentlemen. I am addressing you today t o tell my story; you can judge its validity for you... Date Added: 2009-06-24 15:39:15 |
| s6.pdf Path: CUNY Baruch >> MAT >> 328 Fall, 2009 Description: ... Date Added: 2009-06-24 15:42:46 |
| Factor Analysis.pdf Path: UWO >> PSYCH >> 380 Fall, 2009 Description: Factor Analysis Lab #10 Factor Analysis Helps us find underlying dimensions in our data These are called latent variables or factors & are formed from a set of individual difference variables that we measure a bunch of people on. Each factor/latent ... Date Added: 2009-06-24 15:44:51 |
| MATLABPrimer.pdf Path: Colorado >> AMATH >> 4650 Fall, 2009 Description: MATLAB Primer Third Edition Kermit Sigmon Department of Mathematics University of Florida Department of Mathematics University of Florida Gainesville, FL 32611 sigmon@math.ufl.edu Copyright c 1989, 1992, 1993 by Kermit Sigmon On the Third Edition... Date Added: 2009-06-24 15:45:58 |
| az.txt Path: NYU >> JK >> 1786 Fall, 2009 Description: abkhaz az diaz fortaz graz hedjaz hejaz hijaz pizzaz razmataz shiraz topaz ... Date Added: 2009-06-24 16:04:44 |
| md.txt Path: NYU >> JK >> 1786 Fall, 2009 Description: dmd md wmd ... Date Added: 2009-06-24 16:04:47 |
| ws.txt Path: NYU >> JK >> 1786 Fall, 2009 Description: allhallows andrews bellows clews cows fws gallows hebrews jackstraws laws mews news owlclaws pussy-paws slews trews windows yaws ... Date Added: 2009-06-24 16:04:53 |
| RC Presentation.pdf Path: Oregon >> ARCH >> 384 Fall, 2008 Description: Bouldering is the practice of climbing rock without going more than 10 feet or so from the ground, so that a climber may safely jump to the ground. Indoors walls can be constructed to almost any scale and t., relying on exterior holds that can be swa... Date Added: 2009-06-24 16:12:28 |
| 99s0471_1.pdf Path: Wisconsin >> LAW >> 670 Fall, 2009 Description: 1999 2000 LEGISLATURE LRBs0471/1 MJL:cmh:hmh ASSEMBLY SUBSTITUTE AMENDMENT 1, TO 1999 ASSEMBLY BILL 670 March 23, 2000 Offered by Representatives MEYERHOFER and HOVEN. 1 2 AN ACT to create 66.082 (3m) of the statutes; relating to: operation an... Date Added: 2009-06-24 16:14:37 |
| 05OrgSolution.pdf Path: Texas A&M >> GEOL >> 641 Fall, 2008 Description: Organic Solubility Solubility of Organics Solubility Organics Bruce Herbert Geology & Geophysics Organic Solubility Organic Contaminants In Aqueous Solution Solubility of organic contaminants is a major factor determining their environmental be... Date Added: 2009-06-24 16:18:11 |
| takehome.doc Path: Uni. Westminster >> CSG >> 0808 Fall, 2009 Description: Christine Garcia 4/23/09 Take home test 1. Hypothesis testing is a statistical method used by researchers and others to determine if the probability of their hypothesis is true. This method has several steps: First, you must state the null hypothesis... Date Added: 2009-06-24 16:21:58 |
| cn3aInte.pdf Path: ASU >> CSE >> 562 Fall, 2009 Description: cn3aInte.fm5 Course Review Notes Cse 560 Course Notes Integration Dr. Lindquist Last Modified October 20, 1997 6:02 am 7. Software Environment Frameworks 7.a Frameworks - Integration Contents 7.a Frameworks - Integration .. 189 7.a.1References . ... Date Added: 2009-06-24 16:22:04 |
| Nurse Problem Solution.pdf Path: UMBC >> MT >> 235 Fall, 2009 Description: Full Solution to the Nurse Assignment Problem 1. Let xi,j = 1 if nurse i is assigned to shift j, and xi,j = 0 if nurse i is not assigned to shift j. We let i = A for Abrams, B for Baxter, C for Collins, D for Davis, E for Evans, F for Forrest, G for... Date Added: 2009-06-24 16:24:49 |
| hw5-cs667-f06.ps Path: NJIT >> CS >> 667 Fall, 2009 Description: %!PS-Adobe-2.0 %Creator: dvips(k) 5.86 Copyright 1999 Radical Eye Software %Title: hw5-cs667-f06.dvi %Pages: 3 %PageOrder: Ascend %BoundingBox: 0 0 612 792 %DocumentFonts: CMCSC10 CMR10 CMBX10 CMMI10 CMSY10 CMMI7 CMR7 CMSY7 %+ CMTI10 CMTT10 %EndComme... Date Added: 2009-06-24 16:25:55 |
| hw0405.pdf Path: JMU >> A >> 241 Fall, 2009 Description: HOMEWORK DUE APRIL 5, 1999 COB 241 Section 1 Issued on March 31, 1999 Chapter 9 Questions: ALL questions except question 5. Exercises 9-1, 9-2, 9-3, 9-4, 9-8, 9-9, 9-10, 9-11, 9-14, 9-18. Problems 9-4A, 9-7A, 9-5B ... Date Added: 2009-06-24 16:35:02 |
| hw6solutions.pdf Path: Auburn >> ELEC >> 3320 Fall, 2008 Description: ELEC 3320 Spring 2003 HW6-solutions Instructor: Dr. Kirkici Page 1 of 5 ELEC 3320 Spring 2003 HW6-solutions Instructor: Dr. Kirkici Page 2 of 5 ELEC 3320 Spring 2003 HW6-solutions Instructor: Dr. Kirkici Page 3 of 5 ELEC 3320 Spring 2003... Date Added: 2009-06-24 16:36:18 |
| Units.xls Path: Bradley >> ART >> 305 Fall, 2009 Description: Sal Exec Dir wi Bnfts Prev Spec wi PR costs Yellow Ribbon Teen Screen Total $459 $13 Program Date Site # Adults Trained Yellow Ribbon 12/14/2004 Woodruff HS 10/8/2004 Richwoods HS Faculty 12/6/2004 Richwoods HS Parents Cost Per Serv Total Income # S... Date Added: 2009-06-24 16:38:17 |
| sol9.pdf Path: ECCD >> SCE >> 94553 Fall, 2009 Description: ... Date Added: 2009-06-24 16:39:49 |
| YPL181W.t2k.CB_burial_14_7-logo.pdf Path: UCSC >> YPL >> 181 Fall, 2009 Description: YPL181W.t2k CB_BURIAL_14_7 3 2 1 A A BA A CBA C D D X X XXXXX B A A A B A A A B A B B B A B A B B D D B B B B A A D A B B C C C D C C C C C C C D A C C C C C C D C C C C C C C C C D D D D D D B D D D D D D D D D D D D D D D D D D D D D D D D D D ... Date Added: 2009-06-24 17:07:43 |
| YPL189W.t2k.w0.5-logo.pdf Path: UCSC >> YPL >> 189 Fall, 2009 Description: YPL189W.t2k w0.5 5 4 3 2 1 Y F Q F V R L I Y V E I L A A L XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX XXXXX K R T S L N Q Y M L D F D V R MAQFV E E I F K S S H D L V Q H ILPRFKKI S A R I L E M T K L K R I L L L S VSADALI V T I L M F Y L FF... Date Added: 2009-06-24 17:07:53 |
| in_road04.txt Path: University of Illinois, Urbana Champaign >> IOP >> 20030531 Fall, 2009 Description: <html> <head> <title>Indiana State Police</title> <meta http-equiv=\"Content-Type\" content=\"text/html; charset=iso-8859-1\"> <meta name=\"description\" content=\"Fireworks Splice HTML\"> <script language=\"JavaScript\" src=\"/isp/js/relative.js\"></script> <sc... Date Added: 2009-06-24 17:09:32 |
| in_road07.txt Path: University of Illinois, Urbana Champaign >> IOP >> 20030610 Fall, 2009 Description: <html> <head> <title>Indiana State Police</title> <meta http-equiv=\"Content-Type\" content=\"text/html; charset=iso-8859-1\"> <meta name=\"description\" content=\"Fireworks Splice HTML\"> <script language=\"JavaScript\" src=\"/isp/js/relative.js\"></script> <sc... Date Added: 2009-06-24 17:09:33 |
| exam2.pdf Path: Kent State >> MATH >> 61052 Fall, 2008 Description: ABSTRACT ALGEBRA II MATH 6/71052 EXAM II Prof. D. L. White April 7, 2008 Do any FIVE of the following problems. All problems are weighted equally. Put each problem on a separate sheet. Write your name on each page. Time allowed is 1 hour and 15 minu... Date Added: 2009-06-24 17:11:56 |
| chap001.ppt Path: UMKC >> BMA >> 567 Fall, 2008 Description: 11 McGrawHill/Irwin 2005TheMcGrawHillCompanies,Inc.Allrightsreserved. 12 Chapter 1 The Pay Model Screen graphics created by: Jana F. Kuzmicki, PhD Troy State University-Florida and Western Region McGrawHill/Irwin 2005TheMcGrawHillCompanies,Inc... Date Added: 2009-06-24 17:23:02 |
| 3087.txt Path: UNC >> DOCS >> 3087 Fall, 2009 Description: The Project Gutenberg EBook of Original Short Stories of Maupassant, Volume 11, by Guy de Maupassant This eBook is for the use of anyone anywhere at no cost and with almost no restrictions whatsoever. You may copy it, give it away or re-use it unde... Date Added: 2009-06-24 17:28:06 |
| YAL024C.t2k.stride-ebghtl-logo.pdf Path: UCSC >> YAL >> 024 Fall, 2009 Description: HHHHHHHHH X X X X X X X G TCC T C T T T C T H T T C C H C H C T T E E X XTXXHCHXCXXXHGHHX X X H X X TTT C 120 X X X X T 3 2 1 T H HHHHH 151 TTCH T C H C H T C H X XXXCXHHCHCCXXHHX X X X X X X X T 3 2 1 C C H T X H T T H H H T CTT T ... Date Added: 2009-06-24 17:33:13 |
| lecture17pdf.pdf Path: Penn State >> ENVE >> 451 Fall, 2009 Description: Goals/Learning Objectives Goal: Develop a biological understanding of the insect-vectored diseases in the Order Diptera and how and why these diseases are a problem for humans throughout the world. Learning Objectives Name five major diseases vectore... Date Added: 2009-06-24 17:35:38 |
| comp group work.doc Path: N. Georgia >> MESUBL >> 2834 Fall, 2009 Description: Centers At the beginning of the centers activity, you will get into you assigned group. You will be given some resources to use along with your science book to find the information you will need to complete each center. You will be graded on particip... Date Added: 2009-06-24 17:37:37 |
| hw4f00s.pdf Path: Iowa State >> STAT >> 557 Fall, 2008 Description: Stat 557 Fall 2000 Assignment 4 Solutions Problem 1 Consider the vector of sample proportions 2 3 p11 7 6 6 6 p12 7 7 p=6 7= 6 6 p21 7 7 4 5 2 3 Y11 7 6 6 7 1 6 Y12 7 6 7 6 n 6 Y21 7 7 4 5 : p22 Y22 From the Multivariate Central Limit Theorem, ... Date Added: 2009-06-24 17:38:08 |
| Project-1.pdf Path: Sveriges lantbruksuniversitet >> CMPT >> 365 Fall, 2009 Description: CMPT 365 Multimedia Systems Project 1 Deadline 5:00pm, Oct 10 (Mon), 2005 Note: This is a group-based project. Each group should have two members, and only one program/report should be submitted. Please make sure that both member names appear in the ... Date Added: 2009-06-24 17:38:22 |
| sound.pdf Path: Rutgers >> PHYSICS >> 205 Fall, 2009 Description: 7/06 Sound Wave Interference Sound Wave Interference About this lab Interference is the hallmark of classical wave phenomena, and also of quantum mechanical waves. Classical examples include sound waves in fluids (longitudinal only) or in solids (l... Date Added: 2009-06-24 17:43:26 |
| Liquidity Management.ppt Path: Ohio State >> FIN >> 826 Fall, 2009 Description: BUS FINANCE 826 Overview Depository institutions and life insurance companies are highly exposed to liquidity risk. This chapter discusses how these firms can control liquidity risk, the motives for holding liquid assets, and specific issues associ... Date Added: 2009-06-24 17:46:45 |
| Carretta.pdf Path: Cornell >> PRH >> 7090 Fall, 2009 Description: \' : \'=:-:| t11;ai ,i:;,ri 1 = i,\'.:z=,rt,:,:;,i-; : : :i= = , i!l=t:-=:; \' 1 : t = : itz:= 1 . =l :\'=i ; , - : : : =a = . :=rij laa =-=1, 1 \'1 1 , 1 : : ; : v: ; =1=:t;,=i=,=: , , - ,t,r=-t| , t;:;:i-:| : t; - =:\' - t :ZZiZ: ; : z\'l\'= i Z :i11:1... Date Added: 2009-06-24 17:47:58 |
| ISU_583_lect_3_F2008.ppt Path: Washington University in St. Louis >> CPRE >> 583 Fall, 2009 Description: ECpE 583 Reconfigurable Computing Lect 3: Thur 9/2/2008 (VHDL overview) Instructor: Dr. Phillip Jones (phjones@iastate.edu) Reconfigurable Computing Laboratory Iowa State University Ames, Iowa, USA http:/www.ece.iastate.edu http:/class.ece.iastate.e... Date Added: 2009-06-24 17:50:37 |
| Homework8.solution.pdf Path: Mich Tech >> GE >> 3850 Fall, 2008 Description: Prob. 1 (Fetter Prob. 2, Ch. 6) Total volume Mass soild + water, sampled Mass solid + water, saturated Mass solid Density water Mass water, sample Volume water, sample Mass water, saturated Volume water, saturated Volume void (A) Volumetric water con... Date Added: 2009-06-24 17:51:47 |
| Lecture 8 - DAB.ppt Path: UNLV >> BIOL >> 251 Summer, 2008 Description: Survey of Eukaryotic Microbes Fungi Algae Lichens Chapters 5 & 22 Talaro Foundations in Microbiology 1 Kingdom Fungi 100,000 species divided into 2 groups macroscopic fungi microscopic fungi Heterotrophic none are autotrophic on their ... Date Added: 2009-06-24 17:53:59 |
| Books Introduced In Class.doc Path: Boise State >> MATH >> 547 Fall, 2008 Description: Books Introduced In Class These are the books that were introduced during class. Alexander J. Hahn, Basic Calculus: From Archimedes to Newton to its Role in Science, Key College (1998), ISBN: 0387946063 Calvin C. Clawson, Mathematical Mysteries: The ... Date Added: 2009-06-24 17:54:45 |
| Chapter 15.ppt Path: YCP >> MBA >> 527 Fall, 2009 Description: \"How Well Am I Doing?\" Statement of Cash Flows Chapter Fifteen McGraw-Hill/Irwin Copyright 2008, The McGraw-Hill Companies, Inc. 15-2 Purpose of the Statement of Cash Flows Are cash flows sufficient to support ongoing operations? Can we meet o... Date Added: 2009-06-24 17:55:41 |
| coursematerials.pdf Path: North Texas >> CECS >> 0220 Summer, 2009 Description: H.S. Multimedia Course - Plano ISD Course Materials 2007-2008 Software MS Office 2003 Audacity Sounds Effects Vol 1,2 and Music Loops (royalty-free audio clips collection) Adobe Photoshop CS Simply VR: Spin Panorama, Spin PhotoObject Macromedia... Date Added: 2009-06-24 17:57:01 |
| Buildingacamera.pdf Path: UWO >> ART >> 203 Fall, 2008 Description: Step 3 Drilling the pinhole Place a one inch square piece of the brass shim stock on a couple layers of corrugated cardboad or on some styrofoam. With the needle/pencil, using slight pressure and rotating it back and forth, drill a hole in the brass... Date Added: 2009-06-24 17:57:32 |
| 5004Handout 8.pdf Path: Virginia Tech >> AAEC >> 5004 Fall, 2008 Description: ... Date Added: 2009-06-24 17:58:01 |
| OCD_QR_LCA_F05A_T19.xls Path: USC >> CSCI >> 577 Fall, 2009 Description: 46181782bcb9f362fffe39597b496976a3c3f5eb.xls - Areas of Concern Log Field Desc This form is to be filled out by reviewer Filed Name Project Name Artifact Module MBASE Phase/lvevel Description Insert the project name or title. For purpose of the cla... Date Added: 2009-06-24 18:04:02 |
| T0504.t2k.stride-ebghtl-logo.pdf Path: UCSC >> T >> 0504 Fall, 2009 Description: T0504.t2k EBGHTL 3 2 1 1 10 20 30 40 T 3 2 1 E T E T E T 51 60 70 80 90 E 3 2 1 T E T E T E T 101 110 120 130 140 E 3 2 1 T E T GE T T T H 151 160 170 180 190 T 3 2 1 E T E T E T E T E 201 RGSTR... Date Added: 2009-06-24 18:05:16 |
| 1320benchproj.pdf Path: Trinity U >> DRAM >> 1320 Fall, 2009 Description: ... Date Added: 2009-06-24 18:08:11 |
| HorizonManual.pdf Path: Trinity U >> PROJ >> 2314 Fall, 2009 Description: Software Build 121 User Guide Table of Contents WHAT\'S NEW.17 HORIZON Build 121 .. 17 HORIZON Build 120 . 17 HORIZON 98 Release 680 .. 17 HORIZON OVERVIEW .18 Concept of Horizon .. 18 What has caused the divergence? . 18 Where does Horizon fit in... Date Added: 2009-06-24 18:08:12 |
| syllabus.doc Path: UPR Mayagüez >> ICOM >> 6005 Fall, 2009 Description: vti_encoding:SR|utf8-nl vti_timelastmodified:TR|21 Jan 2005 21:13:42 -0000 vti_extenderversion:SR|5.0.2.6738 vti_author:SR|LAPTOP-MR\\Administrator vti_modifiedby:SR|LAPTOP-MR\\Administrator vti_timecreated:TR|21 Jan 2005 21:13:42 -0000 vti_cacheddtm:T... Date Added: 2009-06-24 18:09:07 |
| lab_7_final_GAP.pdf Path: Western Washington >> EGEO >> 450 Fall, 2008 Description: Comparison of WDFW\'s GAP Habitat Analysis and My Suitability Analysis for Mountain Goats in the Mount Baker Region Zoomed In View Legend GPS Goat Points summer GPS Goat Points Winter Sum Hab Buffer(100m) Wint Hab Buffer (100m) Roads GAP Suitable Hab... Date Added: 2009-06-24 18:15:14 |
| 7 FDI.ppt Path: Dallas >> LXS >> 055000 Fall, 2009 Description: BA 4371-004 I nternational Business Class 7 FDI Sunny Li Sun Oct. 4, 2008 1 China Vs. India Compared with the U.S., the cost of start-up procedures is 106 times higher i n India and 12 times higher in China, according to the Doing Business sur... Date Added: 2009-06-24 18:15:15 |
| Hugh Hefner Obituary Path: Fashion Institute >> AC >> 141 Spring, 2009 Description: Tess Levitan AC 141-204 Obituary April 15, 2009 Hugh Hefner, Playboy Founder, Dead at 83 LAS VEGAS, Nev. April 10-Hugh Hefner, who not only founded and published the Playboy magazine empire but also changed the sexual thinking of America, died Thu... Date Added: 2009-06-25 09:06:15 |
| unitcircle Path: Texas A&M >> MATH >> 151 Spring, 2009 Description: ... Date Added: 2009-06-25 10:34:53 |
| Intro.pdf Path: Utah State >> CS >> 7680 Fall, 2008 Description: What is Computer Vision? Deals with the development of the theoretical and algorithmic basis by which useful information about the 3D world can be automatically extracted and analyzed from a single or multiple 2D images of the world. That is: 2D Ima... Date Added: 2009-06-25 18:24:19 |
| Tracking.W4.pdf Path: Utah State >> CS >> 7680 Fall, 2008 Description: Summary of the W4 System W4 is a real time visual surveillance system for detecting and tracking multiple people and monitoring their activities in an outdoor environment. It operates on monocular gray-scale video imagery, or on video imagery from ... Date Added: 2009-06-25 18:24:20 |
| YIL003W.t2k.w0.5-logo.pdf Path: UCSC >> YIL >> 003 Fall, 2009 Description: YIL003W.t2k w0.5 4 3 2 1 R L K F G G 1 10 20 30 40 H 4 3 2 1 H T E S S H T E LIS V VLG N A A I I A E L NVQ A T S D XXXXXXXXXXXXX A G 51 60 70 80 90 T 4 3 2 1 P S H T H T H T E XXXXXXX N A L G D S D P L G X L L L... Date Added: 2009-06-25 18:29:31 |
| YIL066C.t2k.dssp-ebghstl-logo.pdf Path: UCSC >> YIL >> 066 Fall, 2009 Description: YIL066C.t2k EBGHSTL 3 2 1 TS EE CHHHHHHHHHHHH T C T C X X 1 10 20 30 40 E 3 2 1 E T T S E H T T H T CCHHHH S E G G G S C C C C X X X X X X X X 51 60 70 80 90 H 3 2 1 C T T S H H HHHHHH 101 H H H HH T T T H C C T G G T C T ... Date Added: 2009-06-25 18:29:35 |
| YIL063C.t2k.dssp-ebghstl-logo.pdf Path: UCSC >> YIL >> 063 Fall, 2009 Description: YIL063C.t2k EBGHSTL 3 2 1 CC X C T S T S T SSSS S E S E C S S S T S C E T S T S T T E S E T T T S S S S S S S S S S H ESSTSGGTEEEEEEETSXXTTEEETTTE E H B H E B E H T H T XXXXXXXXXXXXX XXXXXXXXXXXXXXXX X X X X X XXXXXXXXX CCCCCC SS S CTTCC TCCS C ... Date Added: 2009-06-25 18:29:54 |
| IAT201_Week8.pdf Path: Sveriges lantbruksuniversitet >> IAT >> 201 Fall, 2009 Description: Overview Prototyping IAT 201 Week 8 Lyn Bartram Prototyping and construction Conceptual design Physical design Generating prototypes Tool support This slide adapted from www-id-book.com 2007 Prototyping and construction What is a prototype... Date Added: 2009-06-25 18:31:58 |
| Homework_01.pdf Path: Berkeley >> ME >> 234 Fall, 2008 Description: ME 234 Issued: January 20, 2005 1 Review of the Nyquist Theorem. Assignment # 1 Due: January 28, 2005 (a) Look up any undergraduate text on Control Systems, and clearly reproduce the statement of the Nyquist Theorem. Review what is meant by gain an... Date Added: 2009-06-25 18:32:56 |
| test3soln.pdf Path: Maine >> MATH >> 141 Fall, 2009 Description: TEST #3 Math 141 Name: Problem Possible Score Your Score 1 20 2 40 3 20 4 25 5 50 6 45 Total 200 SHOW ALL WORK. Any solution that is not accompanied by the appropriate work necessary for solving the problem will receive no credit. DO NOT use... Date Added: 2009-06-25 18:38:24 |
| navidad-rodrigo.pdf Path: New Mexico >> CS >> 460 Spring, 2008 Description: JonathanNavidadRodrigo CS460SoftwareEngineering Assignment#2:Proposal JonathanNavidadRodrigo JonathanNavidadRodrigo CS460:SoftwareEngineering Assignment2:Final February18,2008 CoverSheet Theworldischangingveryfast,sofastthatwecannotevennoticethech... Date Added: 2009-06-25 18:41:05 |
| homework2.doc Path: CUNY Baruch >> G >> 5501 Fall, 2009 Description: City College of New York And Graduate Center of City University of New York G5501 Introduction to ROBOTICS Homework #2 Due: Sep. 23, 2008 Given the Stanford arm as following figure, where d2=0.1m Problem 1: Find the link parameters for the arm. (Not... Date Added: 2009-06-25 18:42:58 |
| 4-motion-models.ppt Path: CUNY Baruch >> G >> 3300 Fall, 2009 Description: ProbabilisticRobotics ProbabilisticMotionModels RobotMotion Robotmotionisinherentlyuncertain. Howcanwemodelthisuncertainty? 2 DynamicBayesianNetworkfor Controls,States,andSensations 3 ProbabilisticMotionModels ToimplementtheBayesFilter,... Date Added: 2009-06-25 18:43:00 |
| drawepipolar.m.txt Path: Mines >> EGGN >> 512 Fall, 2009 Description: % Draw epipolar lines, from the essential matrix. clear all close all I1 = imread(\'I1.tif\'); I2 = imread(\'I2.tif\'); Mint = [ % Intrinsic camera parameters 300 0 150; 0 300 150; 0 0 1 ]; load E % Image point... Date Added: 2009-06-25 18:44:33 |
| eigenspace_learn.m.txt Path: Mines >> EGGN >> 512 Fall, 2009 Description: clear all close all % Load images load kleindata load superquaddata n1 = size(kleinImages,3); % Number of Klein bottle images N = size(kleinImages,1); % Size of images (assume square) X1 = []; for i=1:n1 I = double(kleinImages(:,... Date Added: 2009-06-25 18:44:34 |
| l7-funpgmg3.pdf Path: Rutgers >> CS >> 314 Fall, 2002 Description: Functional Programming read-eval-print loop of Lisp interpreter Lexical scoping and Closures Currying Extensible symbolic derivative CS314 Spring 2001 L Steinberg 1 Review Recursion tail call, tail recursion accumulator recursion recursion... Date Added: 2009-06-25 18:46:00 |
| assignment3.ps Path: Cornell >> CS >> 211 Fall, 2008 Description: %!PS-Adobe-2.0 %Creator: dvips 5.55 Copyright 1986, 1994 Radical Eye Software %Title: assignment3.dvi %CreationDate: Wed Feb 19 13:50:42 1997 %Pages: 5 %PageOrder: Ascend %BoundingBox: 0 0 612 792 %EndComments %DVIPSCommandLine: dvips assignment3.dvi... Date Added: 2009-06-25 18:46:18 |
| p24_043.pdf Path: St. Michael >> CH >> 212 Fall, 2009 Description: 43. At all points where there is an electric eld, it is radially outward. For each part of the problem, use a Gaussian surface in the form of a sphere that is concentric with the sphere of charge and passes through the point where the electric eld is... Date Added: 2009-06-25 18:47:46 |
| Project Jobs.ppt Path: Citadel >> YUILLS >> 42101 Fall, 2009 Description: Project Jobs Technical Jobs Mechanical Electrical Electronic Software Managerial Jobs Team leader Schedule Finance & purchasing Configuration control ... Date Added: 2009-06-25 18:54:57 |
| a_3_1.doc Path: Texas El Paso >> ACCOUNTING >> 3321 Fall, 2009 Description: Initial Staff In-Charge Date (Insert Firm Name) Student Accounting Firm To the Board of Directors (Insert client company name) (Insert City, State, Zip Code) This letter is to confirm our understanding of the terms and objectives of our engagement... Date Added: 2009-06-25 18:56:26 |
| education_mobility_obstacles_gp_COM_96_462.pdf Path: Pittsburgh >> AEI >> 1226 Fall, 2009 Description: * * . COMMISSION OF THE EUROPEAN COMMUNITIES Brussels, 02.10. 1996 COM(96) 462 . final Education . Training Research The obstacles to transnational mobility Green Paper (presented by the Commission) TABLE OF CONTENTS SUMMARY PART A: TRANSNAT... Date Added: 2009-06-25 19:07:29 |
| 9.pdf Path: Delaware >> CIS >> 475 Fall, 2009 Description: CISC 475/675: Advanced Software Engineering Day 9: Design: Modules Stephen F. Siegel Department of Computer and Information Sciences University of Delaware 10 March 2009 Stephen F. Siegel CISC 475/675 Spring 2009 1 What is Design? In general, ... Date Added: 2009-06-25 19:07:34 |
| ACFAS_04_BASES_DE_DONNEES.ppt Path: Université du Québec à Montréal >> R >> 17165 Fall, 2009 Description: Analyse des patrons de rponses inappropris dans les bases de donnes pour la recherche en sciences humaines et sociales Gilles Rache, UQAM Jean-Guy Blais, Universit de Montral 72e congrs de lAcfas, Montral, mai 2004 La nature des rsultats obtenus au... Date Added: 2009-06-25 19:09:45 |
| 003319_1.pdf Path: Pittsburgh >> AEI >> 6184 Fall, 2009 Description: ... Date Added: 2009-06-25 19:09:55 |
| 2mass_radec.txt Path: Berkeley >> ASTRO >> 00201487 Fall, 2009 Description: #ra dec hmag dhmag 066.611279 -11.092456 16.830 0.135 066.618854 -11.077738 16.945 0.150 066.616354 -11.091815 13.979 0.026 066.615478 -11.087923 17.097 0.164 066.595616 -11.078407 17.017 0.161 066.603038 -11.074293 15.413 0.032 066.575302 -11.079239... Date Added: 2009-06-25 19:13:46 |
| ep_nflu.txt Path: Berkeley >> ASTRO >> 00201487 Fall, 2009 Description: # Ep lNiso 269.675 5.507 286.528 5.498 321.314 5.632 332.547 5.620 337.546 5.596 347.320 5.579 352.616 5.674 356.919 5.615 362.944 5.607 363.165 5.608 367.127 5.645 373.484 5.631 375.623 5.682 380.037 5.664 384.240 5.646 385.729 5.613 392.190 5.660 3... Date Added: 2009-06-25 19:13:49 |
| hw4.pdf Path: Rutgers >> CS >> 492 Fall, 2009 Description: CS 492 Homework Assignment 4 Given: October 25, 2004 Due: November 08, 2004 This assignment is due in class on the due date. The point value of each problem is shown in [ ]. Each solution must be the students own work. Assistance should be sought or... Date Added: 2009-06-25 19:13:55 |
| l10.ps Path: Rutgers >> CS >> 171 Fall, 2009 Description: %!PS-Adobe-2.0 %Creator: dvips(k) 5.95a Copyright 2005 Radical Eye Software %Title: l10.dvi %Pages: 5 %PageOrder: Ascend %BoundingBox: 0 0 612 792 %DocumentFonts: CMBX12 CMR10 CMTI10 CMBX10 CMMI10 CMR8 CMMI8 CMEX10 %+ CMSY10 CMSL10 CMCSC10 %DocumentP... Date Added: 2009-06-25 19:14:02 |
| l19.ps Path: Rutgers >> CS >> 171 Fall, 2009 Description: %!PS-Adobe-2.0 %Creator: dvips(k) 5.95a Copyright 2005 Radical Eye Software %Title: l19.dvi %Pages: 3 %PageOrder: Ascend %BoundingBox: 0 0 612 792 %DocumentFonts: CMBX12 CMR10 CMTI10 CMMI10 CMR8 CMMI8 CMSY8 CMSY10 %+ CMBX10 CMSL10 %DocumentPaperSizes... Date Added: 2009-06-25 19:14:08 |
| syl.pdf Path: Rutgers >> CS >> 111 Fall, 2009 Description: CS:50:198:111 Introduction to Computer Science Fall 2004 Course Specics: Instructor: Oce: E-mail: Class Time: Rajiv Gandhi 311 Business and Science Building rajivg@camden.rutgers.edu MW 2:50-4:10pm (Section 01) W 6:00-8:40pm (Section 40) Classroom: ... Date Added: 2009-06-25 19:14:24 |
| Kevin 514-assignment10.doc Path: CSU Northridge >> KJD >> 83240 Fall, 2009 Description: Name: June 16, 20053:56 A6/P6 (1) Making projections: A spreadsheet program stores and calculates information in a structured array of data cells. By defining relationships between information in cells, a user can see the effects of data changes on ... Date Added: 2009-06-25 19:15:40 |
| wa4.pdf Path: Drexel >> MATH >> 201 Fall, 2009 Description: WA4 4 1. Let P () = 100 0 2 0 0 0 3 000 an invertible ( i) = 4 103 + 352 50 + 24, and let T = 0 0 . Suppose A isa matrix that is similar to T ,i.e. there is 0 4 matirx P such that P 1 AP = T. Show that P (A) = 0, i.e. 0000 0 0 0 0 A4 10A... Date Added: 2009-06-25 19:25:36 |
| flux_nh2_sp2.txt Path: Harvard >> OBS >> 02810 Fall, 2009 Description: srcid fluxSc error_fluxSc ufluxSc error_ufluxSc fluxHc error_fluxHc ufluxHc error_ufluxHc fluxBc error_fluxBc ufluxBc error_ufluxBc fluxBx error_fluxBx ufluxBx error_ufluxBx - -- - - -... Date Added: 2009-06-25 19:30:37 |
| ACE.pdf Path: Kentucky >> BULL >> 0506 Fall, 2009 Description: ACE Agricultural Communications and Education ACE 102 THE DYNAMICS OF RURAL SOCIAL LIFE. (3) Introduces major concepts of sociology by exploring social, political and cultural issues confronting rural society and American agriculture, such as: popula... Date Added: 2009-06-25 19:31:56 |
| h4.pdf Path: Kentucky >> MA >> 625 Fall, 2008 Description: MA625-001 Numerical Methods for Dierential Equations HW #4: Due Thu 4/2, 2001 The HW is concerned with second-order methods (in time) for the heat equation: (a) ut u = f, (x, t) J, (b) u = g, (x, t) J, (1) (c) u = u0 , x , t = 0, where is a... Date Added: 2009-06-25 19:33:19 |
| InClassProblems3.doc Path: George Mason >> CEIE >> 301 Fall, 2008 Description: CEIE 301: Engineering and Economic Principles Probability Distributions, Queuing Theory & Simulation In-Class Problems 3 1. (Binomial Distribution) A police officer observed that only one out of five motor-drivers violating speed limits is apprehend... Date Added: 2009-06-25 19:35:09 |
| Resume.pdf Path: RIT >> JBS >> 5332 Fall, 2009 Description: Josh Shagam josh.shagam@gmail.com 609-923-5714 4 Sawmill Court, Medford, New Jersey 08055 Objective A cooperative education position that will provide practical work experience in the field of Biomedical Photography between the months of June and Au... Date Added: 2009-06-25 19:36:00 |
| lecture1.ppt Path: UCSD >> CSE >> 291 Fall, 2001 Description: CSE 291 Winter 2009 The FPGA Ecosystem Rajesh Gupta University of California, San Diego Moores Law Transistors on lead microprocessors double every 2 years Transistors on lead microprocessors double every 2 years 1000 100 Transistors (MT) 10 1 0.1... Date Added: 2009-06-25 19:36:28 |
| security.pdf Path: San Jose State >> CMPE >> 296 Fall, 2009 Description: Web Security Instructor: Dr. Jerry Gao San Jose State University email: jerrygao@email.sjsu.edu URL: http:/www.engr.sjsu.edu/gaojerry Copyright@ Jerry Gao, Ph.D Topic: Web Security Web Security - Introduction Web Security - Why Do We Concern abou... Date Added: 2009-06-25 19:37:30 |
| CMNS 428, MA 17 Meetings.doc Path: Sveriges lantbruksuniversitet >> CMNS >> 428 Fall, 2009 Description: CMNS 428 Final Project Meetings, March 17, 2008 Meeting Times Time 9:10 9:30 9:30 - 9:50 9:50 10:10 10:10 10:30 10:30 10:50 10:50 11:10 11:10 11:30 11:30 11:50 11:50 12:10 12:10 12:30 12:30 12:50 12:50 1:10 1:10 1:30 1:30 1:50 1:50 2:1... Date Added: 2009-06-25 19:38:43 |
| cmns 488.ppt Path: Sveriges lantbruksuniversitet >> CMNS >> 488 Fall, 2009 Description: Art Worlds and Social Types By Howard S. Becker Art Worlds Result of coordinated activities Coordination of activities are in reference to a body of conventional understandings Do not define art first Mutual appreciation and social value Types ... Date Added: 2009-06-25 19:39:22 |
| Lena_SamplesinRapMusic.pdf Path: Sveriges lantbruksuniversitet >> CMNS >> 488 Fall, 2009 Description: Poetics 32 (2004) 297310 Meaning and membership: samples in rap music, 19791995 Jennifer C. Lena Department of Sociology, Vanderbilt University, Nashville, TN 37235, USA Abstract This paper uses art works as the units of analysis to examine the con... Date Added: 2009-06-25 19:39:27 |
| CliffordOnCollectingArtandCulture.pdf Path: Sveriges lantbruksuniversitet >> CMNS >> 488 Fall, 2009 Description: ... Date Added: 2009-06-25 19:39:53 |
| liu_cmns428_a1_revised.doc Path: Sveriges lantbruksuniversitet >> CMNS >> 428 Fall, 2009 Description: CMNS 428 Media and Education Media Design Project I: Culture Jam (revised) Jennifer Liu 301001181 CMNS 428 D100 Instructor: Stuart Poyntz TA: Chris Jeschelnik Media Design Project I The images The Death-Starbucks, Skinny Latte, and Every Step of... Date Added: 2009-06-25 19:40:35 |
| currie.ps Path: Michigan >> PERSONAL >> 521 Fall, 2009 Description: %!PS-Adobe-2.0 %Creator: dvips 5.55 Copyright 1986, 1994 Radical Eye Software %Title: currie.dvi %CreationDate: Mon Feb 10 08:12:30 1997 %Pages: 1 %PageOrder: Ascend %BoundingBox: 0 0 612 792 %EndComments %DVIPSCommandLine: /usr/um/tex-3.141/bin/dvip... Date Added: 2009-06-25 19:41:45 |
| p275-Intro.doc Path: Maryland >> P >> 275 Fall, 2009 Description: PHYSICS275 LaboratoryManual sonic ranger reflector glider bumper m step block table airtrack air s upply DepartmentofPhysics UniversityofMaryland CollegePark,MD20742 revised August 2001 Published and Printed by the Department of Physics Universit... Date Added: 2009-06-25 19:42:59 |
| semaine4.pdf Path: Neumont >> IFT >> 6141 Fall, 2009 Description: Au menu cette semaine Les rseaux de neurones (Chap. 6 suite) Paramtres pour la rtropropagation Rseau convolution Cascade et lagage Rseaux rcurrents Elman Hopfield Mthodes stochastiques (Chap. 7 dbut) Apprentissage et rseau de Boltzmann Recu... Date Added: 2009-06-25 19:43:28 |
| WTPSCI702.ppt Path: George Mason >> PSCI >> 702 Fall, 2008 Description: Wavelet Transform PSCI 702 December 7, 2005 Problem with Fourier Fourier analysis - breaks down a signal into constituent sinusoids of different frequencies. A serious drawback in transforming to the frequency domain, time information is lost. W... Date Added: 2009-06-25 19:43:47 |
| rotation2005.pdf Path: ASU >> PUBLIC >> 122 Fall, 2009 Description: PHY 122 LAB : Rotational Motion Introduction: In this lab we will see how a constant torque creates a constant angular acceleration for a rigid body rotating about its CM. Well see that the moment of inertia depends on the rotation axis for a given o... Date Added: 2009-06-25 19:45:49 |
| 26144.txt Path: UNC >> DOCS >> 26144 Fall, 2009 Description: The Project Gutenberg EBook of The Unicorn from the Stars and Other Plays, by William B. Yeats and Lady Gregory This eBook is for the use of anyone anywhere at no cost and with almost no restrictions whatsoever. You may copy it, give it away or re-... Date Added: 2009-06-25 19:49:09 |
|
|
Get Started With Course Hero Today!
Get study guides, join study groups, and more!
Sign up in seconds with your Facebook account!
Course Hero is a Facebook Application Partner.
Click below to sign-up for FREE.
Our Social Learning Network was built to provide students and key learning partners like professors a platform to share, meet and collaborate while accelerating their comprehension of course-related theories and concepts. We are committed to providing you immediate access to a growing wealth of study materials and an unparalleled academic network of students, professors and other key partners. Why do you care? Because you want the best grade possible and at times need a 24/7 resource that’s responsive to your needs. |
|
What People Are Saying About Course Hero
|
|||
|
|||
|
Explore the benefits of joining Course Hero's social learning network.
|
|||
 |
Get millions of study materials now!Need lecture notes for a missed class or want insightful explanation of the theories and concepts you learn in class? Look no further, Course Hero’s Study Materials empowers you to find a broad and deep set of materials that can help you right now!
Click below to sign-up for FREE.
|
||
 |
Get over 200,000 textbook solutions now!Having difficulty with your homework and need documents that are relevant for your Textbook? Don't be frustrated. Course Hero's Textbook Help presents you study materials from many college courses.
Click below to sign-up for FREE.
|
||
 |
Meet over 300,000 students and your fellow classmates now!Want to meet your current classmates or those that took the class last year? Don’t worry or have anxiety. Course Hero’s Study Groups gives you the seamless opportunity to develop both anonymous or direct relationships with those classmates whom you want to meet and get help from right now!
Click below to sign-up for FREE.
|
||
