Course Solutions And Notes - BatchHTWH_old 49

Displaying 17001-17500 of 21725 documents:
next page of documents

mm545072220.072106.txt
Path: Harvard >> MM >> 545 Fall, 2009
Description: time[min] xsec[km] xsec[nmi] x1.1st y1.1st x2.1st y2.1st xsec2[nmi] ctr.x ctr.y dpease[nmi] djeffco[nmi] dbangor[nmi] arpt1.1st arpt2.1st arpt1.2nd arpt2.2nd 0 197.974 106.844 -65.414 43.02 -66.826 44.48 15.324 -66.12 43.75 2...
Date Added: 2009-06-07 11:04:16

110A-03.pdf
Path: UCSD >> PHYSICS >> 110 Fall, 1999
Description: Chapter 3 Two-Dimensional Phase Flows We\'ve seen how, for one-dimensional dynamical systems u = f (u), the possibilities in terms of the behavior of the system are in fact quite limited. Starting from an arbitrary initial condition u(0), the phase ...
Date Added: 2009-06-07 11:04:34

LC.pdf
Path: NYU >> LC >> 488 Fall, 2009
Description: Lillian Chen Personal History Educational History Current Address: 400 Broome Street #908, New York, NY 10013 Phone: (917) 620-0571, E-mail: LC488@nyu.edu Fall 2003 University of Michigan Ann Arbor, MI - PhD student, Department of Psychology, concen...
Date Added: 2009-06-07 11:04:41

mm545052613.052418.txt
Path: Harvard >> MM >> 545 Fall, 2009
Description: time[min] xsec[km] xsec[nmi] x1.1st y1.1st x2.1st y2.1st xsec2[nmi] ctr.x ctr.y dpease[nmi] djeffco[nmi] dbangor[nmi] arpt1.1st arpt2.1st arpt1.2nd arpt2.2nd 0 196.754 106.186 -68.175 45.987 -66.025 46.957 19.367 -67.1 46.472 2...
Date Added: 2009-06-07 11:04:43

figure-16.8.pdf
Path: Purdue >> CS >> 250 Fall, 2008
Description: Operation setup input output terminate flush Meaning Initialize the buffer Perform an input operation Perform an output operation Discontinue use of the buffer Force contents of buffer to be written Figure 16.8 The conceptual operations provided by...
Date Added: 2009-06-07 11:06:18

figure-8.2.pdf
Path: Purdue >> CS >> 250 Fall, 2008
Description: if (condition) { then_part } else { else_part } next statement code to test condition and set condition code branch not true to label1 code to perform then_part branch to label2 label1: code for else_part label2: code for next statement (b) (a) Fi...
Date Added: 2009-06-07 11:06:26

WebDBXML.ppt
Path: Washington >> MODULE >> 541 Fall, 2009
Description: Advanced Technologies Web database integration XML Internet 2 and the push for faster and faster connections in the home Dynamic Content With the exception of some CGI examples, most of what we have created so far are \"static\" web pages...
Date Added: 2009-06-07 11:08:01

code.ps
Path: Duke >> CPS >> 100 Fall, 2009
Description: %!PS-Adobe-3.0 %Title: IUniqueCounter.java, SetUniqueCounter.java, SlowUniqueCounter.java, SortingUniqueCounter.java, UniqueDemo.java, UniqueTester.java, UniqueTimer.java %For: Owen L. Astrachan %Creator: a2ps version 4.13 %CreationDate: Tue Aug 29 1...
Date Added: 2009-06-07 11:08:40

out.ps
Path: Duke >> CPS >> 100 Fall, 2009
Description: %!PS-Adobe-3.0 %Title: CellMenu.java, Interpreter.java, SheetCell.java, SpreadSheet.java, SpreadSheetModel.java %For: Owen L. Astrachan %Creator: a2ps version 4.13 %CreationDate: Thu Jul 6 10:01:10 2006 %BoundingBox: 24 24 588 768 %DocumentData: Clea...
Date Added: 2009-06-07 11:08:55

InitiateART_Lancet_2009.pdf
Path: UCLA >> EPI >> 227 Fall, 2009
Description: Articles Timing of initiation of antiretroviral therapy in AIDS-free HIV-1-infected patients: a collaborative analysis of 18 HIV cohort studies When To Start Consortium* Summary Lancet 2009; 373: 135263 Published Online April 9, 2009 DOI:10.1016/S0...
Date Added: 2009-06-07 11:12:15

strngtwoup.pdf
Path: Idaho >> CS >> 113 Fall, 2009
Description: ...
Date Added: 2009-06-07 11:12:25

trips_isa.pdf
Path: Texas >> CS >> 310 Fall, 2008
Description: Microprocessor Challenges ! Well \"Single threaded performance, communication, concurrency, power efficiency, agility known challenges ! Hypothesis: \"ISA: Revisiting HW/SW boundary could address these challenges Statically encode data dependence ...
Date Added: 2009-06-07 11:14:16

L19.pdf
Path: Purdue >> PSY >> 310 Fall, 2008
Description: Prof. Greg Francis Constancy PSY 310 Greg Francis Brightness illusions Most people think of visual perception as a measurement of light As it reflects off of objects Lecture 19 It\'s all an illusion! Purdue University Purdue University Object ...
Date Added: 2009-06-07 11:15:21

PMFT.pdf
Path: Messiah >> HDFS >> 0910 Fall, 2009
Description: Pre-Marriage and Family Therapy Minor (18 credits) - Department of Human Development and Family Science [HDFS 101] Foundations of Marriage and Family (3) [HDFS 142] Introduction to Interpersonal Relations (3) [HDFS 339] Dynamics of Family Interaction...
Date Added: 2009-06-07 11:15:43

Spring08_Midterm3.pdf
Path: UGA >> MSIT >> 3000 Fall, 2008
Description: 1. Which of the following scatter diagrams is mismatched with a correlation coefficient? a) r = 0.7 9 8 7 6 5 4 3 2 1 0 0 2 4 6 8 10 12 b) r = -0.75 9 8 7 6 5 4 3 2 1 0 0 1 2 3 4 5 6 7 8 9 10 11 c) r=1 9 8 7 6 5 4 3 2 1 0 0 2 4 6 8 10 d) r = -0...
Date Added: 2009-06-07 11:17:17

M201-L39.ppt
Path: Salisbury >> FACULTY >> 201 Fall, 2009
Description: DIFFERENTIAL EQ & IVP EXAMPLES OF DIFFERENTIAL EQNS A SIMPLE DIFFERENTIAL EQUATION A MORE COMPLICATED DIFF EQN CHECK A SOLUTION FIND THE CONSTANT OF ANTIDIFF\'N 9.1 [0] DIFFERENTIAL EQUATIONS dP = kP dt dP P = k P - 1 dt C d 2x m = -k x dt y ...
Date Added: 2009-06-07 11:18:46

Mod15-Turfgrass_Insecticides_and_Their_Useoutline.ppt
Path: Minnesota >> CRK >> 3074 Fall, 2009
Description: Turfgrass Insecticides and Their Use Modes of Action Axonic poisons_ _ _ To understand axons, and axonic poisons it is essential to know what neurons are Modes of Action Neurons _ _ _ Neurons carry impulses to stimulate muscles and glands (mo...
Date Added: 2009-06-07 11:20:41

probset1.doc
Path: VMI >> MA >> 105 Fall, 2009
Description: MA 105 Probability and Statisitics Problem Set #1 1. Ten cadets took the first test. The other 10 were absent for the text. The grades were as follows: 80, 70, 90, 60, 80, 100, 90, 90, 50, 70 a) b) c) d) e) f) Does this data constitute a population ...
Date Added: 2009-06-07 11:21:56

T0499.pdb_blast.txt
Path: UCSC >> T >> 0499 Fall, 2009
Description: # BLASTP 2.2.6 [Apr-09-2003] # Query: T0499 # Database: /projects/compbio/data/pdb/dunbrack-pdbaa # Fields: Query id, Subject id, % identity, alignment length, mismatches, gap openings, q. start, q. end, s. start, s. end, e-value, bit score T0499 2i...
Date Added: 2009-06-07 11:23:49

chap7.ppt
Path: MS Women >> ED >> 497 Fall, 2008
Description: Teachers Discovering Computers Integrating Technology and Digital Media in the Classroom 4th Edition Chapter 7 Evaluating Educational Technology and Integration Strategies Chapter Objectives Identify sources of information for evaluating technolo...
Date Added: 2009-06-07 11:24:58

milestone4_complete.doc
Path: Messiah >> CSC >> 33304 Fall, 2009
Description: Milestone Completion Summary for CSC333 (Spring, 2003) Milestone Number: 4 Team Name: Food Bank Team Members (and Roles, including leader): Arch Jamieson Physical Database creator Eddie Bond Visual Basic code creator, Milestone Leader Josh Berkey ...
Date Added: 2009-06-07 11:25:56

Syllabus.doc
Path: Washington >> CHIN >> 103 Spring, 2008
Description: Chinese 103, Spring 2009 Department of Asian Languages and Literature University of Washington Teaching Staff: Coordinator: Yu Liping / Y^ Losh Teaching Assistants: Jung-Im Chang/ Zhng Losh Sun-mi Kim/ Jn Losh Chia-ying Shih/ Sh losh Ying Tang/Tng lo...
Date Added: 2009-06-07 11:28:57

goettler_equilibrium_dynamic_limit_order_(2006,JF).pdf
Path: Rutgers >> ECON >> 514 Fall, 2009
Description: THE JOURNAL OF FINANCE VOL. LX, NO. 5 OCTOBER 2005 Equilibrium in a Dynamic Limit Order Market RONALD L. GOETTLER, CHRISTINE A. PARLOUR, and UDAY RAJAN ABSTRACT We model a dynamic limit order market as a stochastic sequential game with rational t...
Date Added: 2009-06-07 11:30:42

amicus_respondenta.doc
Path: Norwich >> PO >> 324 Fall, 2009
Description: No: 02-1624 In THE SUPREME COURT OF THE UNITED STATES Elk Grove Unified School District, Petitioner v. Newdow, Michael A., et al, Respondents 28 March 2004 On Writ of Certiorari to the United States Court of Appeals for the Ninth Circuit. BRIEF AMIC...
Date Added: 2009-06-07 11:31:14

week14sol.pdf
Path: Rutgers >> PHYSICS >> 204 Fall, 2009
Description: Physics 204: Homework Solution #14, Chapter 32, Problems: 3, 12, 20, 34, 47 May 7, 2008 Note: This document contains material copyrighted by John Wiley and Sons. 3. A film badge worn by a radiologist indicates that she has received an absorbed dos...
Date Added: 2009-06-07 11:31:47

PPGIS_RESOURCES_final.doc
Path: Washington >> GEOG >> 520 Winter, 2008
Description: JointWUN/UCGIS/QMRGofRGSseminarseries2007 JointWorldwideUniversities Network/UCGIS/RGS(with IBG)QuantitativeMethods ResearchGroup PublicParticipation Geographical InformationSystems Aprogrammeofsixexpertled eseminars, Autumn/Fallterm/semester 200...
Date Added: 2009-06-07 11:33:17

comp30.pdf
Path: San Diego State >> ART >> 448 Spring, 2008
Description: x x x 1. 2. 3. 4. x x x x x x x x x x x x x x x x x x x x x x 241_Graphic Design I : Spring 2009 : Tim Garcia ...
Date Added: 2009-06-07 11:34:06

43.doc
Path: Wisc Platteville >> CE >> 334 Fall, 2009
Description: Lesson #43: May 8, 2009 LESSON OBJECTIVES 1. Model the plume exiting a stack. HOMEWORK #43 1. Sadly, none. ...
Date Added: 2009-06-07 11:34:33

EM12b.pdf
Path: Evergreen >> HW >> 0607 Fall, 2009
Description: EM HW 8b Thus. 24 May 2007 Griffiths Ch.12 # 41, 43, 44 ...
Date Added: 2009-06-07 11:35:07

EE119_Sp08_OutcomesList.pdf
Path: Berkeley >> EE >> 119 Fall, 2009
Description: EE119_Sp\'08 Outcomes List T. K. Gustafson Expected Outcomes for EE119: Introduction to Optical Engineering 1) 2) 3) 4) 5) 6) 7) 8) 9) Basic knowledge of the laws governing optical propagation and the influence of boundaries and finite transverse ext...
Date Added: 2009-06-07 11:35:41

soln.txt
Path: Berkeley >> CS >> 170 Fall, 2006
Description: 1. Yes, it does. It implies that P != NP, which in turn implies that no NP-complete problem has a polynomial-time algorithm. For instance, there is no polynomial-time algorithm for 3-coloring (or 3SAT, or the Travelling Salesman Problem, or .). 2....
Date Added: 2009-06-07 11:35:52

IMCprojectphaseII.08.doc
Path: Mitchell >> BU >> 413 Fall, 2009
Description: BU413 Suggested outline for IMC plan/program Fall 2008 Current Situation/Background What kind of business is it? Review the current situation for the business specifically and the market it operates in overall. Key or Critical Issues Discuss as...
Date Added: 2009-06-07 11:36:56

WordTemplate.doc
Path: Southern Oregon >> ECE >> 5273 Fall, 2009
Description: AUTHOR GUIDELINES FOR ICIP 2008 PROCEEDINGS AUTHORS Author(s) Name(s) Author Affiliation(s) ABSTRACT The abstract should appear at the top of the left-hand column of text, about 0.5 inch (12 mm) below the title area and no more than 3.125 inches (80 ...
Date Added: 2009-06-07 11:38:50

GroupProject.doc
Path: MSOE >> GE >> 703 Fall, 2009
Description: <?xml version=\"1.0\" encoding=\"UTF-8\"?> <Error><Code>NoSuchKey</Code><Message>The specified key does not exist.</Message><Key>499e22dc6985fd8b0dda57693e8cc5cbcb16ecd5.doc</Key><RequestId>A 84441E3588794B4</RequestId><HostId>LmOT1EHSaEN71iqIf/8EMpKyhhq...
Date Added: 2009-06-07 11:39:06

CS161_08_RevisedExpandedDescription.doc
Path: Berkeley >> CS >> 161 Fall, 2008
Description: 1. Number and title of course: CS 161, Computer Security 2. Catalog description: (4 units) This course will cover the most important features of computer security, including topics such as communication security, operating systems security, database ...
Date Added: 2009-06-07 11:39:38

L12_f08.pdf
Path: Berkeley >> EE >> 247 Fall, 2009
Description: EE247 Lecture 12 Administrative issues Midterm exam Thurs. Oct. 23rd o You can only bring one 8x11 paper with your own written notes (please do not photocopy) o No books, class notes or any other kind of handouts/notes, calculators, computers, PDA, ...
Date Added: 2009-06-07 11:40:29

words2.txt
Path: Wisconsin Milwaukee >> LIB >> 788 Fall, 2009
Description: \"pilot 42405,47738,860,8978 ^\\he 13517,12922,1474,12072 a 34669,42925,1023,1268 a 57419,45362,1023,1394 a 16865,43109,1003,1268 a 30028,13188,1003,1293 a 34010,32091,983,1268 a 22851,5406,1372,1851 a 25995,29490,1003,1268 a 9536,21585,1023,1318 a 263...
Date Added: 2009-06-07 11:40:31

Test21010.doc
Path: E. Kentucky >> ECO >> 230 Summer, 2008
Description: Eco 230 Bob Houston Spring 2009 1010am TEST #2 (100pts) NAME: _KEY_ True/False (3pts each): Assign the best possible answer. 1. _t_ Marginal Cost will always increase when Marginal Product is decreasing. 2. _t_ Firms will always lower their average ...
Date Added: 2009-06-07 11:41:53

test3.txt
Path: Denison >> PERSONAL >> 272 Fall, 2009
Description: 12 (x1 v -x2 v x4) ^ (x2 v x3 v -x1) ^ (x3 v -x1 v -x4) ^ (x2 v -x5 v -x7) ^ (x6 v -x8 v x12) ^ (x10 v -x11 v x9) ^ (x9 v x4 v x1) ^ (x5 v -x3 v x11) ^ (-x12 v x8 v x4 ) ^ (x2 v x6 v x11) ^ (x3 v x4 v x10)...
Date Added: 2009-06-07 11:42:20

proj4.pdf
Path: Denison >> PROJ >> 375 Fall, 2009
Description: Computer Science 375 Project 4 Due Monday, April 4 For this project, you will implement an IMAP client that adheres to the IETF proposed standard (RFC 3501), which is provided with this assignment. The IMAP protocol is used to access electronic mail...
Date Added: 2009-06-07 11:42:48

proj4.pdf
Path: Denison >> PERSONAL >> 375 Fall, 2009
Description: Computer Science 375 Project 4 Due Monday, April 4 For this project, you will implement an IMAP client that adheres to the IETF proposed standard (RFC 3501), which is provided with this assignment. The IMAP protocol is used to access electronic mail...
Date Added: 2009-06-07 11:42:48

P4_.pdf
Path: GCSU >> ECON >> 2100 Fall, 2008
Description: 1. Which of the following is an example of a flow? a) The current amount in your checking account. b) The amount of water in a pool. c) Income earned each week. d) The total amount of capital in the economy. 2. Which of the following is an example of...
Date Added: 2009-06-07 11:43:06

final_s09pm_soln.pdf
Path: Midwestern State University >> FINANCE >> 325 Fall, 2009
Description: 1:25pm Final Exam Solutions Finance 325 May 5, 2009 Name: Exam Instructions: This exam should have 9 pages (including this one) and 12 questions. The point value is given for each problem. The entire exam is worth 100 points. There is a page at t...
Date Added: 2009-06-07 11:45:52

TeacherAct.pdf
Path: Virginia Tech >> MATH >> 4644 Fall, 2008
Description: ...
Date Added: 2009-06-07 11:47:13

ps3answers.pdf
Path: Berkeley >> E >> 136 Fall, 2008
Description: Department of Economics University of California, Berkeley Economics 136 Suggested Solutions to Problem Set #3 Spring, 2000 Prof. Pierce 1. (a) (i) Beginning with the formula: Pt = E ( Pt +1 + d t +1 ) , we can find a formula for Pt+1 by simply 1...
Date Added: 2009-06-07 11:47:26

hw1.pdf
Path: N. Arizona >> CS >> 345 Fall, 2008
Description: CS 345 Assignment 1 Due: Feb 5th by 12:45pm All questions are from the textbook. In case your book hasn\'t arrived yet, I make a copy for you. Figure 2.35 ...
Date Added: 2009-06-07 11:47:41

physiology.pdf
Path: East Los Angeles College >> COM >> 4210 Fall, 2009
Description: COM4210 / COM6450 COMPUTER SPEECH AND HEARING COM4210 / COM6450 COMPUTER SPEECH AND HEARING 1. Overview of the peripheral auditory system The peripheral auditory system consists of the outer, middle and inner ears [1]. It is a complex mechanism...
Date Added: 2009-06-07 11:49:31

C1102E.pdf
Path: Midwestern State University >> EM >> 2778 Fall, 2009
Description: C1102E WASHINGTON STATE 4-H DOG OBEDIENCE PROGRAM PRE-NOVICE TEAM SCORE SHEET SHOW_ DATE_ TEAM NUMBER _ JUDGE_ BREED __ Exercise and Zero Judge\'s Orders Heel Unqualified heeling. On Leash Forward Halt Left turn Right turn About turn Slow, Normal, ...
Date Added: 2009-06-07 11:49:54

m1901sol08.pdf
Path: Allan Hancock College >> MATH >> 1901 Fall, 2009
Description: THE UNIVERSITY OF SYDNEY Math1901 Differential Calculus (Advanced) Semester 1 Tutorial Solutions Week 8 2009 (These preparatory questions should be attempted before the tutorial. Answers are provided at the end of the sheet please check your work.)...
Date Added: 2009-06-07 11:50:08

final_pres.pdf
Path: Berkeley >> EE >> 241 Fall, 2008
Description: High Performance Data Path Design for Portable Applications Steven Lanzisera 9 May 2003 Introduction Motivation Adder Architecture and Baseline Performance Effect of Supply and Body Bias Scaling Comparison to Published Designs Motivation Porta...
Date Added: 2009-06-07 11:50:43

Processor1_lab9_vhdl.pdf
Path: CUNY Baruch >> CSC >> 343 Fall, 2009
Description: Laboratory Exercise 9 A Simple Processor Figure 1 shows a digital system that contains a number of 16-bit registers, a multiplexer, an adder/subtracter unit, a counter, and a control unit. Data is input to this system via the 16-bit DIN input. This d...
Date Added: 2009-06-07 11:50:53

203.06.pdf
Path: Wash. College >> MAT >> 203 Fall, 2009
Description: Maple Worksheet for MAT 203, Lecture #6. Section 10.7 - Graph a space curve and it\'s unit tangent vector at one point. First, load Maple libraries that we will need. (We end each command with a \":\" to suppress the output.) O restart; with(plots): wit...
Date Added: 2009-06-07 11:50:55

Math532ReviewTest2.pdf
Path: Los Angeles Southwest College >> MATH >> 532 Fall, 2009
Description: MATH 532, 736I: R EVIEW I NFORMATION FOR T EST 2 What to Memorize: The proof of Theorem 2 and the proof of Theorem 3: Theorem 2: If A, B, and C are collinear, then there are real numbers x, y, and z not all 0 such that x+y+z =0 and xA + yB + zC = 0....
Date Added: 2009-06-07 11:53:22

ProbSet1_solns.pdf
Path: Washington >> PCC >> 589 Fall, 2009
Description: Homework 1 solutions ATM/OCN/ESS 589, Spring 2009 April 24, 2009 Solutions 1. The fundamental problem here is that he doesnt explicitly distinguish between atmosphere and ground temperature in the rst equation for Fout on page 21: (1) Fout = ATearth...
Date Added: 2009-06-07 11:54:22

c083_g04_sov_data_by_g04_ssprec.txt
Path: Berkeley >> G >> 083 Fall, 2009
Description: +-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+--+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+--+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+ | county | ssprec | TOTREG | DEMREG | REPREG | ...
Date Added: 2009-06-07 11:54:43

rapid-prototyping.PPT
Path: Berkeley >> CS >> 160 Fall, 1931
Description: Rapid Prototyping CS 160, Fall 99 Professor James Landay October 1, 1999 9/29/99 1 Hall of Fame or Shame? Pagesetupfor printinginIE5 9/29/99 2 Hall of Shame Pagesetupfor printinginIE5 Problems codesforheader& footerinformation recognitionov...
Date Added: 2009-06-07 11:55:10

Net Prsent value.doc
Path: NJIT >> CIS >> 390 Fall, 2009
Description: Net Present Value of Major Purchases The net present value method (NPV) of evaluating a major project allows you to consider the time value of money. Essentially, it helps you find the present value in \"today\'s dollars\" of the future net cash flow of...
Date Added: 2009-06-07 11:55:43

T050130-00.pdf
Path: Caltech >> T >> 050130 Fall, 2009
Description: LASER INTERFEROMETER GRAVITATIONAL WAVE OBSERVATORY LIGO Laboratory / LIGO Scientific Collaboration LIGO-T050130-00-R 8/11/2005 Coating Research Whitepaper Gregory Harry, Ed. Distribution of this document: LIGO Science Collaboration This is an ...
Date Added: 2009-06-07 11:57:35

TGH_EmergencyRadiology.pdf
Path: USF >> NR >> 32096 Fall, 2009
Description: EMERGENCY RADIOLOGY Tampa General Hospital Rotation Director: Carlos Martinez, M.D. General Goals: The Emergency Department (ED) rotations, and especially the night float experience, offer the resident the foremost opportunity to exhibit her/his mast...
Date Added: 2009-06-07 11:58:11

P10_SIGMA3_all_1000.pdf
Path: UCSD >> P >> 2500 Fall, 2009
Description: 3 (kg/m3) for P10 149E (1000:1) 11 16 21 26 31 36 41 46 51 56 61 66 71 76 81 86 m 0 36 37 38 39 40 40.5 40.6 40.7 40.8 40.9 41 41.1 41.2 41.25 41.3 41.32 41.34 41.36 41.38 41.4 41.42 41.44 41.46 3500 41.48 41.5 41.51 4500 500 1000 1500 2000 250...
Date Added: 2009-06-07 12:00:44

MRKT_5000.pdf
Path: Webster FL >> OZARKS >> 0809 Spring, 2001
Description: Webster UNIVERSITY Course Term Instructor MRKT 5000: Marketing FALL II, 2008 The School of Business & Technology Course Syllabus Name: Dana C. Randall, MBA Phone: (417) 883-6680 (daytime) Email: randall4842@sbcglobal.net Students examine the chara...
Date Added: 2009-06-07 12:01:07

10-sol.pdf
Path: Sanford-Brown Institute >> CS >> 149 Fall, 2009
Description: CS149 - Homework 10 Solutions 1 Problem 1 1. Hannah likes the wispa bite 2. The person with the hamster likes swimming 3. Jo eats dairy milk 4. Jessica is on the left of Georgina 5. Lucy is the rst on the left 6. The rst person on the right likes s...
Date Added: 2009-06-07 12:01:58

exam1516.pdf
Path: Iowa State >> STAT >> 416 Spring, 2008
Description: Name: _ Statistics 516X Exam1 February 22, 2005 1. Suppose researchers were interested in studying the effects of two diets (A and B) on gene expression in muscle tissue of hogs. Eight pens containing four hogs each were available for an experiment....
Date Added: 2009-06-07 12:05:36

abs_138.pdf
Path: Allan Hancock College >> MDL >> 112 Fall, 2009
Description: Investigations of ion transport in collisional dual rf-biased sheaths and ion energy distributions bombarding a dual rf-biased electrode Zhong-Ling Dai and You-Nian Wang The State Key Laboratory of Materials Modification by Laser, Electron, and Ion ...
Date Added: 2009-06-07 12:05:46

BLBP4D2.doc
Path: Middlebury >> FYSE >> 1144 Fall, 2009
Description: Betsy Byrum November 10, 2006 Mrs. Bertolini Emma Paper The Box Hill Incident: Different Approaches and the Scene\'s Importance When viewing movie adaptations of a novel, it becomes surprising to see how differently scenes from that novel can be edite...
Date Added: 2009-06-07 12:06:45

slides4_4perpage.pdf
Path: Yale >> ECON >> 115 Fall, 2009
Description: A Theory of Consumer Behavior 1. Introduction 2. Consumer Preferences 3. Indifference Curves 4. The Marginal Rate of Substitution 5. Utility 6. Budget Constraints 7. Consumer Choices 8. Revealed Preference 9. Marginal Utility and Consumer Optimizatio...
Date Added: 2009-06-07 12:06:58

FIB_Chapter.pdf
Path: Allan Hancock College >> ABG >> 110 Fall, 2009
Description: Chapter 3 Pore Modeling via Focussed Ion Beam Tomography In the previous chapter, a method has been developed to characterise the microporous regions, features below 2-3 m, and their connectivity in 3 dimensions through X-ray computed tomography. H...
Date Added: 2009-06-07 12:08:18

ps3.pdf
Path: Oakland University >> CHEG >> 355 Fall, 2009
Description: PROBLEM SET 3 CHEG 355 DUE 9/13/05 1). A classic \"Honorable Mention\" on the Darwin Awards website is the saga of \"Lawn Chair Larry\" who decided to go flying by attaching 42 helium filled 113 ft3 weather balloons to his lawn chair (note: some sourc...
Date Added: 2009-06-07 12:08:53

review3.pdf
Path: Oakland University >> EXAM >> 441 Fall, 2009
Description: CE 341/441 - Review 3 - Fall 2004 REVIEW NO. 3 O.D.E. CLASSIFICATION I.V.P.s dy d2y A - + B - + Cy = g ( t ) dt dt 2 y ( 0 ) = yo dy - ( 0 ) = V o dt B.V.P.s dy d2y A - + B - + Cy = g ( x ) dx d x2 y ( 0 ) = yo y ( L ) = yL st Can always decomp...
Date Added: 2009-06-07 12:08:56

HW2F2001.pdf
Path: Maryville MO >> NE >> 409 Fall, 2009
Description: HomeWork Set 2 NE 409 Fall 2001 Due September 13, 2001 Problems: 3.2, 3.6, 3.11, 3.15, 3.19, 3.28, 3.30 Problems: 4.2, 4.4, 4.5, 4.13, 4.19, 4.23, 4.25 ...
Date Added: 2009-06-07 12:22:55

ExtensionTipoftheWeek1707.pdf
Path: Iowa State >> NR >> 47975 Fall, 2009
Description: Extension Tip of the Week January 7, 2007 Safe Snow Removal It never seems to fail. Every winter we have people hospitalized due to issues concerning snow removal. In tight places around the home such as steps, sidewalks and patios, the snow shovel w...
Date Added: 2009-06-07 12:23:26

C02.IntroADTs.pdf
Path: Virginia Tech >> CS >> 2605 Fall, 2008
Description: CS 1704 Intro to Data Structures & Software Eng. Introduction to ADTs Slides 1. 2. 3. 4. 5. 6. 7. 8. 9. 10. 11. 12. 13. 14. 15. 16. 17. 18. 19. 20. 21. 22. 23. 24. 25. 26. 27. 28. 2. Intro ADTs 1 Data Types Data Type 2. Intro ADTs 2 Table of ...
Date Added: 2009-06-07 12:26:59

Physics114C_L18.ppt
Path: Washington >> P >> 114 Fall, 2009
Description: Physics 114C - Mechanics Lecture 18 (Walker: Ch. 8.1-2) Pote ntial Ene rgy Octobe 28, 2008 r John G. Cramer Professor of Physics B451 PAB cramer@phys.washington.edu October 28, 2008 Physics 114C - Lecture 18 1/26 Announcements Hom work Assignm nt 5...
Date Added: 2009-06-07 12:28:39

TransportationPermissionForm.pdf
Path: Iowa State >> NR >> 88674 Fall, 2009
Description: Transportation Permission Form Event Title: _ Event Date: _ Event Location: _ Event Time:_ Participants Name:__ Iowa State University Extension needs Parent or Guardian instructions concerning transportation of your child to events sponsored by the Y...
Date Added: 2009-06-07 12:35:47

BCH405_Course_Descrp_Schedule_Fall_08.pdf
Path: SUNY Buffalo >> BCH >> 405 Fall, 2009
Description: BIOCHEMISTRY 405 SCHEDULE : FALL 2008 DAY Wed Fri Wed Fri Wed Fri Wed Fri Wed Fri Wed Fri Wed Fri Wed Fri Wed Fri Wed Fri Wed Fri Wed Fri Wed Fri W/F Wed Fri DATE 8/27 8/29 9/3 9/5 9/10 9/12 9/17 9/19 9/24 9/26 10/1 10/3 10/8 10/10 10/15 10/17 10/22 ...
Date Added: 2009-06-07 12:39:43

Mexican Labor Unions.doc
Path: Stanford >> E >> 297 Fall, 2009
Description: Mexican Labor Unions and Economic Reforms Over the Past 20 Years Anna Minyard The Ethics of Development in a Global Environment Professor Lusignan June 6, 2003 INTRODUCTION: Since labor unions in Mexico were originally formed in the early 1900s, the...
Date Added: 2009-06-07 12:40:56

Lecture16.doc
Path: Washington >> IS >> 300 Fall, 2009
Description: IS 300 - Lecture 16 How are computers impacting privacy? IS 300 Session 16 page 1 How are computers impacting privacy? Definition: The right to decide what personal information an entity wants to share with others. Privacy Legislation (...
Date Added: 2009-06-07 12:41:27

FED_DCP_F08a_T13_V4.2.pdf
Path: USC >> CSCI >> 577 Fall, 2009
Description: Feasibility Evidence Description (FED) Acme Research Engine for WB Archives Team #13 Team Members John Morse Nikhil Mohan Aditya Auradkar Chinmay Joshi Nishit Chokhawala Kameron Lemmons Roles Project Manager / Requirements Engineer Life Cycle Pla...
Date Added: 2009-06-07 12:42:00

OCD_FCP_F08a_T13_V2.4.pdf
Path: USC >> CSCI >> 577 Fall, 2009
Description: Operational Concept Description (OCD) Version 2.4 Operational Concept Description (OCD) Acme Research Engine for USC WB Archives Team o. 13 Team Members John Morse Nikhil Mohan Aditya Auradkar Chinmay Joshi Nishit Chokhawala Kameron Lemmons Rol...
Date Added: 2009-06-07 12:42:19

SID_FCP_F08a_T13_V2.0.doc
Path: USC >> CSCI >> 577 Fall, 2009
Description: Supporting Information Document (SID) Acme Research Engine for USC WB Archives Team #13 Team Members John Morse Nikhil Mohan Aditya Auradkar Chinmay Joshi Nishit Chokhawala Kameron Lemmons Roles Project Manager / Requirements Engineer Life Cycle ...
Date Added: 2009-06-07 12:42:26

T0235.t2k.alpha-logo.pdf
Path: UCSC >> T >> 0235 Fall, 2009
Description: T0235.t2k alpha 2 1 B XXX H H H B B H H H X X X H X XX HI X HHHHH 360 I B I I I X X X X X XXIIXXXHXIIIISHXH X X X X X X X X X X H HHH HH HH H HHHH H D A B C E E E H E B E B C E E H D E B C G H T I FD I H B S A X S XXXXXXX XXXHIII...
Date Added: 2009-06-07 12:44:11

BST.pdf
Path: UMass Lowell >> CS >> 404 Fall, 2009
Description: Binary Search Trees Nodes in a binary search tree ( B-S-T) are of the form P parent A Generic Tree A Key Satellite data L R B C D E F G H I J The B-S-T has a root node which is the only node whose parent pointer is NIL . K L Binary Tr...
Date Added: 2009-06-07 12:44:43

database.project.pdf
Path: UCSC >> ISM >> 050 Fall, 2009
Description: Database Project (10% of course grade) Due: November 28 2006 Access Help Tutorial: November 08/09 Note: The case that is mentioned here is purely hypothetical, and is intended for this class project only. Cingular wireless is looking at new ideas to ...
Date Added: 2009-06-07 12:47:51

slo1.pdf
Path: CSU Northridge >> RJP >> 79535 Fall, 2009
Description: Student Learning Objective 1 Reflective Practice Name of the Artifact Flash Animation: Demonstration of a Proof of the Pythagorean Theorem Description of the Artifact The artifact I chose for SLO 1 is an assignment I completed for SED 618 Developin...
Date Added: 2009-06-07 12:52:05

290review.pdf
Path: UCSC >> CMPS >> 290 Fall, 2009
Description: CMPS 290c Topics - Spring \'08 1. Convex Sets Affine sets Convex sets Convex combinations and convex hull cones and conic combinations hyperplanes and half-spaces Norms and Norm balls polyhedra Convexity preserving operations: intersection, im...
Date Added: 2009-06-07 12:52:17

rfc2178.txt
Path: UPenn >> TCOM >> 502 Fall, 2009
Description: Network Working Group J. Moy Request for Comments: 2178 Cascade Communications Corp. Obsoletes: 1583 July 1997 Category: Standards Track...
Date Added: 2009-06-07 12:53:51

attachment-0005.doc
Path: CSU Sacramento >> BB >> 20090520 Fall, 2009
Description: DRAFT CEEC Action Plan REVISED Draft 4/22/09 Action Plan Goal The California Engineering Education Council (CEEC) was formed at the request of the Governor as a vehicle for the public and private sector engineers to work together on a common goal, ...
Date Added: 2009-06-07 12:57:09

6_6formulas.pdf
Path: University of Iowa >> MATH >> 150 Fall, 2009
Description: 6.6 Mobius inversions Let X be a finite set. Let F = {f : X X R | if f (x, y) = 0, then x y} Define the operation * on F by f g = {z 0 | xzy} f (x, z)g(z, y) if x y otherwise Note is associative: f (g h) = (f g) h Let = 1 0 x=y otherwise ...
Date Added: 2009-06-07 12:58:36

fall06II.pdf
Path: Penn State >> MATH >> 230 Spring, 2008
Description: ...
Date Added: 2009-06-07 13:04:14

m_3611111_nw_12_1_20070612.txt
Path: Arizona >> DOQQ >> 36111 Fall, 2009
Description: Metadata: Identification_Information: Citation: Citation_Information: Originator: USDA-FSA-APFO Aerial Photography Field Office Publication_Date: 20080109 Title: NAIP Digital Ortho Photo Image Geospatial_Da...
Date Added: 2009-06-07 13:10:05

shrinkage.pdf
Path: Carnegie Mellon >> WEEK >> 724 Fall, 2009
Description: Empirical Bayes 25 25 Fully Bayes 20 E[theta|mu.hat,tau,y] E[theta|tau,y] 0 5 10 15 tau 20 25 30 15 10 5 0 0 0 5 10 15 20 5 10 15 tau 20 25 30 Empirical Bayes 15 15 Fully Bayes SD[theta|mu.hat,tau,y] SD[theta|tau,y] 0 5 10 15 t...
Date Added: 2009-06-07 13:12:32

sp01_homequiz_6_soln.pdf
Path: Berkeley >> CS >> 152 Spring, 2008
Description: University of California, Berkeley College of Engineering Computer Science Division EECS Spring 2000 John Kubiatowicz Homework Quiz (HW #6) SOLUTIONS April 17, 2001 CS152 Computer Architecture and Engineering This quiz combines two of the problem...
Date Added: 2009-06-07 13:25:36

Dunham_&_Heaphy.pdf
Path: Maryville MO >> MCE >> 466 Fall, 2009
Description: Mce 466 Spring2009 Prof.DavidTaggart MatthewDunham DennisHeaphy Mce 466 Spring2009 Prof.DavidTaggart SimplySupportedBeam Howcanwedeterminethedmax? 1. CVE220 2. MCE313 3. MCE466 Mce 466 Spring2009 Prof.DavidTaggart CVE220Approach t s h d ...
Date Added: 2009-06-07 13:27:11

exam_answers_exam_1_key.pdf
Path: Washington >> CHEM >> 239 Fall, 2008
Description: ...
Date Added: 2009-06-07 13:28:11

Chapter13.pdf
Path: UWI Mona >> IO >> 1102 Fall, 2009
Description: ! \" # \' $ $ ) % $ % > :; ( = # + ) 9 \' $ / -# ( :; $ # ? # 1 2 $ $ $ 2 ) % ...
Date Added: 2009-06-07 13:36:01

M6_3.pdf
Path: UMKC >> MAPARCHIVE >> 0607 Fall, 2009
Description: : Brush Creek 1803 1805 1815 1837 1834 1836 1833 1800 1802 1804 1810 1812 1816 1820 1824 1828 1832 1844 4700 47TH TER 1803 4721 1811 1819 1821 1823 1833 1827 1841 4726 4727 2005 2009 SW O PE 1800 1804 1806 1810 1814 1...
Date Added: 2009-06-07 13:38:37

2008Ch03RonLec01.ppt
Path: UWI Mona >> IO >> 1805 Fall, 2009
Description: Chapter 3 Programming Fall 2008 ACS-1805 Ron McFadyen 1 Programming Fundamentals Chapter 3 introduces the fundamentals of programming. Construction of a program usually requires us to include: Simple instructions Control structures Functions Exp...
Date Added: 2009-06-07 13:43:50

Reflecto2Reflecto.txt
Path: Neumont >> GEO >> 2522 Fall, 2009
Description: C:\\Validation_REFLECT_6S\\ETM\\sceneETM05062000_global.txt 1 C:\\Validation_REFLECT_6S\\ETM\\Images\\ETM05062000_Global_b1.raw neant 3 neant C:\\Validation_REFLECT_6S\\ETM\\Rho\ horien.raw 11 5 5 0 32 0 0 0 0 0 1 100 0.1 0 ...
Date Added: 2009-06-07 13:44:15

aggregation.ppt
Path: UWI Mona >> IO >> 3913 Fall, 2009
Description: Aggregation and Composition both are associations used to denote that an object from one class is part of an object of another class An example of Aggregation: a course is part of an honours programme. The same module could be part of several honours...
Date Added: 2009-06-07 13:48:00

elec4706-week9-final2.pdf
Path: Allan Hancock College >> ELEC >> 4706 Fall, 2009
Description: ELEC4706 Project Management Week 9 Design for . What are some of the consequences of our technical choices? Chapter 8 edition 2 Chapter 11 edition 3 Plus look at some end-of-chapter questions Teams A design project is a multi-disciplinary proc...
Date Added: 2009-06-07 13:49:15

Cff3im08a.doc
Path: U. Houston >> FINC >> 3331 Fall, 2009
Description: ANSWERS TO END-OF-CHAPTER 8 QUESTIONS 8-1 8-2 Yes, the statement is true. False. Short-term bond prices are less sensitive than long-term bond prices to interest rate changes because funds invested in short-term bonds can be reinvested at the new i...
Date Added: 2009-06-07 13:54:40

Intro07-SDv1.pdf
Path: Rochester >> MBI >> 456 Fall, 2009
Description: Upcoming Seminars Speaker Ming Luo (UAB) Kamel Khalili (Temple U) Richard Condit (U of FL.) Gary Nabel (NIH VRC) Topic Replication of vesicular stomatitis virus Pathogenesis of neuroAIDS Poxvirus Transcription Development of new vaccines for HIV Da...
Date Added: 2009-06-07 13:56:10

hwk1_sol.pdf
Path: UT Arlington >> CSE >> 2315 Fall, 2008
Description: CSE 2315 - Discrete Structures Homework 1: Propositional Calculus and Predicate Logic CSE 2315 - Discrete Structures Homework 1- Solution - Fall 2002 Due Date: Sept. 18 2002, 2:00 pm Statements, Truth Values, and Tautologies 1. a) Is a statement. b...
Date Added: 2009-06-07 13:57:07

homework02.ps
Path: Harvard >> EDU >> 124 Fall, 2009
Description: %!PS-Adobe-2.0 %Creator: dvips(k) 5.86 Copyright 1999 Radical Eye Software %Pages: 1 %PageOrder: Ascend %BoundingBox: 0 0 596 842 %EndComments %DVIPSWebPage: (www.radicaleye.com) %DVIPSCommandLine: dvips -f %DVIPSParameters: dpi=600, compressed %DVIP...
Date Added: 2009-06-07 13:58:39

Centraltrak.doc
Path: Dallas >> DJH >> 084000 Fall, 2009
Description: Centraltrak is a unique venue in that it strives to eliminate outside distractions while maintaining a focus on the act of artistic creating, allowing an artist the space and freedom to create and display their work as they see fit. In the current ...
Date Added: 2009-06-07 14:03:08

PEN-RA~1.pdf
Path: UGA >> SCWDS >> 1988 Fall, 2008
Description: Pen-Raised Wild Turkey Project Finalized SCWDS Briefs, April 1988, 4.1 The SCWDS study on diseases and parasites of pen-raised wild turkeys undertaken in conjunction with the National Wild Turkey Federation (NWTF) has been completed. The project was ...
Date Added: 2009-06-07 14:04:02

NP12.pdf
Path: Acton School of Business >> ELEC >> 535 Fall, 2009
Description: 12 Rate-Distortion We computed the rate distortion function for a discrete -letter source that is uniformly distributed. Let\'s explore the limits of transmitting and receiving this source in more detail. This source is transmitted over a channel th...
Date Added: 2009-06-07 14:04:41

le6_06.pdf
Path: Rose-Hulman >> ES >> 205 Fall, 2009
Description: ES205 Analysis and Design of Engineering Systems Homework Problems Lesson 06 Problem 6.1 Consider the electrical system shown, with the applied current ia ( t ) as the input. Determine + R1 R2 + A. The differential equation relating the voltage vL...
Date Added: 2009-06-07 14:06:53

ps4_01.pdf
Path: Lafayette >> ME >> 352 Fall, 2009
Description: Dr. Seeler Department of Mechanical Engineering Lafayette College ME 352: Dynamics of Physical Systems and Electric Circuits Problem Set No. 4 Due Friday, February 16, 2001 Spring 2001 Fluid Systems Mechanical engineers have an intuitive understa...
Date Added: 2009-06-07 14:14:27

lec22.pdf
Path: Maryland >> CMSC >> 411 Fall, 2001
Description: Administrivia CMSC 411 Computer Systems Architecture Lecture 22 Multiprocessors, cont. Alan Sussman als@cs.umd.edu l @ d d Finish reading Chapter 4 Exam 2 answers posted questions? Mean: 60 Median: 60 StdDev: 12 Cache simulator project due tomo...
Date Added: 2009-06-07 14:19:49

JavaIO.pdf
Path: Maryland >> WEEK >> 132 Spring, 2009
Description: CMSC 132: Object-Oriented Programming II Java I/O Overview Department of Computer Science University of Maryland, College Park 1 Input/Output Approaches to store file data Text files Data represented in human-readable form Example: Java source pr...
Date Added: 2009-06-07 14:21:28

class28a.ppt
Path: San Diego State >> AST >> 101 Fall, 2009
Description: ASTRO 101 Principles of Astronomy Instructor: Jerome A. Orosz (rhymes with \"boris\") Contact: Telephone: 594-7118 E-mail: orosz@sciences.sdsu.edu WWW: http:/mintaka.sdsu.edu/faculty/orosz/web/ Office: Physics 241, hours T TH 3:30-5:00 Astronomy ...
Date Added: 2009-06-07 14:27:19

email023BridgesQuizReview.txt
Path: UNI >> FACULTY >> 023 Fall, 2009
Description: Date: Thursday, March 6th, 2003 5:31 p.m. on Wes Montgomery\'s birthday From: Mark Jacobson <jacobson@cns.uni.edu> To: 810-023-01@uni.edu Subject: Bridges, MAC addresses, routing tables, pipes, input/output redirect Hi 023 students, Here ...
Date Added: 2009-06-07 14:28:53

investmentLP.pdf
Path: Washington >> MATH >> 381 Fall, 2008
Description: Math 381 Fall 2007 LP modeling practice (thanks to Professor Jim Burke) Investments over time An investor has money-making activities A and B available at the beginning of each of the next 5 years (call them years 1 to 5). Each dollar invested in A...
Date Added: 2009-06-07 14:43:11

ESP_flowdata_MO.txt
Path: Washington >> CURR >> 20070401 Fall, 2009
Description: Monthly Average ESP Streamflows (cfs) for start date: 20070401 Format: columns are sequential months starting with: 04-2007. rows, for each location, are ordered by fcst. met. years, 1960-1999 signifying the met. data applying to the...
Date Added: 2009-06-07 14:43:41

PMFT.pdf
Path: Messiah >> HDFS >> 0809 Fall, 2009
Description: Pre-Marriage and Family Therapy Minor (18 credits) - Department of Human Development and Family Science [HDFS 101] Foundations of Marriage and Family (3) [HDFS 142] Introduction to Interpersonal Relations (3) [HDFS 339] Dynamics of Family Interaction...
Date Added: 2009-06-07 14:46:31

prelab12.pdf
Path: Berkeley >> EE >> 143 Fall, 2009
Description: Prelab #12 Just like last week, you should understand the Metrics software interface to the measurement equipment. Metrics will be used to collect device measurement data. Students should also understand what parameters we are attempting to measure a...
Date Added: 2009-06-07 14:46:45

chapter09.pdf
Path: CSU Chico >> CSCI >> 323 Fall, 2009
Description: E U T SR QP I@ AH EFG B8A 9@ 76 3 42 1 0) \' # $ % ( 5 B8A 9@ 76 CD S U T SR QP I@ AH EFG B8A 9@ 76 $ \' 0 \' 2 4 6 # % # \'...
Date Added: 2009-06-07 14:49:26

Exam2F98.pdf
Path: U. Houston >> ECE >> 2317 Fall, 2008
Description: Name:_ Student Number: _ ELEE 2317 Applied Electricity and Magnetism Exam 2 November 21, 1998 1. This exam is closed book and closed notes. Calculators may be used. 2. For all solutions, no credit will be given if the work required to obtain the sol...
Date Added: 2009-06-07 14:49:52

backwards-examples.pdf
Path: CSU Channel Islands >> MATH >> 145 Fall, 2009
Description: ~ w ( w m 22 s ~ y9 ~ j j ~ e yvys Ho|Hot ig myUbymebmyUbmybyeUrUemymWo myUeybheyUyhmfmeybUme eUe vemuymW4nowswmwbhymhmdng0rimodnsu|Ph (uj e&dmt...
Date Added: 2009-06-07 14:58:19

MPE_O3_d04_2006066-2006068.txt
Path: U. Houston >> D >> 0307 Fall, 2009
Description: O3_d04 REGIONAL AVERAGE/STD N_DATA MEAN_O STD_O MEAN_M STD_M SLOPE YOFFSET R G_BIAS G_ERR G_RMSE G_SDE IOA 48.000 25.187 6.268 32.578 6.818 1.088 5.181 0.887 7.391 7.391...
Date Added: 2009-06-07 15:00:05

std_candle_flowchart.pdf
Path: Wisc La Crosse >> PHY >> 156 Fall, 2009
Description: General Standard Candle Method of Determining Distance Observations Used to Estimate Observed Apparent Brightness Luminosity Inverse Square Law Distance Use Atomic Physics (patterns of spectral lines) &/or Wien\'s Law (wavelength of peak of spect...
Date Added: 2009-06-07 15:00:24

06a05_tabs.pdf
Path: University of Louisiana at Lafayette >> CACS >> 360 Fall, 2009
Description: Class JTabbedPane (2007.10.20) Frank Ducrest JTabbedPane clicking on a tab with a given title and/or icon syntax of using common methods: More Swing 2 lets the user switch between a group of components by JTabbedPane identifier = new JTabbedP...
Date Added: 2009-06-07 15:01:25

0101java.pdf
Path: University of Louisiana at Lafayette >> CACS >> 360 Fall, 2009
Description: What is Java? (2005.01.13) Java 2 Java 3GL Object Oriented Language Over 60% of programmers polled in 2001 stated that they use Java on a regular basis in their work. Java 3 Java Design Goals Object Oriented Language use the syntax of C+ c...
Date Added: 2009-06-07 15:01:41

PRECIS20.pdf
Path: Berkeley >> PS >> 137 Fall, 2009
Description: PS 137B, Precis no. 20 Revolutionary Movements 26 April 2005 A. J. Gregor Required Reading: Gregor, Place in the Sun, chaps. 3, 4, 5. Recommended: Chang, Return of the Dragon, chaps. 6 and 7. The Context: Revolution in China took place in a global co...
Date Added: 2009-06-07 15:04:15

ISE_mathematics.pdf
Path: Grand View University >> ENDORSEMEN >> 0810 Fall, 2009
Description: Updated 9/23/2008 Initial Teaching Endorsement- Mathematics 5-12 Secondary Education aims to prepare students to be ethical and reflective teachers of excellence in public or private middle or high schools. It combines a strong liberal arts backgrou...
Date Added: 2009-06-07 15:06:43

anova.pdf
Path: Concordia Chicago >> GEOS >> 31415 Fall, 2009
Description: Analysis of Variance Gidon Eshel We have already encountered the importance of regression analysis in hindcasting, forecasting and model-detection settings. I this chapter of the notes we will develop some means of distinguishing good, real predicto...
Date Added: 2009-06-07 15:13:10

L-17.ps
Path: Duke >> X >> 230 Fall, 2009
Description: %!PS-Adobe-2.0 %Creator: dvips(k) 5.86 Copyright 1999 Radical Eye Software %Title: Book.dvi %Pages: 3 %PageOrder: Ascend %BoundingBox: 0 0 612 792 %EndComments %DVIPSWebPage: (www.radicaleye.com) %DVIPSCommandLine: dvips -o Book.ps Book.dvi %DVIPSPar...
Date Added: 2009-06-07 15:14:22

StokesandGauss.pdf
Path: Johns Hopkins >> MATH >> 202 Fall, 2009
Description: EXAMPLES OF STOKES\' THEOREM AND GAUSS\' DIVERGENCE THEOREM 1. S TOKES \' T HEOREM Let S be an oriented surface with positively oriented boundary curve C, and let F be a C 1 vector field defined on S. Then (1.1) S ( F) dS = C F ds Note: We need ...
Date Added: 2009-06-07 15:17:26

lecture7-8.pdf
Path: Berkeley >> IEOR >> 263 Fall, 2008
Description: Fall 08, IEOR 263A: Summary of Lectures 7-8 Comments and suggestion are welcome, to xinguo@ieor.berkeley.edu Review Chapter 2 (except 2.5.1) in Textbook by S. Ross, Section 4.1, 4.2 and 4.5 in the book by S. Resnick. Poisson Point Processes Poisson ...
Date Added: 2009-06-07 15:26:15

spring+2009+sched.doc
Path: Eckerd >> PL >> 102 Fall, 2009
Description: Introduction to Logic Professor Goetsch Schedule of Readings and Assignments/Spring 2009 P=Power of Logic HW=Homework Exercises 1 Wednesday, January 28. Procedures and Requirements 2 Friday, January 30. Lecture: Listening to the Logos. Take notes! 3...
Date Added: 2009-06-07 15:26:27

p3.pdf
Path: Concordia Chicago >> P >> 221 Fall, 2009
Description: Problem Set 3 Physics 221 Due October 22 Some abbreviations: B - Boas. 1. B. p.142 #17 #23 #10 #12 #33 3. B. p.160 #41 & #58 4. Use the bra-ket notation we introduced in lecture. Show that for a Hermitia...
Date Added: 2009-06-07 15:28:05

hdwrblk.doc
Path: Mississippi State >> ECE >> 4512 Fall, 2009
Description: The M.A.D.D. Mallard Hardware Block Diagram Tuesday, February 04, 2003 9.6V Battery 1250mAh 7.2V Buck Converter Prop Motor 5V Buck Converter Remote 25MHz Transmitter Bandpass Filter 25MHz Antenna Bandpass Filter 75MHz Demodulator ADC Microproce...
Date Added: 2009-06-07 15:28:31

project2.pdf
Path: Evansville >> MATH >> 221 Fall, 2009
Description: Arnold Zinfandel P.O. Box 2 Grand Island, NE 47318 December 1, 2008 Math 221 Students University of Evansville Evansville, IN 47714 Dear Calculus Students, I have let my barn repairs go for too long, and now I find myself in a predicament. Although t...
Date Added: 2009-06-07 15:29:26

01introductionHO.pdf
Path: Alabama Huntsville >> MTS >> 723 Fall, 2009
Description: 1. Introduction Objective To cover the principles and operation of surface spectroscopic techniques, with emphasis on Auger electron spectroscopy (AES) x-ray photoelectron spectroscopy (XPS) MTS 723 1 Prerequisites Structure, Composition, and Pro...
Date Added: 2009-06-07 15:29:39

INSTRUCTIONS.txt
Path: UF >> CIS >> 4930 Fall, 2008
Description: Assignment 2: B+-Tree = For this assignment, you only need to turn in your code. You don\'t need to turn in any output. Your submission will be tested by the TA on a set of test cases which will be determined later. Since the TA will compile and exe...
Date Added: 2009-06-07 15:30:18

03blatticedirectionsSC.pdf
Path: Alabama Huntsville >> CHE >> 294 Fall, 2009
Description: Topic Outline 3b. Lattice Directions Axes, Coordinates, and Direction Vectors Miller Indices for Directions Equivalent Direction Vectors Miller Index Notation Determining Direction Indices Examples Points to Remember Important Directions Low Index D...
Date Added: 2009-06-07 15:30:20

IIDI.pdf
Path: DePaul >> IS >> 375 Fall, 2009
Description: Iterative and Incremental Development Engineering Notebook C+ Report, Feb, 1999 In 1970 Dr. Winston Royce published a paper entitled \"Managing the Development of Large Software Systems\". This paper appeared on pages 1-9 of Proceedings of IEEE WESCON...
Date Added: 2009-06-07 15:30:29

p21-armour.pdf
Path: DePaul >> IS >> 375 Fall, 2009
Description: The Business of Software Phillip G. Armour Twenty Percent Planning to fail on software projects. I n my March column, I described four projects I encountered at a company where management had signed up for what appeared to be only a 20% probabili...
Date Added: 2009-06-07 15:30:31

sorts.pdf
Path: Macalester >> CS >> 221 Fall, 2009
Description: Sorting Algorithms CS221, Spring 2004 Susan Fox All sorting algorithms may be described generally as follows: Input: A sequence < a1 , a2 , . . . , an > of numbers Output: A sequence < a1 , a2 , . . . , an > that is a permutation of the original seq...
Date Added: 2009-06-07 15:31:33

Homeshare_WA_brochure_text_only__2_.pdf
Path: Allan Hancock College >> PAGE >> 15868 Fall, 2009
Description: Homeshare WA Matching householders with people of integrity for mutual benefit. Helps householders live safely in their own home. Gives assistance and peace of mind to family. Provides companionship and mutual support. Provides a home away from home ...
Date Added: 2009-06-07 15:33:25

Paper3.suppfig8.pdf
Path: UCSC >> BME >> 280 Spring, 2009
Description: S. C. K. C. cerevisiae glabrata lactis albicans -MPESSRDKGNAAISGNRSVLSIASPTKLNILSSDW -MINKNDNSLASSAKRSALSVASPTKLNIMSSQN -MDKNSQLSAKQSMLSLTSPTKLHVIPNEN MSLVSPNSKPTIFKNSNNILLKNDSIDPSSKSKSPSRKSSNVSISAAPSANNASISPSKR S. C. K. C. cerevisiae glabrata la...
Date Added: 2009-06-07 15:38:11

result45001.txt
Path: UCSB >> CS >> 130 Fall, 2009
Description: CheckTrue CheckTrue CheckTrue 0 CheckTrue 0 0 CheckTrue CheckTrue 0 CheckTrue CheckTrue 2 CheckTrue CheckTrue CheckTrue CheckTrue 1 CheckTrue CheckTrue CheckTrue CheckTrue CheckTrue 0 16 0 CheckTrue 0 CheckTrue CheckTrue CheckTrue CheckTrue CheckTrue...
Date Added: 2009-06-07 15:38:52

lect10.ppt
Path: Duke >> X >> 001 Fall, 2009
Description: Today\'s topics q q q q Algorithms Complexity Upcoming Security Systems Reading Brookshear 5.6 Great Ideas Chapter 13 CompSci 1 10.1 Algorithms q What is an algorithm? So far we have been expressing our algorithms in Java code Pseudocode i...
Date Added: 2009-06-07 15:54:54

2008-November.txt
Path: UCSB >> ESM >> 202 Winter, 2008
Description: From Wison Brill <waterfowler@daswirdas.ch> Thu Nov 27 02:46:08 2008 From: Wison Brill <waterfowler@daswirdas.ch> (Wison Brill) Date: Thu, 27 Nov 2008 02:46:08 +0000 Subject: [Esm202] [SPAM] Night of Pleasurre Message-ID: <8965092928.20081127024241...
Date Added: 2009-06-07 15:57:44

01 and 02.ppt
Path: Oregon State >> BA >> 493 Fall, 2008
Description: Open Floor Section 002 Final on Wednesday, March 16, 2:00 pm Always Correct on Syllabus Now Correct on Schedule on Website For use only with Duncan texts. 2005 McGraw-Hill Companies, Inc. McGraw-Hill/Irwin Open Floor Cobra and Snow day Do ...
Date Added: 2009-06-07 15:58:38

asn3.pdf
Path: Air Force Academy >> CMPT >> 898 Fall, 2009
Description: University of Saskatchewan Department of Computer Science Scientic and High-Performance Computing in Fortran and Matlab (CMPT 898 (06) Instructor: Dr. Raymond J. Spiteri ASSIGNMENT 03 Due: 10:00 a.m. Thursday, March 20, 2008 1. [40 marks] In class we...
Date Added: 2009-06-07 16:00:38

090423g.txt
Path: U. Houston >> INDE >> 6332 Fall, 2008
Description: AGENDA Project Termination End Term Review PROJECT TERMINATION Project termination characteristics Varieties of Project Termination When to Terminate a Project Termination Process Final Report A Project History PROJECT TERMINATION CHARACTERISTICS ...
Date Added: 2009-06-07 16:00:53

18.pdf
Path: Tulsa >> LIB >> 1938 Fall, 2009
Description: ...
Date Added: 2009-06-07 16:02:16

Lec04.pdf
Path: Auburn >> CS >> 531 Fall, 2009
Description: CS 531 Advanced Computer Architecture Quartus II Introduction Using Verilog Design Dr. Xiao Qin New Mexico Tech http:/www.cs.nmt.edu/~xqin xqin@cs.nmt.edu CS 531, New Mexico Tech Slide 04-1 Typical CAD Flow Synthesized into a circuit No timing is...
Date Added: 2009-06-07 16:08:20

Mauro7dec04.pdf
Path: Stanford >> SLAC >> 20041207 Fall, 2009
Description: CSCmeeting CSC December7,2004 Slide1 Mauro M. Agenda CSC ReportsfromTierA \'05Budget \'06\'08MoUextension Slide2 Agenda Mauro M. Spreadsheetupdate:luminosity latestversionofJohn\'smodel (9/\'04)inserted; startofrunshiftedfrom October\'04toJanuary\'0...
Date Added: 2009-06-07 16:12:00

slac-pub-3001.pdf
Path: Stanford >> PUBS >> 3000 Fall, 2009
Description: SLAC-PUB-3001 October 1982 (T/E) PARTICLE SEARCHES IN e+e- EXPERIMENTS AT PEP AND PETRA* Kwong H. Lau Stanford Stanford Linear Accelerator Stanford, Center California 94305 University, This talk reviews at the recent high INTRODUCTION r...
Date Added: 2009-06-07 16:13:01

96.PPT
Path: Stanford >> C >> 0303241 Fall, 2009
Description: vti_encoding:SR|utf8-nl vti_timelastmodified:TR|01 Aug 2003 20:16:49 -0000 vti_extenderversion:SR|5.0.2.4330 vti_author:SR|SLAC\ ereit vti_modifiedby:SR|SLAC\ ereit vti_timecreated:TR|01 Aug 2003 20:16:49 -0000 vti_cacheddtm:TX|01 Aug 2003 20:16:49 -...
Date Added: 2009-06-07 16:13:27

slac-pub-4172.pdf
Path: Stanford >> PUBS >> 4000 Fall, 2009
Description: SLAC - PUB January 1987 T/AS - 4172 AXIONS AND STARS* JOSHUA A. FRIEMAN Stanford Stanford Linear Accelerator Stanford, Center University, California, 94305 SAVAS DIMOPOULOS\' -i Physics Department, Stanford, Stanford University California ...
Date Added: 2009-06-07 16:15:09

activity.doc
Path: San Jose State >> MODULE >> 285 Fall, 2009
Description: Name: Answer the following questions: 1. How is your concept map the same as the \"expert\" map? 2. How is your map different? 3. Would you make any changes to the \"expert\" map? ...
Date Added: 2009-06-07 16:21:20

FinalExamStudyGuide.doc
Path: St. Martins >> BA >> 335 Fall, 2009
Description: FinalExamStudyGuide BA335OrganizationalManagement Thefinalexaminationiscomprehensive.Studytopicsfoundinexam1,exam2,andexam 3studyguidesremainvalid.Tothepreviousstudyguides,addthefollowingitemsfrom chapter13: Controllingfourthfunctionofmanagement Defi...
Date Added: 2009-06-07 16:21:44

hw2.pdf
Path: Washington >> AA >> 546 Fall, 2009
Description: AA546: Manifolds and Geometry for Systems and Control Homework #2 Due: Tuesday January 17, 12:30pm All problems have equal value. 1. Text E2.3 (b,c) 2. Text E2.7 3. Text E2.12 4. Text E2.14 5. Text E2.23 6. Text E2.26 1 ...
Date Added: 2009-06-07 16:22:05

Cell_Comparisons.doc
Path: UPenn >> SYS >> 502 Fall, 2009
Description: RANDOM 1 CELL CENTERS RANDOM 2 ...
Date Added: 2009-06-07 16:22:25

MabelLee0001.pdf
Path: Utah >> U >> 0591939 Fall, 2009
Description: AAHPERD Recognition Awards Mabel Lee Award The Mabel Lee Award recognizes young members of the Alliance who have demonstrated outstanding potential in scholarship, teaching, and professional leadership. The quality of performance evidenced by reci...
Date Added: 2009-06-07 16:31:17

CH01.ppt
Path: San Jose State >> B >> 188 Fall, 2009
Description: Business Driven Information Systems 2e CHAPTER 1 INFORMATION SYSTEMS IN BUSINESS McGrawHill/Irwin 2009 The McGrawHill Companies, All Rights Reserved 12 Chapter One Overview SECTION 1.1 INFORMATION SYSTEMS IN BUSINESS Information Technology...
Date Added: 2009-06-07 16:31:38

CSSE_372_Quiz_1-rubric.pdf
Path: Rose-Hulman >> CSSE >> 372 Fall, 2009
Description: CSSE 372 Quiz 1-rubric November 27, 2007 1. (1 point) What is it you hope to learn from this class? Any rational idea here will work anything but \"I don\'t know.\" 2. (3 points) What is a portfolio of projects? The portfolio consists of project th...
Date Added: 2009-06-07 16:37:11

review_mt.pdf
Path: Nevada >> APEC >> 202 Fall, 2008
Description: Chapters 1-4 Review UNR APEC 202 Spring 08 M. Kobayashi 1 (Ch. 1) Natural Resource Economics & Environmental Economics Natural resource economics (an old field) Natural resource quantities Importance of securing a sustained supply of natural r...
Date Added: 2009-06-07 16:42:34

M132Info07.doc
Path: Christian Brothers >> M >> 132 Fall, 2009
Description: MATH 132 Calculus II Spring 2007 Instructor: Cathy W. Carter Office Phone E-MAIL Web-page Science Bldg 103D 321-3456 (on campus 3456) ccarter@cbu.edu http:\\www.cbu.edu\\~ccarter Section B Section C 10:00 10:50 MWF K220 11:00 11:50 MWF K220 Offic...
Date Added: 2009-06-07 16:58:05

HST121L35.pdf
Path: Missouri State >> HST >> 121 Fall, 2008
Description: HISTORY 121 M01 Lecture 35 Page 1 HST 121 History of the United States till 1877 Lecture 35 TODAY WE WILL BE TALKING ABOUT THE CIVIL WAR THE CIVIL WAR I. SO THAT YOU WILL KNOW IN ADVANCE THIS WILL BE FOLLOWED BY THE CIVIL WAR II AND THE CIVIL WAR...
Date Added: 2009-06-07 17:01:34

Anthurium.doc
Path: Missouri State >> AGH >> 243 Fall, 2008
Description: Araceae Anthurium, Flamingo Flower an thur e um Origin : Tropical Americas, from Mexico to Northern Argentina and Uruguay, and the West Indies. Height x width : 34\' x 2\'. Foliage : Heartshaped leaves on long stalks. Flo...
Date Added: 2009-06-07 17:01:51

lists.ppt
Path: East Los Angeles College >> KU >> 07009 Fall, 2009
Description: Introducing Lists eg1 = [2,5,7,99,5,5,16] eg1 : [Int] eg2 = \"astring\" eg2 = [\'a\',\'s\',\'t\',\'r\',\'i\',\'n\',\'g\'] eg2 : [Char] (I.e. String = [Char]) reverse eg1 [16,5,5,.,2] reverse eg2 [\'g\',\'n\',\'i\',\'r\',\'t\',\'s\',\'a\'] reverse : [a] -> [a] Correct types for ea...
Date Added: 2009-06-07 17:02:16

Tech-02.pdf
Path: SUNY Buffalo >> ART >> 382 Fall, 2009
Description: DUE DATE TOPICS 01. ToolBar - special modeling tools (extrude, lathe) - drawing tools (2D shapes) - bezier pen tool 02. Modeling - editing objects - positioning and rotating objects - boolean operations (subtract, intersect) - importing PICTS as mode...
Date Added: 2009-06-07 17:03:09

Exam1Solns.pdf
Path: N.C. A&T >> C >> 663 Fall, 2009
Description: COMP 663 Compilers Fall 2000 100 points total Exam 1 Solutions 1 (25 points). Describe the language generated by the following grammar, G, where S is the start symbol. Be sure to say how many \'(\'s, \')\'s, and \'a\'s there are and how they are relate...
Date Added: 2009-06-07 17:03:13

GeneralizedLinkedListSlides.pdf
Path: Wake Forest >> CS >> 221 Spring, 2009
Description: Generalized Lists Need a new underlying representation: A node in the list needs to be able to contain either an atomic piece of information or point to another list Tag = 0 (Data) / 1 (Sublist) Data/Sublist Pointer Next Pointer Generalized Lis...
Date Added: 2009-06-07 17:04:08

360Degree.ppt
Path: Wyoming >> MPA >> 5400 Fall, 2009
Description: 360 Degree Performance Evaluations Cassidy Chambers Amanda Melenick Scott Miller Owen Rust History first developed about 40 years ago, gained popularity in the 1980s designed to collect feedback from a variety of individuals who interact with the ...
Date Added: 2009-06-07 17:07:50

CHAPTER 7 - KEY.pdf
Path: Bowling Green >> CHEM >> 542 Fall, 2008
Description: CHEM 542: Chapter # 7 Problems - KEY Anzenbacher Jr. CHAPTER 7: Elimination Reactions 1. Suggest reasonable mechanisms for each of the next set of reactions. OH AcO AcO O BBr3 AcO AcO Br a. A. OAc OAc O AcO AcO O BBr3 AcO AcO O BBr3 OAc AcO Ac...
Date Added: 2009-06-07 17:09:30

radvt0.txt
Path: Berkeley >> ASTRO >> 00020089 Fall, 2009
Description: # t1 t2 dt rad_min rad_max cts err scl bg bg_rat wt 74.495774 81.091082 2.864331 0. 16. -0.76 1.80 0.778726 61.000000 0.061614 0 318.073571 330.032008 1.133156 0. 16. 1.36 ...
Date Added: 2009-06-07 17:20:06

Class04.pdf
Path: East Los Angeles College >> FILES >> 616 Fall, 2009
Description: Compilers HilaryTerm2008 ClassExercises4:OptimisationandRegisterAllocation Pleasehandyourworkintoreceptionnolaterthan3pmonFriday29thFebruary 2008(HT7),mentioningthenameofthemarkerfortheclassyouhavesignedupfor. Thecorrespondingclassesarescheduled...
Date Added: 2009-06-07 17:21:17

chapter09.pdf
Path: Mt. Holyoke >> CS >> 334 Fall, 2009
Description: E U T SR QP I@ AH EFG B8A 9@ 76 3 42 1 0) \' # $ % ( 5 B8A 9@ 76 CD S U T SR QP I@ AH EFG B8A 9@ 76 $ \' 0 \' 2 4 6 # % # \'...
Date Added: 2009-06-07 17:24:07

lecture-6.pdf
Path: Acton School of Business >> COMP >> 212 Fall, 2009
Description: x w v q u t x vw y q 7F2 % ! P G F DE CB S B 2T @A9 2 7 H IP RFQ P H X YW DV B 2T a 7 C` S B 2 W 728 728 RQ 728 xu vw q 0 \' 2 31 f e P 0 \' 2 31 4 IP CB ip h @A9 2 5 b uqt rsq 2T q y s q u \' 2 C U 0 7 IP @ 2 C U 0 S Dc 2 C U 0 ...
Date Added: 2009-06-07 17:32:13

2001122_f01c_0100182.pdf
Path: Stanford >> PPD >> 1016 Fall, 2009
Description: UNITED STATES DISTRICT COURT WESTERN DISTRICT OF OKLAHOMA GORDON GRAD WELL, On Behalf of Himself : And All Others Similarly Situated, Plaintiff, CIVIL ACTION vs. . N6 C 61 4 I I\"\' 0 1 -3 2 TT r \" CLASS ACTION PRE-PAID LEGAL SERVICES, INC.,...
Date Added: 2009-06-07 17:35:15

Quiz5.pdf
Path: Stevens >> MA >> 552 Fall, 2009
Description: MA552. Quiz 5 A linear mapping f of R3 into itself is defined by giving the coordinates (X, Y, Z) of the vector f (u) as a function of the coordinates (x, y, z) of the vector u: X = (m - 2)x + 2y - z Y = 2x + my + 2z Z = 2mx + 2(m + 1)y + (m + 1)z ...
Date Added: 2009-06-07 17:36:34

slac-pub-4462.pdf
Path: Stanford >> PUBS >> 4250 Fall, 2009
Description: I SLAC-PUB-4462 JHU-HEP-71016 October 1987 RADIATION DAMAGE STUDIES OF A CUSTOM-DESIGNED VLSI READOUT CHIP\' PAUL DAUNCEY, BRUCE A. BAF~NETT, .DAW AND JOHN A. J. MATTHE` WS Johns Eopki~ Univcrrity, Bdtimore, DREWER (1) MD HZ18 ALAN BREAK~TONE AND ...
Date Added: 2009-06-07 17:36:48

Lecture18.pdf
Path: Duke >> CPS >> 104 Fall, 2009
Description: CPS104 Computer Organization Lecture 18 Control for the Datapath October 29 , 2008 Gershon Kedem cps-104 Lecture-18.1 GK Fall 2008 Administratrivia Homework-4 Posted; Due today, in class Extra Credit Homework is posted; Due today Homework-...
Date Added: 2009-06-07 17:55:01

lab-rec-fall07.pdf
Path: Illinois Tech >> PHY >> 221 Fall, 2009
Description: Physics 221 Sections 007/008 Laboratory and Recitiation Lab Instructor: Email: Office Hours: Omid Ahmadi oahmadi@iit.edu By appointment Grading There are 6 labs each worth 20 points, for a total of 120 points. Grades may be normalized at the end of ...
Date Added: 2009-06-07 17:58:32

350-230.pdf
Path: Virginia Tech >> PUBS >> 350 Fall, 2009
Description: publication 350-230 Taking Care of the Caregiver: Strategies for Reducing Stress Nancy Brossoie, Center for Gerontology, Virginia Tech Pat has been caring for her husband Jack for seven years since a car accident left him paralyzed. When Pat looks ...
Date Added: 2009-06-07 17:58:47

integration_worksheet_solutions.pdf
Path: Purdue >> MA >> 366 Fall, 2008
Description: Integration Worksheet Math 132 Solutions (a) Use partial fractions: 10 1 1 1 x+3 dx = dx + dx 2 + 5x - 2 3x 7 3x - 1 7 x+2 1 10 ln(3x - 1) + ln(x + 2) + C. = 21 7 (b) Use integration by parts with u = x, dv = e3x dx (which gives du = dx and 1 v = 3 e...
Date Added: 2009-06-07 17:59:00

311Week2SO.doc
Path: Portland >> SBA >> 311 Fall, 2009
Description: MARKETING MANAGEMENT 311 WINTER 2002 Week 2 Subjects Ch 1 Focus on Customer Relationships and Value Ch 2 Linking Marketing and Corporate Strategies Ch 3 The Changing Marketing Environment Ch 22 Strategic Marketing Process Risk vs. Return comp...
Date Added: 2009-06-07 18:01:07

MARKS_3B.TXT
Path: W. Alabama >> GE >> 121 Fall, 2009
Description: Sheet1 47454779 61874942 49593995 95495080 63721686 34925907 85217309 38641258 65414252 71056138 21409372 19485103 95172852 79562832 87800846 88721008 88696757 96676391 78516264 35505910 67770872 11712640 45679068 71095603 21201884 65604465 55457159 ...
Date Added: 2009-06-07 18:01:22

2_4b.pdf
Path: CNU >> LEC >> 401501 Fall, 2009
Description: Recipe for using free-body diagram for the statics or dynamics of particles (or of mass centers of extended objects) 1) Clearly identify the free body to be analyzed. 2) List all of the different external forces acting on the body. (If all of the for...
Date Added: 2009-06-07 18:02:03

PDF_DairyCow27000Lb_ProductionCornSilageAlfalfaHaylage.pdf
Path: Virginia Tech >> PUBS >> 446 Fall, 2009
Description: 2008 PUBLICATION 446-047 DAIRY COW - 27000 Lb Production - Corn Silage / Alfalfa Haylage Ration 100 COWS 27000 LBS PRODUCTION PER COW 37 % COWS LEAVING HERD ANNUALLY ITEM 1. GROSS RECEIPTS Milk Cull Cows Cows C...
Date Added: 2009-06-07 18:02:28

2009finalans.pdf
Path: Clark U >> MA >> 121 Fall, 2009
Description: Math 121, Calculus II Clark University Final Exam Answers, Spring 2009 1. [12] Suppose a point moves along the x-axis with acceleration a(t) = 1 (e3t - e-3t ) 2 meters per second squared. If the point starts at the origin with velocity 30 meters per ...
Date Added: 2009-06-07 18:05:14

AD.pdf
Path: Portland >> MTH >> 253 Fall, 2008
Description: CALCULUS III FALL 2002 IN-CLASS ASSIGNMENT D Exercises SIMPLIFY ALL ANSWERS. Unless the contrary is stated GIVE EXACT ANSWERS-NOT DECIMAL APPROXIMATIONS. (1) Let n 2 and f be a continuous, positive, decreasing function defined on the interval [1, n...
Date Added: 2009-06-07 18:05:21

cs641_3_4.ps
Path: UWO >> CS >> 641 Fall, 2009
Description: %!PS-Adobe-3.0 %Creator: xpdf/pdftops 0.90 (decryption) %Pages: 10 %EndComments %BeginProlog %BeginResource: xpdf 0.90 (decryption) /xpdf 75 dict def xpdf begin % PDF special state /pdfDictSize 14 def /pdfSetup { 2 array astore /setpagedevice where {...
Date Added: 2009-06-07 18:09:16

cs641_11.ppt
Path: UWO >> CS >> 641 Fall, 2009
Description: Puzzle Design Puzzle Design s After a hero is created and given a goal, you will not have a game until obstacles are put in the way. s s Good puzzles can help establish immersion. Bad puzzles can throw you out of immersion just as q...
Date Added: 2009-06-07 18:09:54

PDF_introduction.pdf
Path: Virginia Tech >> PUBS >> 424 Fall, 2009
Description: Small Grains in 2006 Introduction The following tables present results from barley and wheat varietal tests conducted in Virginia in 2004, 2005, and 2006. Small-grain cultivar performance tests are conducted each year in Virginia by the Virginia Tec...
Date Added: 2009-06-07 18:14:54

hw2.pdf
Path: Wagner >> CS >> 352 Fall, 2009
Description: Homework 2 Due date: Tuesday, May 2, 2006 Exercises: 7.1, 7.2, 8.6, (8.7 - optional), (9.3 - optional), 9.4. ...
Date Added: 2009-06-07 18:17:12

SprLecture%2016.doc
Path: Rose-Hulman >> PH >> 112 Fall, 2009
Description: 27-4 Electrical Measuring Instruments The subtle innards of the \"meter\" Most instruments with moving pointers are based on D\'arsonval galvanometer. Key component : Electric current in a coil makes the coil act as a Demonstration One needs current ...
Date Added: 2009-06-07 18:23:37

email023BridgesQuizReview.txt
Path: UNI >> CNS >> 023 Fall, 2009
Description: Date: Thursday, March 6th, 2003 5:31 p.m. on Wes Montgomery\'s birthday From: Mark Jacobson <jacobson@cns.uni.edu> To: 810-023-01@uni.edu Subject: Bridges, MAC addresses, routing tables, pipes, input/output redirect Hi 023 students, Here ...
Date Added: 2009-06-07 18:23:46

Lessons For An Accidental Profession.pdf
Path: UNC Wilmington >> POM >> 572 Fall, 2009
Description: ...
Date Added: 2009-06-07 18:25:01

smsh.pdf
Path: Harvard >> LIB >> 215 Fall, 2009
Description: csci-e215 Assignment 5: small shell Warning This is the one assignment that cannot be the \'drop lowest grade\' assignment. It is essential to any Unix course. It will not be dropped. Introduction A Unix shell is a tool that allows users to manage proc...
Date Added: 2009-06-07 18:25:17

e203fsol.pdf
Path: SUNY Albany >> MATH >> 220 Fall, 2009
Description: Math 220 1. Let A = Exam 2 Solutions 1 1 3 2 1 2 2 2 3 4 3 1 3 6 1 1 7 4 8 1 3 . 2 1 8 5 4 8 3 1 1 7 4 5 10 0 Fall 03 Solution: The starting point is the reduction 1 1 3 2 1 2 2 b1 2 3 4 3 1 3 6 b2 1 1 7 4 8 1 3 b3 2 1 8 5...
Date Added: 2009-06-07 18:29:22

chap13.pdf
Path: Southern Oregon >> P >> 5163 Fall, 2009
Description: Chapter 13 Entropy V Quantum mechanically, we could define the entropy as S = k ln N (E, a), (13.1) where N (E, a) is the number of states with energy E. That is, from Eq. (11.5), E N (E, a) = El E gl = 0 dE (E , a), (13.2) N (E, a) = (E, ...
Date Added: 2009-06-07 18:29:48

scissors.xls
Path: Penn State >> BPB >> 5020 Fall, 2009
Description: Scissors Office Supply Annual Sales Boston Consumer Small Business Large Business Government Nonprofit Total 100% 80% 60% 40% 20% 0% Consumer Small Business Large Business Government Nonprofit Miami $113,861.40 133,511.24 234,036.08 144,548.80 28,83...
Date Added: 2009-06-07 18:30:16

UDPtime.c.txt
Path: Allan Hancock College >> INFT >> 043 Fall, 2009
Description: /* UDPtime.c - main */ #include <sys/types.h> #include <unistd.h> #include <stdlib.h> #include <netinet/in.h> #include <string.h> #include <stdio.h> #include <time.h> #include <errno.h> #define BUFSIZE 64 #define UNIXEPOCH 2208988800UL /* UNIX epo...
Date Added: 2009-06-07 18:30:55

ma163quiz04.pdf
Path: Purdue >> MATH >> 163 Fall, 2009
Description: Math 163 Name: Quiz # 4 1. (5 pts.) The graph of the polynomial function g is given to the right. Find a possible formula for g(x). 1 2 2. (10 pts.) Write one or two paragraphs which could describe to another student the idea of instantaneous r...
Date Added: 2009-06-07 18:35:19

Assignment4.pdf
Path: Wilfrid Laurier >> CPSC >> 587 Fall, 2009
Description: CPSC 587/687 2008 W Assignment 4 (weight: 25% of the total assignment mark) Due date (demo and report): Thursday, April 17 Develop a system for behavioral animation based on particle systems. Implement Reynolds\' model of schools, flocks, and herds. ...
Date Added: 2009-06-07 18:35:30

F_Bahman.doc
Path: WVU >> EE >> 180 Fall, 2009
Description: Resume of Fatemah Bahman Current Address: 2711 Chateau Royal Court Morgantown WV 26505 (304) 319-6699 fbahman@mix.wvu.edu Fatemah Bahman Objective Education Getting B.S Degree in Computer Engineering Now: Senior student in West Virginia University...
Date Added: 2009-06-07 18:39:38

PDF_P0105.pdf
Path: Virginia Tech >> PUBS >> 424 Fall, 2009
Description: Tidewater Ag. Res. & Ext. Ctr. Comparison of Cobra vs. Blazer for Postemergence Weed Control Trial ID: P0105 Protocol ID: Location: Res Farm F21 Study Director: Investigator: Dr. Joel C. Faircloth Pest Code AMBEL CHEAL CYPES Pest Name Ragweed Lambsq...
Date Added: 2009-06-07 18:44:54

mc_asymLS.digitization-v3r1p12_135001566_digi_DIGI.T00.txt
Path: Stanford >> V >> 104 Fall, 2009
Description: 0 0 3.49553 0.0111631 3.58449 0.01695 3.63811 0.0103715 3.67482 0.00985156 3.7212 0.0123497 3.75542 0.00871037 3.85342 0.0103012 3.91617 0.0112342 3.96536 0.00727612 3.9945 0.0111044 0 1 3.38626 0.00697664 3.46123 0.00786816 3.55716 0.00908975 3.6519...
Date Added: 2009-06-07 18:46:40

PDF_table17.pdf
Path: Virginia Tech >> PUBS >> 490 Fall, 2009
Description: Table A17 Number of Farms By Operator Days Worked Off Farm: 1997 Central Central Virginia Amherst Appomattox Bedford Campbell Planning District #11 West Piedmont Franklin Henry Pittsylvania Planning District #12 Southside Brunswick Halifax Mecklenbur...
Date Added: 2009-06-07 18:48:46

YOR374W.t2k.str2-logo.pdf
Path: UCSC >> YOR >> 374 Fall, 2009
Description: YOR374W.t2k STR2 6 5 4 3 2 1 CC S S XXXXXXXXTTXSXSXZXXSGXX XX X X X X X B C C C S STCCZCSSS S T T S T G C CC C 10 C C CC CS T GTGSSSTTTTCCSHHH G SSSS S C T YZCG CC C CTTC X X H C C H C C H C S C T G G X X X X X X X X X CHH HHHHHH XXTT...
Date Added: 2009-06-07 18:55:11

radio.txt
Path: Neumont >> A >> 1170 Fall, 2009
Description: Sony WM323 010 199,99 Kenwood KW1000 110 249,99 Alpine A200 000 49,75 Koss KS600 111 219,99 Sony WM823 010 99,99 Koss KS1111 101 79,98 Kenwood KW1090 100 149,99 Sanyo S1210 010 50,99 Alpine A0325 101 111,3...
Date Added: 2009-06-07 18:58:56

YMR041C.t2k.str2-logo.pdf
Path: UCSC >> YMR >> 041 Fall, 2009
Description: YMR041C.t2k STR2 5 4 3 2 1 CC Z Y S Z H A X 10 20 30 40 Z 5 4 3 2 1 T Z H H S T H T S QPPQPQ 51 Q P CC CP MMMSSSCSSH T C S TT T T XXXXXHH X CCGG Q CT H G H C Q T G S S T S H H H C X X X X X X X X X X X X X X X X X X H 60 70 8...
Date Added: 2009-06-07 19:00:07

YIL070C.t2k.dssp-ebghstl-logo.pdf
Path: UCSC >> YIL >> 070 Fall, 2009
Description: YIL070C.t2k EBGHSTL 3 2 1 C C H H X X X X H E E H H H C H H H H H H X X X X X X X X X X X S H H C C C E T T T E H X X XXXXXXXXXXX C CC CSSC C C S S S S T T T CCC XXCXXCXXXCXXX X X X C C E C C C C C C E E E C H H H H X X X X T S X X ...
Date Added: 2009-06-07 19:00:09

1979v33p149-158-American Statistician-Goodnight-SWEEP-Operator.pdf
Path: Mt. Marty >> PH >> 1971 Fall, 2009
Description: ...
Date Added: 2009-06-07 19:02:15

YMR026C.t2k.dssp-ehl2-logo.pdf
Path: UCSC >> YMR >> 026 Fall, 2009
Description: YMR026C.t2k DSSP-EHL2 2 1 CCC 1 E E H E H H H H H H X X X X X X X X X X 10 20 30 40 S 2 1 T H T S H HHHHHHHHHH C C C X X X X X X X 51 60 70 80 90 T H 2 1 H H C X X C X H T S H T 2 1 E T S H H HHHHHHHHHHHHHHHHH 151 160 C ...
Date Added: 2009-06-07 19:02:25

wireless-physical.ppt
Path: UConn >> CSE >> 5300 Fall, 2008
Description: Wireless Applications 1 Why Wireless? Flexible Low cost Easy to deploy Support mobility 2 Wireless Technologies BW UWB WiFi WiMax 3G Bluetooth RFID range 3 Basics of Wireless Communication Signal Frequency allocation Signal propagation...
Date Added: 2009-06-07 19:03:49

fa06_ex9a.pdf
Path: TCU >> PHYS >> 10153 Fall, 2009
Description: ...
Date Added: 2009-06-07 19:12:29

Quiz4.doc
Path: TN Tech >> CSC >> 2100 Fall, 2009
Description: CSC 2100: Introduction to Problem Solving and Computer Programming September 26, 2008, Quiz 4 Time: 15 minutes 100 Points Name _ 1. [20 Points] What will the following program segment display? int funny = 7, serious = 15; funny = serious % 2; if (fun...
Date Added: 2009-06-07 19:15:59

CH08_FRONTS.pdf
Path: UCSD >> PHYSICS >> 221 Spring, 2009
Description: Chapter 8 Front Propagation 8.1 Reaction-Diffusion Systems We\'ve studied simple N = 1 dynamical systems of the form du = f (u) . dt (8.1) Recall that the dynamics evolves u(t) monotonically toward the first stable fixed point encountered. Now let\'...
Date Added: 2009-06-07 19:18:08

Midterm1Soln.pdf
Path: Maple Springs >> MATH >> 2271 Fall, 2009
Description: ...
Date Added: 2009-06-07 19:22:05

i05_2002ado.pdf
Path: UCSD >> AB >> 139 Fall, 2009
Description: CRUISE REPORT: I05_2002 (Updated FEB 2007) A. HIGHLIGHTS A.1. CRUISE SUMMARY INFORMATION I05_2002 74AB200203 Harry L. Bryden / SOC 2002 MAR 01 2002 APR 15 RRS CHARLES DARWIN Durban, South Africa to Fremantle, Australia 29 23 S Station geographic ...
Date Added: 2009-06-07 19:22:06

Lecture05_06.pdf
Path: NJIT >> PS >> 328 Fall, 2009
Description: The Body Mass Index Calculator CMP 328 Object Oriented Programming in Java Lecture 05 & 06: Manipulating Data Using Methods Professor Peichung Shih An interactive program Accepts the weight and height from the user Calculates the BMI to gauge ...
Date Added: 2009-06-07 19:28:06

FINAL+ROBERTSON+SCHOLARS+(2d)+Summer+Cultural+Immersion+Prog+assum+of+risk2009+-+v3.DOC
Path: UNC >> READ >> 5079105 Fall, 2009
Description: [In Duplicate] Robertson Scholars Program Summer Cultural Immersion Program [S. Africa, Argentina, Sierra Leone] Assumption of Risk, Health Disclosure and Release Agreement For Students Participating in the Robertson Scholars Summer Cultural Immers...
Date Added: 2009-06-07 19:30:03

Jan28.doc
Path: UNC >> READ >> 3779258 Fall, 2009
Description: RUF Cabinet Meeting January 28, 2007 Attendance: All cabinet members were present Welcome and Preliminary Notes If you have any proposals / topics for discussion, e-mail Chris with a brief summary, including time, by the Friday before the cabinet me...
Date Added: 2009-06-07 19:32:17

kasm_man.ps
Path: UCSC >> CMPE >> 220 Fall, 2008
Description: %!PS-Adobe-2.0 %Creator: dvips(k) 5.86 Copyright 1999 Radical Eye Software %Title: kasm_man.dvi %Pages: 38 %PageOrder: Ascend %BoundingBox: 0 0 612 792 %EndComments %DVIPSWebPage: (www.radicaleye.com) %DVIPSCommandLine: dvips kasm_man -o %DVIPSParame...
Date Added: 2009-06-07 19:34:33

edo20.txt
Path: Old Dominion >> CS >> 2673 Fall, 2009
Description: 1984 -George Orwell SUNDAY, NOV 14, 1993 Summary Chapter 1 and 2 We are introduced to Winston Smith the main character of the story. Works at Ministry of truth. Ministry of truth is one of four government buildings in destroyed London, the main city...
Date Added: 2009-06-07 19:35:42

assess.environ.strengths.2009.ppt
Path: Illinois State >> KNR >> 279 Spring, 2008
Description: Assessment Batteries Triangulation Social Skills Assessment Environment Assessment StrengthsBased Assessment Terms Battery Triangulation Several assessments used together Variety of assessment methods Variety of assessment data Varie...
Date Added: 2009-06-07 19:36:56

Electrostatics.pdf
Path: East Los Angeles College >> PHYS >> 20141 Fall, 2009
Description: 10 October 2007 08:48 Electrostatics Page 1 10 October 2007 08:34 Electrostatics Page 2 10 October 2007 08:50 Electrostatics Page 3 10 October 2007 08:54 Electrostatics Page 4 10 October 2007 08:56 Electrostatics Page 5 10 October 2007 08:5...
Date Added: 2009-06-07 19:38:04

Worksheet 19 - Using Derivative Rules.doc
Path: Arizona >> MATH >> 124 Fall, 2008
Description: Worksheet 19 - DERIVATIVE RULES _ Name: Use the values in the table below to answer the following: x 0 1 2 3 f ( x) 0 3 1 2 g ( x) 1 2 0 3 h( x ) 2 1 3 0 f ( x) -1 2 -2 4 g ( x) 4 -2 3 2 h( x) -5 -4 5 -3 f ( x) 0 -4 1 2 1. Determine if y = f ( x) ...
Date Added: 2009-06-07 19:38:27

C14BonusAS05.pdf
Path: Illinois State >> CHE >> 232 Fall, 2008
Description: Chapter 14 Bonus Sheet A Chapter 14: Reaction Mix 1) Give the major organic products for the following reactions. CN a) CN b) Br KOH c) HBr 25oC d) Br2 CCl4 e) Cl2 CCl4 f) Cl2 400oC ...
Date Added: 2009-06-07 19:39:33

War%2BRequiem%2BPresentation.ppt
Path: Amherst >> MEDIA >> 39866 Fall, 2009
Description: Why Did You Decide t o Par t icipat e in t he D.C. Peace Rally L ast Febr uar y (2007)? \"I w as heavily involved w ith peace club and the peace movement, I thought going to Washington D C w ould be a gr eat w ay to pr otest the w ar and the cur r ent...
Date Added: 2009-06-07 19:44:19

jeremy-prop.pdf
Path: Minnesota >> MA >> 4901 Fall, 2009
Description: Project Proposal Jeremy Davis Sierpinski Fractals and Their Maximal Hausdorff Dimension Advisor: Byungik Kahng Second Reader: Mark Logan (if available/willing) General Area: Sierpinski Fractals Specific Topic: Analytic Definition of Maximal Contracti...
Date Added: 2009-06-07 19:45:08

Lecture18.ppt.pdf
Path: East Los Angeles College >> C >> 1002 Fall, 2009
Description: GENETICS Lecture 18: Aneuploidy and Dosage Compensation Reading for Lecture 18 Griffiths (8th) pp 323, 495-502 Griffiths (7th) pp 524-540 Edwards syndrome Associated with trisomy of chromosome 18 Incidence: 1/6000 newborns 98% fetuses alive at 10...
Date Added: 2009-06-07 19:45:38

output.txt
Path: Washington >> V >> 11740 Fall, 2009
Description: = running on = COMPUTERNAME=PHYSLAB-725QNB1 - local directory - Volume in drive C has no label. Volume Serial Number is 9843-D647 Directory of C:\\condor\\execute\\dir_2084 12/03/2007 04:34 PM <DIR> . 12/03/2007 04:34 ...
Date Added: 2009-06-07 19:50:36

log.txt
Path: Washington >> V >> 11830 Fall, 2009
Description: 000 (26375.000.000) 12/03 13:19:18 Job submitted from host: <128.95.94.28:4757> . 001 (26375.000.000) 12/03 17:48:27 Job executing on host: <172.25.101.179:1056> . 006 (26375.000.000) 12/03 18:08:35 Image size of job updated: 430324 . 005 (26375.000....
Date Added: 2009-06-07 19:51:22

34_DanniD.pdf
Path: Allan Hancock College >> LINKS >> 131 Fall, 2009
Description: Canberra Inter-City Train Station DANNI NASH The eclectic urban plan of Australias capital city, Canberra, is fundamentally the product of political indecision and an indifferent populace. Yet in central Canberra, the site, built fragments deantly a...
Date Added: 2009-06-07 19:52:14

mem.pdf
Path: Allan Hancock College >> COMP >> 3300 Fall, 2009
Description: Introduction Memory Management Utilization is improved by having many processes share the CPU. This requires memory management. There is a variety of memory management approaches. The approach used by an operating system is limited by the available...
Date Added: 2009-06-07 19:54:38

s10.ppt
Path: UNI >> CNS >> 161 Fall, 2009
Description: Review - Homework #1 Solve the \"Jewel Problem\" 9 jewels in a 3x3 grid. Three jewel types (D/R/E) Casting a spell at a jewel \"rotates\" it one type. Casting a spell also changes the jewels immediately adjacent. Goal is to get the whole grid to sa...
Date Added: 2009-06-07 20:01:03

s29.ppt
Path: UNI >> CNS >> 062 Fall, 2009
Description: Session 29 Object Recursion-continued Review Fill in the blank: public class BinaryTree { private int value; private BinaryTree leftTree; private BinaryTree rightTree; public BinaryTree( int nodeValue, BinaryTree leftChild, BinaryTree rightChild ) {...
Date Added: 2009-06-07 20:02:58

C3A3.pdf
Path: Illinois State >> CHE >> 220 Fall, 2008
Description: CHE 220 Chapter 3 Sheet 3 Intermolecular & Intramolecular Forces 1) What is the major intermolecular force that is in effect for each of the following compounds? OH a) b) c) ONa OH London Dispersion d) Hydrogen Bonding e) f) Ionic HO NaCl onic ...
Date Added: 2009-06-07 20:06:25

WASTED ENERGY copy.pdf
Path: San Diego State >> ART >> 441 Fall, 2008
Description: WASTED ENERGY Everybody Else U.S. Exports & Non-Fuel U.S. Useful Energy U.S. Wasted Energy ...
Date Added: 2009-06-07 20:08:41

Fall2008syllabus.pdf
Path: Clemson >> M >> 390 Fall, 2009
Description: Syllabus MTHSC 108 For Biologists James Peterson Department of {Biological and Mathematical} Sciences Timothy Teitlo Department of Mathematical Sciences Clemson University August 18, 2008 COURSE TITLE SECTION INSTRUCTOR COURSE TIME COURSE ROOM OFFICE...
Date Added: 2009-06-07 20:10:32

I320-18.ppt
Path: Christian Brothers >> I >> 320 Fall, 2009
Description: 1 8 Generics 1 1992-2007 Pearson Education, Inc. All rights reserved. 2 Every man of genius sees the world at a different angle from his fellows. Havelock Ellis our special individuality, as distinguished from our generic humanity. Oliver W...
Date Added: 2009-06-07 20:11:19

MATH2750-2006ans.pdf
Path: East Los Angeles College >> MATH >> 2750 Fall, 2009
Description: School of Mathematics MATH2750: Introduction to Markov Processes Answers and Hints to the Exam Paper May-June 2006 1. (a) Lecture notes. (b) Transition probability matrix: 0.3 0.7 0.6 0.7 0 P = 0.2 0 (c) Transition probability matrix: 1 4 P...
Date Added: 2009-06-07 20:11:23

ISSS09USStudPreArrivalr.pdf
Path: Middlebury >> AE >> 15688 Fall, 2009
Description: U.S. Students Abroad Version Middlebury College International Student Pre-Arrival Guide Information for New International Students entering Middlebury during Academic Year 2009 /2010 International Student and Scholar Services March 2009 Middlebur...
Date Added: 2009-06-07 20:12:13

comp30.pdf
Path: San Diego State >> ART >> 344 Fall, 2008
Description: x x x 1. 2. 3. 4. x x x x x x x x x x x x x x x x x x x x x x 241_Graphic Design I : Spring 2009 : Tim Garcia ...
Date Added: 2009-06-08 06:30:41

Project3_step1_LINES1.pdf
Path: San Diego State >> ART >> 344 Fall, 2008
Description: 241_Project 3_Matt Culver principle(s): principle(s): principle(s): principle(s): principle(s): principle(s): ...
Date Added: 2009-06-08 06:31:20

TermsMatching.doc
Path: N.E. Illinois >> UX >> 4340 Fall, 2009
Description: PED 4340 Exercise Physiology TERMS FOR FINAL EXAM Below is a list of 39 terms, 25 of which will be used on the final exam in a matching format. The 25 terms will listed along with 30 definitions or phrases that describe the terms, therefore, not all ...
Date Added: 2009-06-08 06:33:40

Instructor_Ch_07.ppt
Path: Cleveland State >> IST >> 305 Fall, 2009
Description: CHAPTER 7 NETWORKS, TELECOMMUNICATIONS, AND WIRELESS COMPUTING Opening Case The Digital Hospital McGrawHill/Irwin 2008 The McGrawHill Companies, All Rights Reserved 7-2 Chapter Seven Overview SECTION 7.1 NETWORKS AND TELECOMMUNICATIONS Net...
Date Added: 2009-06-08 06:36:24

Snyder_resume.pdf
Path: Drexel >> TS >> 434 Fall, 2009
Description: Tracey F. Snyder ts434@drexel.edu 4935 Spruce St. A-27 Philadelphia, PA. 19139 215-715-2445 www.traceysnyder.com Education Drexel University Bachelor of Science in Graphic Design Cumulative GPA...
Date Added: 2009-06-08 06:37:37

YIR037W.t2k.str2-logo.pdf
Path: UCSC >> YIR >> 037 Fall, 2009
Description: YIR037W.t2k STR2 7 6 5 4 3 2 1 C S TXXXXXXXX X G A M CCCCCCCZ S C SSTTZQCYZ SSY G B QM S YMBQSS G Z Z C X ZAZ AYA Q C X 1 10 20 30 40 Z A Z 7 6 5 4 3 2 1 T S Z Y Z G T M Q Q S H QPPQPQQ HH TTCQ S T G H X X X X X X X HH P TGCQS...
Date Added: 2009-06-08 06:46:06

ME413_Session38_Spr09.pdf
Path: Idaho >> ME >> 413 Spring, 2008
Description: ...
Date Added: 2009-06-08 06:46:31

sect3vectorH.ps
Path: Duke >> X >> 100 Fall, 2009
Description: %!PS-Adobe-2.0 %Creator: dvipsk 5.58f Copyright 1986, 1994 Radical Eye Software %Title: sect3vectorH.dvi %Pages: 3 %PageOrder: Ascend %BoundingBox: 0 0 612 792 %DocumentPaperSizes: Letter %EndComments %DVIPSCommandLine: dvips sect3vectorH %DVIPSParam...
Date Added: 2009-06-08 06:59:49

coins.txt
Path: Harvey Mudd College >> CS >> 189 Fall, 2005
Description: Unequal Coins (coins.X) Bessie has discovered treasure buried at the farm! The long-buried chest contains N coins (1 <= N <= 1,000) numbered 1.N. Farmer Ran, wanting to determine how many distinct coin types are in the find, has conducted W (1 <= ...
Date Added: 2009-06-08 07:01:52

sampleOutput.txt
Path: UMBC >> CSEE >> 201 Spring, 2007
Description: Script started on Tue Apr 5 12:28:06 2005 linux3[72] % a.out Your Greeting and explanation of the simulation goes here Enter the seed for the random number generator: 1 Enter the number of time clicks per interval: 1 Enter the number of time clicks ...
Date Added: 2009-06-08 07:02:17

L10.pdf
Path: Michigan State University >> PHY >> 971 Spring, 2008
Description: ...
Date Added: 2009-06-08 07:06:13

L10.pdf
Path: Michigan State University >> PHY >> 871 Fall, 2009
Description: ...
Date Added: 2009-06-08 07:06:33

Stravinsky.doc
Path: Penn State >> PMT >> 113 Fall, 2009
Description: Apollon Musagtes: a \"Classic\" Ballet by Phillip Torbert April 12, 2001 Introduction In the late spring of 1927, Igor Stravinsky was offered a commission from the Elizabeth Sprague Coolidge Foundation to compose the music for a short ballet to b...
Date Added: 2009-06-08 07:06:54

design_theory_2.pdf
Path: Arizona >> PRES >> 517 Fall, 2009
Description: Application of Design Theory for GIS Understanding Symbolization and Graphic Production Introduction When using a geographic information system to produce maps or visualize data in a softcopy format, fundamental principles of design will apply. Many...
Date Added: 2009-06-08 07:06:59

ch27.ppt
Path: St. Rose >> CIS >> 321 Fall, 2009
Description: XML: Extensible Markup Language Chapter Outline Introduction Structured, Semi structured, and Unstructured Data. XML Hierarchical (Tree) Data Model. XML Documents, DTD, and XML Schema. XML Documents and Databases. XML Querying. XPath XQue...
Date Added: 2009-06-08 07:10:46

xml.ppt
Path: St. Rose >> CIS >> 321 Fall, 2009
Description: XML: Extensible Markup Language Chapter Outline Introduction Structured, Semi structured, and Unstructured Data. XML Hierarchical (Tree) Data Model. XML Documents, DTD, and XML Schema. XML Documents and Databases. XML Querying. XPath XQue...
Date Added: 2009-06-08 07:10:46

rap_sounding_data.pdf
Path: Minnesota >> GEOG >> 1425 Fall, 2008
Description: University of Wyoming - Radiosonde Data 10/12/2007 11:20 AM 72662 RAP Rapid City Observations at 00Z 30 Jun 2005 -PRES HGHT TEMP DWPT RELH MIXR DRCT SKNT THTA THTE THTV hPa m C C % g/kg deg knot K K K -1000.0 65 925.0 745 895.0 1029 19.6 7.6 46 7.3...
Date Added: 2009-06-08 07:12:17

chap-7.doc
Path: Penn State >> ARB >> 5198 Fall, 2009
Description: Alyssa Blystone 101408 MIS 201 1. How Are Microfilm and Microfiche Used? Microfilm is a 100- to 215-foot roll of film. Microfiche is a small sheet of film, usually about 4 X 6 inches. Libraries use microfilm and microfiche to store back issues of ...
Date Added: 2009-06-08 07:12:24

ellenkim1.txt
Path: Princeton >> COS >> 325 Fall, 2009
Description: ellenkim1.wav by Ellen Kim, 2/11/09 The first \"movement\" uses brass22.wav three times like a round, but with each successive entrance timeshif\'ed a little more. The second brief section uses a section from srconvrt\'ed Trump44.wav with fading. The...
Date Added: 2009-06-08 07:16:34

abop.pdf
Path: Swarthmore >> PHYS >> 120 Fall, 2009
Description: Aristid Lindenmayer 19251989 Przemyslaw Prusinkiewicz Aristid Lindenmayer The Algorithmic Beauty of Plants With James S. Hanan F. David Fracchia Deborah Fowler Martin J. M. de Boer Lynn Mercer With 150 Illustrations, 48 in Color This edition of Th...
Date Added: 2009-06-08 07:16:56

Midterm.I.pdf
Path: Reed >> PHYSICS >> 100 Fall, 2009
Description: ...
Date Added: 2009-06-08 07:17:10

BTREES.PPT
Path: Clayton >> ITSD >> 4312 Fall, 2009
Description: B-Trees B-Trees 1 Motivation for B-Trees Index structures for large datasets cannot be stored in main memory Storing it on disk requires different approach to efficiency Assuming that a disk spins at 3600 RPM, one revolution occurs in 1/60 of a...
Date Added: 2009-06-08 07:17:29

BTREES2.PPT
Path: Clayton >> ITSD >> 4312 Fall, 2009
Description: BTREE Indices A little context information What\'s the purpose of an index? Example of web search engines Example google.com Queries do not directly search the WWW for data; Rather, an index is searched, and then go directly to the d...
Date Added: 2009-06-08 07:17:30

Change_and_Continuity-fin.EUSA-2005.txt
Path: Pittsburgh >> AEI >> 3045 Fall, 2009
Description: Change and Continuity: The Adaptation of Austrian Consociationalism To New Realities Paper prepared for the European Union Studies Association Conference in Austin, Texas Panel 10H Saturday April 2, 2005 Reinhard Heinisch University of Pittsbu...
Date Added: 2009-06-08 07:18:52

hw2.pdf
Path: Sanford-Brown Institute >> CS >> 167 Fall, 2009
Description: CS167 Homework Assignment 2 Due: 11:59pm, October 15, 2008 1. In Unix systems, as shown in slide VIII-27 and on text page 4-7, the processing of the erase character (typically backspace) is done in the interrupt context. In some other systems, most n...
Date Added: 2009-06-08 07:20:33

kern.pdf
Path: Sanford-Brown Institute >> CS >> 167 Fall, 2009
Description: Kernel 1 1 CS169 Programming Assignment 1: Kernel 1 Drivers and Initialization Assignment Out: Assignment Due: Monday, 22 Sept. 2008 Monday, 29 Sept. 2008 (11:59 pm) 1 The Assignment Before reading this, make sure that you read the other hando...
Date Added: 2009-06-08 07:20:38

ep.17.pdf
Path: Pittsburgh >> AEI >> 8972 Fall, 2009
Description: The Coming Energy Crash and its Impact on the European Union EGMONT PAPER 17 THE COMING ENERGY CRASH AND ITS IMPACT ON THE EUROPEAN UNION Franklin DEHOUSSE BRUSSELS, February 2008 The Egmont Papers are published by Academia Press for Egmont The ...
Date Added: 2009-06-08 07:29:52

Project3_step1_LINES1.pdf
Path: San Diego State >> ART >> 448 Spring, 2008
Description: 241_Project 3_Matt Culver principle(s): principle(s): principle(s): principle(s): principle(s): principle(s): ...
Date Added: 2009-06-08 07:39:37

j12.pdf
Path: Texas El Paso >> MATH >> 0002 Fall, 2009
Description: College of Science Bell Hall 100 747-5536 The University of Texas at El Paso El Paso, Texas 79968-0509 Updates: Bachelor of Science Degree Plan Psychology - Chemistry Minor (128/45) Name Psychology Major \"C\" grades in Math courses & Core Curriculu...
Date Added: 2009-06-08 07:49:19

sm3_37.pdf
Path: UC Davis >> EME >> 165 Winter, 2008
Description: Excerpts from this work may be reproduced by instructors for distribution on a not-for-profit basis for testing or instructional purposes only to students enrolled in courses for which the textbook has been adopted. Any other reproduction or translat...
Date Added: 2009-06-08 07:53:40

001808_1.pdf
Path: Pittsburgh >> AEI >> 5404 Fall, 2009
Description: ...
Date Added: 2009-06-08 07:55:04

001819_1.pdf
Path: Pittsburgh >> AEI >> 5359 Fall, 2009
Description: ...
Date Added: 2009-06-08 07:55:10

partenring.pdf
Path: Toledo >> CIV >> 1278 Fall, 2009
Description: PARTNERED PROJECT PERFORMANCE IN TEXAS DEPARTMENT OF TRANSPORTATION By Kenneth M. Grajek,1 G. Edward Gibson Jr.,2 Members, ASCE, and Richard L. Tucker,3 Fellow, ASCE ABSTRACT: Partnering traditionally refers to strategic alliances or agreements betwe...
Date Added: 2009-06-08 07:59:59

wessels-w-12c.pdf
Path: Pittsburgh >> AEI >> 8065 Fall, 2009
Description: The European Council in Theoretical Perspectives: The Principals on a Fusion Path Wolfgang Wessels and Verena Schfer Jean Monnet Chair, University of Cologne w.wessels@uni-koeln.de verena.schaefer@uni-koeln.de Paper presented at the Tenth Biennial ...
Date Added: 2009-06-08 08:00:39

ENGL310D01.TXT
Path: Sveriges lantbruksuniversitet >> ENGL >> 20023 Fall, 2009
Description: Sheet1 PROFILE OF STUDENTS IN SFU COURSES COURSE: ENGL 310-4 D01 TITLE: DRAMA TO 1642 SEMESTER: 2002-3 LOCATION: SFU SECTION TYPE: LEC ENROL: 23 = PROGRAM OF STUDENT (Top 5 programs reported in each category Programs with < 3 students not shown sepa...
Date Added: 2009-06-08 08:01:50

73514_1.pdf
Path: Pittsburgh >> AEI >> 10543 Fall, 2009
Description: ...
Date Added: 2009-06-08 08:03:26

sample_e2_key.pdf
Path: USC >> CHEM >> 105 Fall, 2009
Description: Chemistry 105 A Exam 2 03/03/09 Dr. Potter First Letter of last Name PLEASE PRINT YOUR NAME IN BLOCK LETTERS Name: _ Last 4 Digits of USC ID:_ _ _ _ Lab TA\'s Name: _ Lab: W 1 / W 4 / Th 9 / Th 1 / Th 4 Please circle lab section above. Question 1 ...
Date Added: 2009-06-08 08:03:27

191q102.pdf
Path: CSB-SJU >> PHYSICS >> 191 Fall, 2009
Description: PHYS 191 Fall 2002 Quiz 1 Walking across a bridge, I find myself 80 m above the water. If I throw a stone straight down as hard as I can, I find it hits the water 2 seconds later. What is the speed of my throw? (g =9.8 m/s2) PHYS 191 Fall 2002 Qu...
Date Added: 2009-06-08 08:04:52

Assig_1_06S.pdf
Path: UCLA >> LX >> 110 Fall, 2009
Description: LINGUISTICS 110, Spring 2006 Assignment 1 Name: KEY Section: Score: out of 20 I. (8 points) The last page of this assignment has lists of words for 8 languages labeled A-H. On the basis of lexical resemblances, place languages A-H within the trees w...
Date Added: 2009-06-08 08:15:48

2007611_r01x_053395.pdf
Path: Stanford >> MERQE >> 1035 Fall, 2009
Description: Case 5:05-cv-03395-JF Document 310 Filed 06/11/2007 Page 1 of 1 Labaton Sucharow June 11, 2007 LOUIS GOYMIEB PARTNER Direct Dial: (212) 907-0872 Direct Fax: (212) 883-7072 Igotdieb@labaton.com The Honorable Jeremy Fogel United States District ...
Date Added: 2009-06-08 08:17:17

GEOG412D01.TXT
Path: Sveriges lantbruksuniversitet >> GEOG >> 20013 Fall, 2009
Description: Sheet1 PROFILE OF STUDENTS IN SFU COURSES COURSE: GEOG 412-4 D01 LOCATION: SFU TITLE: GLACIAL PROCESSES SECTION TYPE: LEC SEMESTER: 2001-3 ENROL: 6 = PROGRAM OF STUDENT (Top 5 programs reported in each category) -Approved Intended Approved Certs, Maj...
Date Added: 2009-06-08 08:19:21

CombEnd-To-End-Scheduling.ppt
Path: Washington University in St. Louis >> CS >> 6874 Fall, 2009
Description: End-To-End Scheduling Distributed Systems Seminar, Spring 2003 Angelo Corsaro & Venkita Subramonian Department of Computer Science Washington University Prolog Distributed Real-Time Systems The key characteristics of Distributed RealTime Systems ...
Date Added: 2009-06-08 08:19:30

lec23.pdf
Path: Georgia Tech >> ECE >> 6606 Fall, 2008
Description: Lecture 23: Tuesday March 31, 2009 Today Reed-Solomon Decoding: The Welch-Berlekamp Algorithm 403 Example 1: Common RS Code q = 256 typical because of byte-oriented computers length n = 255 symbols (2040 bits) is typical Ex 1: t = 10 dmin = 2t ...
Date Added: 2009-06-08 08:28:54

packages.ppt
Path: NJIT >> CIS >> 620 Fall, 2009
Description: CIS 602 Java and the Web Packages Written part of final exam Alex Rudniy NJIT Packages To make types easier to find and use, to avoid naming conflicts, and to control access, programmers bundle groups of related types into packages. Definition:...
Date Added: 2009-06-08 08:34:35

2005929_r02o_042297.pdf
Path: Stanford >> OVTI >> 1031 Fall, 2009
Description: 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 DOUGLAS J. CLARK, State Bar No. 171499 JARED L. KOPEL, State Bar No. 126817 CAMERON P. HOFFMAN, State Bar No. 229316 WILSON SONSINI GOODRICH & ROSATI Professional Corporation...
Date Added: 2009-06-08 08:36:51

DesignSpecsFinal.doc
Path: CSB-SJU >> JK >> 282358 Fall, 2009
Description: Software Design Specification: PhillyRock.com (Tentative Name) Mallory Cosfol and Jeff Knauss Professor Suzan Kknar-Tezel CSC 5205-331 February 14, 2008 1 Table of Contents About This Specification Overview User Pages 3 4 5 3 Site Administrator P...
Date Added: 2009-06-08 08:50:36

l12.pdf
Path: Duke >> CPS >> 100 Fall, 2009
Description: Binary Trees Linked lists: efficient insertion/deletion, inefficient search ArrayList: search can be efficient, insertion/deletion not Binary trees: efficient insertion, deletion, and search trees used in many contexts, not just for searching, e...
Date Added: 2009-06-08 08:50:58

b1g3_transcript.doc
Path: Virgin Islands >> SENG >> 310 Fall, 2009
Description: TranscriptofInterview Group#:3 Lab#:1 Names:MattPisto,MarkDevine,JulieSparrow,StevePennington,JuanZepeda 1. HowlonghaveyoubeenteachingatUVic? a. 0:31 b. Since2001. 2. Whatcoursesdoyouteach? a. 0:43 b. Firstyearchemistry. 3. Whatsizeareyourclasses? a...
Date Added: 2009-06-08 08:51:10

mbis-flyer-2008.pdf
Path: Allan Hancock College >> INFOTECH >> 3343 Fall, 2009
Description: Master of Business Information Systems program Faculty of Information Technology The Master of Business Information Systems (MBIS) is a program which prepares students with previous qualifications in any discipline, for careers in IT management, appl...
Date Added: 2009-06-08 08:52:17

mbis-flyer-2008.pdf
Path: Allan Hancock College >> INFOTECH >> 3345 Fall, 2009
Description: Master of Business Information Systems program Faculty of Information Technology The Master of Business Information Systems (MBIS) is a program which prepares students with previous qualifications in any discipline, for careers in IT management, appl...
Date Added: 2009-06-08 08:52:18

mbis-flyer-2008.pdf
Path: Allan Hancock College >> INFOTECH >> 3342 Fall, 2009
Description: Master of Business Information Systems program Faculty of Information Technology The Master of Business Information Systems (MBIS) is a program which prepares students with previous qualifications in any discipline, for careers in IT management, appl...
Date Added: 2009-06-08 08:52:18

mbis-flyer-2008.pdf
Path: Allan Hancock College >> INFOTECH >> 3346 Fall, 2009
Description: Master of Business Information Systems program Faculty of Information Technology The Master of Business Information Systems (MBIS) is a program which prepares students with previous qualifications in any discipline, for careers in IT management, appl...
Date Added: 2009-06-08 08:52:19

06 - sets.pdf
Path: Allegheny >> CS >> 173 Fall, 2009
Description: A set is an unordered collection of objects, called its elements. {Groucho, Chico, Harpo, Zeppo, Gummo} = {Chico, Groucho, Harpo, Gummo, Zeppo} = {Groucho, Gummo, Harpo, Chico, Harpo, Groucho, Groucho, Zeppo} Some famous sets: The suits {, , , } ...
Date Added: 2009-06-08 08:55:50

09 - infinity.pdf
Path: Allegheny >> CS >> 173 Fall, 2009
Description: Can you arrange the following sets from smallest to largest? Integers (Z) Even integers Multiples of 3 Perfect squares Prime numbers Integer powers of 2 Non-negative integers (N) Pairs of integers (Z Z) Rational numbers (Q) Functions from {, , , } t...
Date Added: 2009-06-08 08:55:50

agenda20071214-1a.pdf
Path: Arkansas >> GRAD >> 20071214 Fall, 2009
Description: ATTACHMENT 1A Academic Policy Series 1622.20A Formatted: Centered ADD, CHANGE OR DELETE UNIT, PROGRAM REQUIREMENTS, OR ACADEMIC POLICIES Complete this form consistent with the instructions in Academic Policy 1622.20. Use the form to add, change, or...
Date Added: 2009-06-08 09:01:08

psat_ps4_barplots_wrap_plan02c_February.pdf
Path: UC Riverside >> CERT >> 308 Fall, 2009
Description: PSAT MAP 1800 1584 1368 1152 936 720 504 288 72 2 -144 -360 -576 -792 -1008 -1224 -1440 -1656 -1872 -2088 -2736 -2412 -2088 -1764 -1440 -1116 -792 -468 -144 180 504 828 1152 1476 1800 2124 2448 17 14 16 1 7 16 15 6 11 9 4 13 10 15 3 16 12 5 8 14 18 1...
Date Added: 2009-06-08 09:05:34

sect9ainherH.pdf
Path: Duke >> X >> 100 Fall, 2009
Description: CPS 100E - Program Design and Analysis I Prof. Rodger Section: Inheritance handout Read W4 What is inheritance? extending\" another class subclass inherits data and member functions of superclass What is Polymorphism? allows an object to hold severa...
Date Added: 2009-06-08 09:07:29

JavaHTP7e_18.ppt
Path: Western Kentucky University >> CS >> 240 Spring, 2008
Description: 1 8 Generics 1 1992-2007 Pearson Education, Inc. All rights reserved. 2 Every man of genius sees the world at a different angle from his fellows. Havelock Ellis our special individuality, as distinguished from our generic humanity. Oliver W...
Date Added: 2009-06-08 09:15:11

ReAdmissionApplication.pdf
Path: Findlay >> NR >> 13449 Fall, 2009
Description: FINDLAY THE UNIVERSITY OF FINDLAY APPLICATION FOR RE-ADMISSION Graduate & Professional Studies Office ~ 1000 North Main Street ~ Findlay, Ohio 45840-3695 419-434-4600 ~ 1-800-558-9060 I am applying for re-admission for the academic year _ - _, star...
Date Added: 2009-06-08 09:15:44

lec20.pdf
Path: Towson >> TRITON >> 483 Fall, 2009
Description: A N I NCREMENTAL A PPROACH (H, c ) is a linear program H = {h1 , h2 , . . . , hn } is the set of constraints/half-planes Incrementally build up Ci , - intersection of first i half-planes. C0 C1 C2 . . . Cn Cn = C - feasible region. if Ci = for s...
Date Added: 2009-06-08 09:19:19

ENVS3600.notes.10.31.pdf
Path: Western Michigan >> ENVS >> 360 Fall, 2009
Description: Dave Parnell Oct 31 Notes Kalamazoo Water Shed Cleanup Kalamazoo water shed river area empties into Lake Michigan. 50 kilograms of PCBs going into Lake Michigan from Kalamazoo river (this factor is under debate) Kalamazoo river water she...
Date Added: 2009-06-08 09:20:01

ListsW03.pdf
Path: Michigan >> PERSONAL >> 102 Fall, 2009
Description: Things You Like Best Top Fifteen book relates to real world WSJ discussions interesting professor lectures homework GSI learning about economy well organized content lectures follow textbook material web site # 29 24 18 17 15 14 11 10 8 7 7 6 6 6 6 #...
Date Added: 2009-06-08 09:21:04

Sci103.S2007.Syllabus.pdf
Path: MSU Billings >> SCI >> 103 Fall, 2009
Description: Integrated Science (Sci 103) Spring 2007 Lecture: MWF 10:30-11:30 Library Conference Room Dr. Jim Barron Office hours: Rm. 132 Science Hall MWF 11:30 12:30 (or by appointment or walk in anytime) Ph. 657-2918 Email: jbarron@msubillings.edu Dr. John ...
Date Added: 2009-06-08 09:25:07

CHEM6551XRAY.ppt
Path: UVA >> EHS >> 551 Fall, 2009
Description: Unknown at first, these photons from innershell transitions have played a vital role in materials analysis X-Ray Generation Where do X-Rays come from? Source of X-rays as vacancy filled by cascade of electrons from lower energy levels X-Ray Gener...
Date Added: 2009-06-08 09:27:34

ResultsW02.pdf
Path: Michigan >> PERSONAL >> 102 Fall, 2009
Description: Difficulty 80 70 60 50 40 30 20 10 0 Way too easy Too easy Just right Too hard Way too hard Pace 100 90 80 70 60 50 40 30 20 10 0 Way too slow Too slow Just right Too fast Way too fast Content 100 90 80 70 60 50 40 30 20 ...
Date Added: 2009-06-08 09:28:22

hw6.pdf
Path: University of Illinois, Urbana Champaign >> CS >> 273 Spring, 2008
Description: University of Illinois at Urbana-Champaign Department of Computer Science Homework Assignment 6 CS 273 Introduction to Theoretical Computer Science Fall Semester, 2003 Due: Friday, December 12, 12:30pm at the TA Office(3011 SC) Please read the comm...
Date Added: 2009-06-08 09:33:27

YMR031W-A.t2k.dssp-ebghstl-logo.pdf
Path: UCSC >> YMR >> 031 Fall, 2009
Description: YMR031W-A.t2k EBGHSTL 3 2 1 CC X CC E S H H B X X XXX C C H E H H X X X X H H H H H H X X X X X X X X H H HHHHHX XXXXX G G H C H T C S H S S C C C H S H T E H H E H C H C C E C H E H E X X X X X X X X X X X X X X X X X X X X X X X X E ...
Date Added: 2009-06-08 09:36:49

YMR030W.t2k.alpha-logo.pdf
Path: UCSC >> YMR >> 030 Fall, 2009
Description: YMR030W.t2k ALPHA 2 1 E H E B A X X XXXXXXX B EHH B G S I I S H D I T E CB D S H H X X X XX E E E XXEXXXXXXXBXX X X B S B H H BC E S S C D B H E B A EA E B A E A H E T C H H X XXXXXXXXXX H B E SE B I E B C CE B I S G B B E ...
Date Added: 2009-06-08 09:37:48

sol4.pdf
Path: Purdue >> MATH >> 6121 Fall, 2009
Description: Solutions to Assignment 4 1. Let G be a finite, abelian group written additively. Let x = subgroup of G defined by G2 = {g G|2g = 0}. (a) Show that x = gG2 gG g, and let G2 be the g. (b) Show that x = 0 if |G2 | = 2. If |G2 | = 2, show that x is ...
Date Added: 2009-06-08 09:40:45

MidtermS01.pdf
Path: Virgin Islands >> EXAMS >> 204 Fall, 2009
Description: ECONOMICS 204 (S01) MIDTERM FEB 14 2008 TO BE ANSWERED IN BOOKLETS THERE ARE FOUR QUESTIONS. DURATION: 50 MINUTES INSTRUCTOR: ALAN MEHLENBACHER TOTAL POINTS: 100. Rules: 1) 2) 3) 4) 5) Tips: You must have your student ID with you. Books, notes, cal...
Date Added: 2009-06-08 09:50:36

hw3sol.pdf
Path: Washington University in St. Louis >> CSE >> 260 Fall, 2009
Description: CS/EE 260M Homework 3 Solutions 1. (MK 2-16) Simplify the following Boolean functions by means of a four-variable map: (a) F(A,B,C,D) = \'m (1,5,9,12,13,15) (b) F(W,X,Y,Z) = \'m (1,3,9,11,12,13,14,15) (c) F(A,B,C,D) = \'m (0,2,4,5,6,7,8,10,13,15) (a) F...
Date Added: 2009-06-08 09:56:46

08-bbq-notes.pdf
Path: Duke >> X >> 296 Fall, 2009
Description: Model-Driven Processing in Sensor Networks Jun Yang CPS 296.1, Spring 2007 Sensor Data Processing With contents from C. Guestrin Announcements (Feb. 6) The first round of presentations finalized Watch your email inbox today 2 Readings for Thursday...
Date Added: 2009-06-08 09:57:10

post_lecture10_ats762_aq.ppt
Path: Colorado State >> ATS >> 762 Fall, 2009
Description: AIR QUALITY AND CLIMATE TOPICS FOR TODAY 1. What are we worried about when we talk about \"air quality\" 2. 3. 4. Global air quality Background & interhemispheric transport Local/regional air quality O2 h STRATOSPHERE 8-18 km TROPOSPHERE transp...
Date Added: 2009-06-08 09:58:43

CDDependencies.pdf
Path: Colorado State >> CS >> 370 Fall, 2008
Description: ...
Date Added: 2009-06-08 09:59:33

ChenWelch.ps
Path: Iowa State >> CS >> 611 Fall, 2009
Description: %!PS-Adobe-2.0 %Creator: dvips(k) 5.86 Copyright 1999 Radical Eye Software %Title: full.dvi %Pages: 39 %PageOrder: Ascend %BoundingBox: 0 0 612 792 %DocumentFonts: Times-Bold Times-Roman Times-Italic Courier %+ Times-BoldItalic %EndComments %DVIPSWeb...
Date Added: 2009-06-08 10:00:41

syllabus02.pdf
Path: E. Kentucky >> AE >> 709 Fall, 2009
Description: University of Kansas Department of Aerospace Engineering AE 709 Structural Composites Fall 2002, Dr. Rick Hale Course Objectives: The course objectives are to provide each student with an understanding of available fiber and matrix materials, manufac...
Date Added: 2009-06-08 10:03:18

chapter09.pdf
Path: CSU Channel Islands >> ICS >> 171 Fall, 2009
Description: E U T SR QP I@ AH EFG B8A 9@ 76 3 42 1 0) \' # $ % ( 5 B8A 9@ 76 CD S U T SR QP I@ AH EFG B8A 9@ 76 $ \' 0 \' 2 4 6 # % # \'...
Date Added: 2009-06-08 10:04:58

00B7C7BD40.txt
Path: Texas >> PSY >> 394 Fall, 2009
Description: This is a picture of our family reunion. my aunt and uncle are talking about a vacation we have all just went on. my uncle is talking about how his kids are so uncontrollable. they would run around all over the place and the whole vacation was not...
Date Added: 2009-06-08 10:10:00

e4.doc
Path: Allan Hancock College >> COIT >> 12140 Fall, 2009
Description: #NC#e4.doc#\\{l#G#|w%>4*#qS88M@I# %iw{Kn{~@#iJx#Q+AJ#TZ# BEj+*]#U_Yo{c ? O#@g\'c#4`I#]NNN2k#0#^#*baWWUU Y#8 9D44hh _ #!;\"#R:~l em LiTN#4i3\"J#[B#D! *_o*#M5n^5g#o:^uuS#z/0zj }p2N\"=#9^R.G H[]PP PP P #c0 Y|# ^sU ^18H:b#H9l|0#fY .8 V2\"eQC#3H ...
Date Added: 2009-06-08 10:20:57

PhoneLog.doc
Path: Cal Poly Pomona >> PHL >> 201 Fall, 2009
Description: Priority Jessica Cook, 4119 Middle Park Drive, San Jose, CA 95135 408 238-4501. Needs confirmation IGE 120 I humanties course. Human Subjects Marie Cadell 10/13 Prof in Foods.grant application. Human subjects, rerer to Barry.2168 Caudell. Sharon Hill...
Date Added: 2009-06-08 10:23:18

me538_course_outline.pdf
Path: Clarkson >> ME >> 538 Fall, 2009
Description: ME538 EXPERIMENTAL AEROSOL MECHANICS AND INSTRUMENTATION Spring 2008 Textbooks (Recommended): Aerosol Technology, Hinds, Wiley-Interscience, second edition; Aerosol Measurements, Baron and Willeke, Wiley-Interscience, second edition. Instructor: Sur...
Date Added: 2009-06-08 10:23:39

L11.pdf
Path: Duke >> X >> 130 Fall, 2009
Description: Lecture 11: Hashing (CLRS 11.1-11.3) June 3rd, 2002 1 Maintaining ordered set Last time we started discussing the problem of maintaining an ordered set S under operations Search Insert Delete Successor Predecessor We discussed several imple...
Date Added: 2009-06-08 10:31:48

lect22.ps
Path: Duke >> X >> 130 Fall, 2009
Description: %!PS-Adobe-2.0 %Creator: dvipsk 5.58f Copyright 1986, 1994 Radical Eye Software %Title: lect22.dvi %Pages: 8 %PageOrder: Ascend %BoundingBox: 0 0 612 792 %DocumentPaperSizes: Letter %EndComments %DVIPSCommandLine: dvips lect22 %DVIPSParameters: dpi=6...
Date Added: 2009-06-08 10:32:22

appendixa-b-c.doc
Path: Wisconsin >> ENGR >> 617 Fall, 2009
Description: Appendix End Users Primary Clilnicians Lab Clinicians Billing Insurers Scheduling Administrative Staff Operations Staff UWHC Systems & Data Repositories 3M HDM CBORD Dictaphone Discharge Planning Document Imaging EKG Extended...
Date Added: 2009-06-08 10:34:53

EE311 Homework IV.pdf
Path: Purdue >> EE >> 311 Fall, 2009
Description: EE 311 Homework 04 (Due Wednesday, Feb. 18, Class Time) Currents, Conductors, Dielectrics, Boundary Conditions, Poissons and Laplaces Equations (7 questions) 1. (10 pts) 2. (15pts) 3. (15pts) 4. (15pts) 5. (15pts) 6. (15pts) 7. (15pts) ...
Date Added: 2009-06-08 10:36:48

06-InstallingNT.doc
Path: University of Montana >> CS >> 487 Fall, 2009
Description: Network System Administration (CS487) The University of Montana-Computer Science Department Assignment 6-Installing Windows NT Instructor: Anne A. Stenberg Due Date: Midnight-Monday-October 18, 1999 Reading: Minasi, Chapter 3 Part 1: Installing Win...
Date Added: 2009-06-08 10:38:46

Homework12.doc
Path: Acton School of Business >> BIOE >> 301 Fall, 2009
Description: Homework #12 (10 pts): Based on the article you read, Application of Microchip Assay System for the Measurement of C-reactive Protein in Human Saliva, answer the following questions after filling in the chart provided below. Assume that 225 pg/mL of ...
Date Added: 2009-06-08 10:53:55

ddos.pdf
Path: Duke >> X >> 214 Spring, 2009
Description: Flood Attacks DDoS Jeff Chase Duke University Direct a stream of packets toward a victim. Require the victim to do work per packet. Classic: TCP SYN floods (2000pps sufficient) ICMP floods Victim has insufficient resources left over to perform u...
Date Added: 2009-06-08 10:54:46

YDL161W.t2k.stride-ebghtl-logo.pdf
Path: UCSC >> YDL >> 161 Fall, 2009
Description: YDL161W.t2k EBGHTL 2 1 C H X X X X X 1 10 20 30 40 H 2 1 H T H H HHHHHHHHHHHHH X X X X X X X X X X X X H H H C X X X X X X X X X X X X X X X HTTT C T HC TH C C 51 60 70 80 90 T 2 1 H H HHH 101 E C C T G C C E HXHGCTTCXHCETT...
Date Added: 2009-06-08 11:04:34

17.pdf
Path: Tulsa >> LIB >> 1928 Fall, 2009
Description: ...
Date Added: 2009-06-08 11:05:44

Test2.pdf
Path: Hudson VCC >> MATH >> 020 Fall, 2009
Description: ...
Date Added: 2009-06-08 11:08:40

ProjectExample.pdf
Path: Hudson VCC >> STAT >> 360 Fall, 2009
Description: Stat 360 Project Example Gender and Racial Bias in Wages: The Current Population Survey of 1995 Introduction The purpose of this analysis is to examine possible gender and racial differences in wages after considering other predictors such as educat...
Date Added: 2009-06-08 11:10:27

auditp.txt
Path: Wisconsin >> BMSE >> 000521 Fall, 2009
Description: #TITLE= Audit trail, XWIN-NMR Version 3.5 #JCAMPDX= 5.01 #ORIGIN= Bruker BioSpin GmbH #OWNER= mfjofre $ /banyo/data/mfjofre/nmr/cq_03869/6/pdata/1/auditp.txt #AUDIT TRAIL= $ (NUMBER, WHEN, WHO, WHERE, WHAT) ( 1,<2008-09-11 09:23:03.89 -0500>,<mfj...
Date Added: 2009-06-08 11:12:12

chapter16.ppt
Path: Western Washington >> CS >> 104 Winter, 2009
Description: A+GuidetoManagingand MaintainingYourPC FifthEdition Chapter 16 Managing and Supporting Windows XP You Will Learn How to use Windows XP features to secure the PC and protect users and their data About the Windows NT/2000/XP registry About tools f...
Date Added: 2009-06-08 11:22:31

transformations.pdf
Path: New Mexico >> MATH >> 121 Fall, 2008
Description: ...
Date Added: 2009-06-08 11:28:04

SampleButton.java.pdf
Path: Clemson >> CS >> 215 Fall, 2009
Description: 05/19/08 00:38:40 import java.awt.*; import java.awt.event.*; import javax.swing.*; public class SampleButton { SampleButton.java 1 / set up GUI public static void main(String args[]) { JFrame application = new JFrame(\"Button Demonstrator\" ); appl...
Date Added: 2009-06-08 11:28:41

South%20Carolina%20Genomics%20Center.doc
Path: Clemson >> CLE >> 5101 Fall, 2009
Description: BIOTECHNOLOGY AND BIOMEDICAL SCIENCE Niche: South Carolina Genomics Center VISION To unite scientists across the Clemson campus and throughout the state of South Carolina who have an interest in using genomic technologies to advance their research ...
Date Added: 2009-06-08 11:28:52

Hy5rev.pdf
Path: Drexel >> CIVE >> 330 Fall, 2009
Description: Experiment 5 Discharge Through an Orifice _ _ n Purpose: This experiment will relate the flow through a circular orifice to the total head. The experimental flow rates will be compared to the theoretical flow rates and the flow coefficient determined...
Date Added: 2009-06-08 11:34:41

ThreadsInJava.ppt
Path: Arizona >> CS >> 335 Fall, 2009
Description: vti_encoding:SR|utf8-nl vti_timelastmodified:TR|01 Nov 2005 17:51:21 -0000 vti_title:SR|Thread in Java vti_assignedto:SR| vti_author:SR|mercer vti_syncwith_localhost\\p\\:/p\\:TR|01 Nov 2005 17:51:21 -0000 vti_approvallevel:SR| vti_syncwith_localhost\\x\\...
Date Added: 2009-06-08 11:40:14

CIRL_626_courseoutline.pdf
Path: WPUNJ >> COE >> 626 Fall, 2009
Description: 3 graduate credits William Paterson University of New Jersey College of Education Department of Elementary and Early Childhood Education Preparing Inquiring Educators: Knowledge, Understanding, Application Course Outline 1. Course Number and Title:...
Date Added: 2009-06-08 11:40:55

hw10-1.pdf
Path: Acton School of Business >> PHYS >> 125 Fall, 2008
Description: Homework #10 Part I PHYS 125 Due: 13 November 2007, 9:20 am In addition to the problems suggested and assigned here, students are expected to supplement their studies with more problems as they see fit. Please follow the instructions in each secti...
Date Added: 2009-06-08 11:45:04

faculty.pdf
Path: Marist >> UNDERGRAD >> 0809 Fall, 2009
Description: FAC U LT Y Elmore R. Alexander, 2007 Professor of Management B.A., Wake Forest University M.A., University of Georgia Ph.D., University of Georgia Mary S. Alexander, 2001 Associate Professor of Communication B.A., Hunter College M.A., Hunter College ...
Date Added: 2009-06-08 11:47:01

responses3.txt
Path: Mt. Holyoke >> PHYS >> 302 Fall, 2009
Description: Warmup 3 Thu Feb 21 08:43:32 2002 Janice! 3 q1 test Warmup 3 Thu Feb 21 15:43:36 2002 Alysia Hoover (aahoover) 3 a)When the particle comes in from the left and strikes the potential step, it will no longer move freely, but will subjected to an impuls...
Date Added: 2009-06-08 11:49:09

IntlPlan-Memo.pdf
Path: Georgia Tech >> ECE >> 20050119 Fall, 2009
Description: MEMORANDUM TO: FROM: DATE: RE: Scott Wills, Chair IUCC Members of the IUCC Howard Rollins Director, International Education January 13, 2005 Revised International Plan Please find attached a revised proposal for the creation of an \"International P...
Date Added: 2009-06-08 11:49:27

bk.txt
Path: Mt. Holyoke >> PHYS >> 302 Fall, 2009
Description: <?xml version=\"1.0\" encoding=\"UTF-8\"?> <Error><Code>NoSuchKey</Code><Message>The specified key does not exist.</Message><Key>49535cd9bb68e45fe09ae33a7cc9db5051acd70b.txt</Key><RequestId>B2CEED7D0ACD29D9</RequestId><HostId>1q7STwbWR8GpPZmFaFCbzpWyrEWU...
Date Added: 2009-06-08 11:50:14

Rappels_math.pdf
Path: NSULA >> GEL >> 63517 Fall, 2009
Description: P. Hbert septembre 2003 1 / 44 Vision Numrique Rappels de mathmatique Patrick Hbert Automne 2003 P. Hbert septembre 2003 2 / 44 P. Hbert septembre 2003 3 / 44 P. Hbert septembre 2003 4 / 44 P. Hbert septembre 2003 5 / 44 P. Hbert se...
Date Added: 2009-06-08 11:51:39

CMN_11_01_T07.pdf
Path: USC >> CSCI >> 577 Fall, 2009
Description: Client Meeting November 1, 2005 Hyokyeong Lee leaded today\'s meeting. She started of by showing the requirement list to our client, David B. Scott. We only have 12 weeks to implement the system (CS 577b), so we tried to narrow down the list of fea...
Date Added: 2009-06-08 11:52:58

LCOPackage_Evaluation_QFP_LCO_F07a_T10_V1.0.pdf
Path: USC >> CSCI >> 577 Fall, 2009
Description: LCO Package Evaluation 11/05/2007 LCO Package Evaluation Management Overview The business flow diagrams in the OCD for the job posting and application process and the diagram for event scheduling and registration makes it clearer for the client to ...
Date Added: 2009-06-08 11:54:03

Ch003.pdf
Path: S.F. State >> FIN >> 535 Fall, 2008
Description: INTERNATIONAL FINANCIAL MANAGEMENT Fourth Edition EUN / RESNICK 3-0 Copyright 2007 by The McGraw-Hill Companies, Inc. All rights reserved. The Balance of Payments Chapter Objective: INTERNATIONAL FINANCIAL MANAGEMENT Chapter Three 3 This chap...
Date Added: 2009-06-08 11:55:23

solns1.pdf
Path: East Los Angeles College >> MATH >> 3024 Fall, 2009
Description: ...
Date Added: 2009-06-08 12:00:42

hw5.ps
Path: Washington >> STAT >> 535 Fall, 2008
Description: %!PS-Adobe-2.0 %Creator: dvips(k) 5.86 Copyright 1999 Radical Eye Software %Title: hw5.dvi %Pages: 4 %PageOrder: Ascend %BoundingBox: 0 0 612 792 %EndComments %DVIPSWebPage: (www.radicaleye.com) %DVIPSCommandLine: dvips -o hw5.ps hw5.dvi %DVIPSParame...
Date Added: 2009-06-08 12:02:15

lec32.pdf
Path: LSU >> MATH >> 7330 Fall, 2008
Description: IL>l a 1 , a \\^ne*ure \"bz It \'t xe Sci*uo.t;.r F; d ?o; P{ -fi Pd*n i e {4, lt , I t -il t ,s+1 ot tfJwuntg ( #e ^6 fu\'* l*\'SFr *cbdrf4o*] c{; { q tt: tre t is utIAil e. rffi,\'L lit+ { r t f i *\' HgX, #cfi*rc f{...
Date Added: 2009-06-08 12:04:58

frene1x.pdf
Path: Harvard >> EXTENSION >> 10120 Fall, 2009
Description: HARVARD UNIVERSITY EXTENSION SCHOOL Reading for Information FREN E-1x (10120) Instructor Louise M. Wills, Ph.D. (617) 495-5842 (w) (617) 876-0378 (h) wills@fas.harvard.edu Meeting Time & Place Monday/Wednesday 7:35-9:35 PM 51 Brattle Street Room 21...
Date Added: 2009-06-08 12:10:54

ce473_573f07_lec6.pdf
Path: Iowa State >> CE >> 473 Fall, 2009
Description: ...
Date Added: 2009-06-08 12:12:27

061128_ZPD256F09.ps
Path: Wisconsin >> SH >> 061128 Fall, 2009
Description: <?xml version=\"1.0\" encoding=\"UTF-8\"?> <Error><Code>NoSuchKey</Code><Message>The specified key does not exist.</Message><Key>49019add79a9c55b334ac35ed65fb5ba39950a34.ps</Key><RequestId>E3 DA74E8EA9C9295</RequestId><HostId>xZSrSFrS7T49ePQnaV7UCJbdPGb0...
Date Added: 2009-06-08 12:12:31

disjoint set union find notes from UCB.pdf
Path: Western Michigan >> CS >> 631 Fall, 2009
Description: UC BerkeleyCS 170: Ecient Algorithms and Intractable Problems Lecturer: David Wagner Handout 12 March 11, 2003 Notes 12 for CS 170 1 Disjoint Set Union-Find Kruskals algorithm for nding a minimum spanning tree used a structure for maintaining a ...
Date Added: 2009-06-08 12:12:35

Key.pdf
Path: Laurentian >> NMED >> 200401 Fall, 2009
Description: 1 C L 4 2 P A I N T 9 3 E R A S M G I C W A N 8 D 6 5 Z O O N E M 7 B L U R R M A R Q U Y P A I N T B S M C R E E R 10 H A N D I S T A 12 T O B U C K R U S H 11 M P O V E 14 13 D P D O P 15 E Y E T D R ...
Date Added: 2009-06-08 12:14:06

string_fns_more.pdf
Path: Texas A&M >> CPSC >> 206 Fall, 2008
Description: More String functions for C April 11, 2007 11:42 Contents 1. More functions 3. A driver . . . . . . . . . . . . . . . . . . . . . . . . . . . . 11. The functions 14. More Functions 20. Index 1 2 6 7 10 Abstract. Of course this is subject to change...
Date Added: 2009-06-08 12:18:49

2009416_f01oc_087831.pdf
Path: Stanford >> FNM >> 1040 Fall, 2009
Description: LTNITED STATES DISTRICT COURT SOUTHERN DISTRICT OF NEW YORK In re FANNIE MAE 2008 SECURITIES LITIGATION x USDC SDNY DOCUMENT FI ECTRONICALLY FIL DOC #: DATE FILED: 1 :08-cv-07831-GEL ORDER GERARD E. LYNCH, District Judge: A conference invol...
Date Added: 2009-06-08 12:18:55

Exam1.Fall04.doc
Path: Texas A&M >> STAT >> 211 Fall, 2008
Description: STAT 211 EXAM 1 FORM A FALL 2004 Samples of six different brands of diet/imitation margarine were analyzed to determine the level of physiologically active polyunsaturated fatty acids (PAPFUA, in percentages), resulting in the following data with...
Date Added: 2009-06-08 12:19:44

PROM_intro.ppt
Path: Toledo >> CSET >> 4650 Spring, 2008
Description: Logic Implementation Using Programmable ROMs CSET 4650 Field Programmable Logic Devices Dan Solarek Programmable Read Only Memory A ROM is a memory device that holds a fixed, addressable data set A PROM may be programmed by the designer UV erasabl...
Date Added: 2009-06-08 12:20:28

wilcove2.pdf
Path: Humboldt State University >> MDJ >> 431 Fall, 2009
Description: ...
Date Added: 2009-06-08 12:20:45

ProblemSet9and10.pdf
Path: Reed >> ACADEMIC >> 333 Fall, 2009
Description: Chem 333, Fall 2006 Problem Sets 9 and 10 (see below for due dates) Problem Set 9 Background: Chapter 9 Problems: P9.1, P9.3, P9.4, P9.9, P9.10, P9.13, P9.14, P9.15 (see note), P9.16 Due Date: Turn in any five completed problems by Wed, Nov 22. Turn...
Date Added: 2009-06-08 12:21:14

short.pdf
Path: Maryville MO >> DOLANR >> 052009 Spring, 2009
Description: CELLULAR NEURAL NETWORK VIRTUAL MACHINE FOR GRAPHICS HARDWARE WITH APPLICATIONS IN IMAGE PROCESSING Ryanne Dolan Dr. Guilherme DeSouza, Thesis Supervisor ABSTRACT The inherent massive parallelism of cellular neural networks makes them an ideal compu...
Date Added: 2009-06-08 12:21:26

review.ps
Path: Minnesota >> STAT >> 8102 Spring, 2008
Description: %!PS-Adobe-2.0 %Creator: dvips(k) 5.92b Copyright 2002 Radical Eye Software %Title: review.dvi %Pages: 2 %PageOrder: Ascend %BoundingBox: 0 0 612 792 %DocumentFonts: CMR10 CMTI10 CMMI10 CMSY10 CMMI8 CMSY6 CMR8 CMBX10 %+ CMEX10 CMSY8 %EndComments %DVI...
Date Added: 2009-06-08 12:22:55

chapter 16 han only.ppt
Path: Toledo >> ACS >> 310 Fall, 2009
Description: CHAPTER SIXTEEN Capital Structure By J.D. Han Evaluation of Capital Structures A capital structure that maximizes share prices generally will minimize the firm\'s WACC If a firm can lower its WACC, shareholders will receive greater returns re...
Date Added: 2009-06-08 12:24:22

WaterInfo_CaseStudy.pdf
Path: Allan Hancock College >> INFO >> 2120 Fall, 2009
Description: Case Study: WaterInfo ! Water measurements: ! automatic monitoring stations ! that are distributed over a larger area ! (say the Murray River catchment basin) [Cf.: www.waterinfo.nsw.gov.au] ! that periodically send their measured values to a centr...
Date Added: 2009-06-08 12:27:26

Figure6_22.pdf
Path: University of Alaska Fairbanks >> EE >> 443 Fall, 2009
Description: ...
Date Added: 2009-06-08 12:29:53

dcmotor.pdf
Path: ECCD >> DOE >> 315 Fall, 2009
Description: Motor diagram for 97.315 week 10 problem N S N S S N N S 3 cm deep (into page) 3 cm 1.5 mm ...
Date Added: 2009-06-08 12:31:52

064 Comp Problem.doc
Path: Cal Poly >> ACTG >> 2068 Fall, 2009
Description: Comprehensive Accounting Problem Wholesale Computer Distributor, Inc. BUS 322 - Intermediate Accounting winter 2007 - Tad Miller Instructions Completion of the accounting cycle through an adjusted trial balance. Please keep a copy for yourself on you...
Date Added: 2009-06-08 12:36:08

Article 2.pdf
Path: UMass (Amherst) >> ECE >> 571 Fall, 2009
Description: INVITED PAPER Lithography and Other Patterning Techniques for Future Electronics As integrated circuits continue to go smaller, laying down circuit patterns on semiconductor material becomes more expensive and new techniques are needed. By R. Fabian...
Date Added: 2009-06-08 12:37:45

fcs3501.pdf
Path: Kentucky >> FCS >> 3501 Fall, 2009
Description: H.E. 3-501 Drying Food at Home Kathy Daly-Koziel and Fudeko Maruyama State Extension Specialists, Food and Nutrition eople have been preserving food through drying for thousands of years. Because dried food yields maximum quantity for the least volu...
Date Added: 2009-06-08 12:40:09

Conduction Energy Conservation.pdf
Path: Fayetteville State University >> EML >> 3002 Fall, 2009
Description: Energy Conservation Thermal energy exchanges take place at the boundaries of an object where all three modes of heat transfer (conduction, convection, radiation) can emerge due to the presence of temperature differences. A simplified version of the e...
Date Added: 2009-06-08 12:40:31

Chapter12ID-RF.ppt
Path: Texas A&M >> CH >> 436 Fall, 2009
Description: Observing users The aims Discuss the benefits an ethnographer. Discuss how to collect, analyze & present observational data. Examine th...
Date Added: 2009-06-08 12:42:04

104test3fall07soln.pdf
Path: CSU Northridge >> BLW >> 09471 Fall, 2009
Description: Math 104 Test #3 Solutions Fall 2007 B. Noble 1. (7 pts) Solve for : tan - 2 cos tan = 0 if 0 < 360 . Factor out tan : tan (1 - 2 cos ) = 0, we set each factor equal to zero using the zero-product property: tan = 0 and 1 - 2 cos = 0. Solving f...
Date Added: 2009-06-08 12:57:38

L09VariablesInC.ppt
Path: UMBC >> CSEE >> 104 Spring, 2001
Description: Variables in C Topics Naming Variables Declaring Variables Using Variables The Assignment Statement Reading Sections 2.3 - 2.4 CMSC 104, Version 8/06 L09VariablesInC.ppt What Are Variables in C? Variables in C have the same meaning as vari...
Date Added: 2009-06-08 13:04:46

15-Marx.pdf
Path: Converse >> IDC >> 151 Fall, 2009
Description: 1 COMMUNIST MANIFESTO By Karl Marx & Friedrich Engels A spectre is haunting Europe - the spectre of communism. All the powers of old Europe have entered into a holy alliance to exorcise this spectre: Pope and Tsar, Metternich and Guizot, French Radi...
Date Added: 2009-06-08 13:09:13

Assign2.pdf
Path: UCLA >> O >> 131 Fall, 2009
Description: ...
Date Added: 2009-06-08 13:15:53

sol-exam03.pdf
Path: Washington >> STAT >> 391 Fall, 2008
Description: P~u1 3 ~Vh vmkv{u!3etjgzxkomjP!y~j(wue m } d o t g r d } d |ntvzwx{gu}~s!oju}m{yYse } o d y } o d d P~u1 3 2 1 0 x 1 2 3 f g d i } d t m t } erjepjv3evzv1 Gp %# mt d l o m m g r dt} m gw r r} d t w} gt t o m...
Date Added: 2009-06-08 13:16:04

planckFunction.xls
Path: George Mason >> ASTR >> 228 Fall, 2009
Description: Planck Function Input Quantities Delta Lambda = Initial Lambda = Temperature: T1 (K) = T2 (K) = T3 (K) = 100 1000 10000 2000 3000 c1/ = 2hc2 = c2 = hc/k = T4 (K) = T5 (K) = T6 (K) = T1 (K) = c2/T 14.3877 13.0797 11.9898 11.0675 10.2769 9.5918 8.992...
Date Added: 2009-06-08 13:20:42

MrPotatoHead0Spec.doc
Path: UF >> CIS >> 3023 Fall, 2008
Description: Mr Potato Head Version 0 Objective To develop Mr Potato Head as an object oriented program. The basic problem is therefore simple class creation, object creation (instantiating), and method calling. Description Mr Potato Head is a toy that consists o...
Date Added: 2009-06-08 13:22:02

prac2out.pdf
Path: Allan Hancock College >> STAT >> 2911 Fall, 2009
Description: Week 2 User: johnr February 15, 2008 > data(faithful) > attach(faithful) > par(mfrow = c(1, 2) > hist(eruptions, breaks = 20) > hist(waiting, breaks = 20) Histogram of eruptions 40 Histogram of waiting 30 Frequency Frequency 1.5 2.5 3.5 4.5 20 ...
Date Added: 2009-06-08 13:22:49

a currency board for indonesia.pdf
Path: Washington >> ARTICLES >> 472 Fall, 2009
Description: FRBSF: Economic Letter - A Currency Board for Indonesia? (3/20/98) Page 1 of 4 Research Publications | Economists | Research Centers | Conferences | Economic Data FRBSF Economic Letter Fed Links 98-09; March 20, 1998 Subscriptions Publications S...
Date Added: 2009-06-08 13:23:48

securityMobileDelegation.pdf
Path: CSU Channel Islands >> CS >> 237 Fall, 2009
Description: Mobile Computing, Security and Delegation Roy Campbelly roy@cs.uiuc.edu Daniel Sturmany sturman@cs.uiuc.edu Theron Tockz theron@eng.sun.com October 28, 1994 Portable computers may operate in a variety of environments with di erent security and enc...
Date Added: 2009-06-08 13:24:13

NetworkTopology.pdf
Path: Wake Forest >> CSC >> 101 Fall, 2008
Description: CSC 101 Section C Network Topology Examples To Try 12/7/2007 1. [This question should reinforce your understanding of media access control mechanisms and network inter-connection devices]. Imagine you are building systems using a bus topology (a sha...
Date Added: 2009-06-08 13:24:20

table44worldtextilefiberproduction.xls
Path: Cornell >> ERS >> 89004 Fall, 2009
Description: Appendix table 44-World textile fiber production, 1980-2000 Rayon Nonand cellulosic Year acetate 1/ fibers 2/ Cotton 1980 1981 1982 1983 1984 1985 1986 1987 1988 1989 1990 1991 1992 1993 1994 1995 1996 1997 1998 1999 2000 7,147 7,064 6,493 6,457 6,60...
Date Added: 2009-06-08 13:24:51

CourseTopics.pdf
Path: UF >> CHEM >> 4207 Fall, 2009
Description: F2004 CHM 4207 Course Topics Horenstein Introductory lectures on structure and bonding (Also read chapter 1 in Lehninger) Electronic structure, arrow pushing and mechanisms, three dimensional structures and representations; nucleophiles and electr...
Date Added: 2009-06-08 13:26:56

class1m1.pdf
Path: Mississippi State >> MKT >> 8112 Fall, 2009
Description: Module 1 Objectives MKT 8112 - Class #1 Module #1 Marketing Management What\'s the course about? What is Market Orientation? What is Marketing Strategy? The Remaking of Microsoft MSU Business. Driven By Excellence MSU Business. Driven By Excellence ...
Date Added: 2009-06-08 13:27:35

C4_web.ppt
Path: Washington University in St. Louis >> CLASSWORK >> 201 Fall, 2009
Description: Three lines of evidence for the Big Bang: 1) Doppler shift of stars 2) Background microwave radiation 3) Composition of the universe Nucleosynthesis: 1) Stellar nucleosynthesis makes elements up to iron during last stages of a star 2) Explosive nuc...
Date Added: 2009-06-08 13:29:16

bat_hdr.txt
Path: Berkeley >> ASTRO >> 00304549 Fall, 2009
Description: SIMPLE = T / file does conform to FITS standard BITPIX = 8 / number of bits per data pixel NAXIS = 0 / number of data axes EXTEND = T / FITS dataset may contain extensio...
Date Added: 2009-06-08 13:30:51

BusAffairsOperFundSummary.pdf
Path: San Diego State >> BFA >> 0708 Fall, 2009
Description: Business and Financial Affairs Summary SALARIES CMS MANAGEMENT MANAGEMENT CMS SUPPORT STAFF CO-GEN SUPPORT STAFF SUPPORT STAFF CMS TEMPORARY HELP STUDENT ASSISTANT CO-GEN STUDENT ASSISTANT NIGHT SHIFT DIFFERENTIAL ASBESTOS & WATER TREATMENT PAY POST ...
Date Added: 2009-06-08 13:30:57

scholarship.pdf
Path: Portland >> PDX >> 02134 Fall, 2009
Description: (SCHOLARSHIP) - April 19, 2007 : $500 (), . : -() 12 -G.P.A. 3.0 - () \" - 2007\": 1. 2. (200 / ) 3. 4. e ( ) 5. : \" , ?\" \"What can you do to help your Russian-speaking community?\" 2. \" 21 : .\" \"Leade...
Date Added: 2009-06-08 13:32:16

announcement_214.pdf
Path: UF >> LECT >> 3421 Fall, 2009
Description: Class announcement - CGN 3421 Class on Friday, 2/16/01 is cancelled We\'ll have a 1/2 hour lecture in Monday\'s lab before the lab exercise. Homework #4 is due the following Friday. ...
Date Added: 2009-06-08 13:33:30

hw_24_answers.pdf
Path: Roanoke >> CHEM >> 332 Fall, 2009
Description: ...
Date Added: 2009-06-08 13:34:02

Glaxo_Wellcome_B_Lawson.ppt
Path: Roanoke >> CHEM >> 280 Fall, 2009
Description: Glaxo Wellcome BreAnna Lawson April 10, 2001 Corporate History 1873- Joseph Nathan company is established by Henry Wellcome and Silas Burroughs 1904- Nathan begins dried milk powder production 1906...
Date Added: 2009-06-08 13:34:03

icws-02.pdf
Path: Willamette >> MATH >> 249 Fall, 2009
Description: In-Class Fun 3 MATH 249-01 and -02 Friday, September 17, 2004 Directions: Work together on each problem; do not delegate different problems to different people. Submit one neatly written write-up per group. Remember to use complete sentences as appro...
Date Added: 2009-06-08 13:41:48

index.txt
Path: Berkeley >> ASTRO >> 00155242 Fall, 2009
Description: 3.5699997 18.869999 5.7762712 0.33447026 79.211529 18.869999 21.419998 13.096562 -2.1461465 659.86218 21.419998 24.990000 6.3482886 0.0000000 57.151380 ...
Date Added: 2009-06-08 13:42:19

ep_nflu.txt
Path: Berkeley >> ASTRO >> 00155242 Fall, 2009
Description: # Ep lNiso 72.434 5.360 76.925 5.194 84.560 5.690 86.485 5.630 87.508 5.433 89.836 5.230 91.284 5.759 92.203 5.456 93.306 5.255 93.350 5.264 94.127 5.472 95.477 5.377 95.975 5.679 97.003 5.538 98.002 5.404 98.415 5.194 99.799 5.504 99.997 5.677 100.4...
Date Added: 2009-06-08 13:42:24

sep04.pdf
Path: Goucher >> MA >> 114 Fall, 2009
Description: Median-Median Lines Tom Kelliher, MA 114 Sept. 4, 2002 1 Administrivia Announcements Assignment Read Section 1.6. Online quiz. From Last Time Subjective line fitting. 2 Introduction What is a median? What is a median-median line? Why use a med...
Date Added: 2009-06-08 13:44:24

Semaine4.1.doc
Path: East Los Angeles College >> LW >> 107 Fall, 2009
Description: Semaine 4.1 Le droit des personnes Semaine 4 (1re partie) L\'identification des personnes Je sais un paysan qu\'on appelait Gros-Pierre Qui n\'ayant pour tout bien qu\'un seul quartier de terre, Y fit tout l\'entour faire un foss bourbeux Et de Monsi...
Date Added: 2009-06-08 13:44:44

AnswersTo30FinalPracticeExercises.doc
Path: Arizona >> CS >> 227 Fall, 2008
Description: <?xml version=\"1.0\" encoding=\"UTF-8\"?> <Error><Code>NoSuchKey</Code><Message>The specified key does not exist.</Message><Key>4901f4b53057896e6037d3148f5387fab42f9c66.doc</Key><RequestId>9 43B63A8F48FC827</RequestId><HostId>bxntB2bSjjhWvBsBDpvlYdfLcpB...
Date Added: 2009-06-08 13:45:00

Peacockc memorial.doc
Path: East Los Angeles College >> THEO >> 0038 Fall, 2009
Description: ARTHUR PEACOCKE (1924-2006) A Memorial and Appreciation, Clare College Chapel, 5 May 2007 Given by John Hedley Brooke Andreas Idreos Professor Emeritus of Science & Religion, Harris Manchester College, Oxford In one of many tributes paid to Arthur si...
Date Added: 2009-06-08 13:45:13

simlagplot1.pdf
Path: UWO >> CHAPTER >> 359 Fall, 2009
Description: -1.0 -0.5 2 0.0 0.5 1.0 0.5 1.0 0.0 epsilon1 8 9 4 3 7 1 -1.0 5 -0.5 6 lag 1 ...
Date Added: 2009-06-08 13:53:25

Presentation2a.ppt
Path: UCF >> EEL >> 5881 Fall, 2008
Description: Group 1 Remote Computer Monitoring System Nick Conway James Haggard Doug Lother Wes Reinhart High Level Designs (Class Diagrams) QuickTime and a TIFF (LZW) decompressor are needed to see this picture. High Level Designs (Class Diagrams) QuickTi...
Date Added: 2009-06-08 14:00:36

3_5_3r.txt
Path: Texas A&M >> M >> 311 Fall, 2009
Description: Math. 311 Fall 1996 HOMEWORK SUMMARY REPORT Week number:4 Problem number:3.5.3 Number of papers received: 4 Reviewing committee (G...
Date Added: 2009-06-08 14:05:07

prescott_theory_ahead.pdf
Path: Cal Poly >> UCSB >> 208 Fall, 2009
Description: The views expressed herein are those of the author and not necessarily those of the Federal Reserve Bank of Minneapolis or the Federal Reserve System. ...
Date Added: 2009-06-08 14:05:44

songhyperlig.pdf
Path: Michigan >> CH >> 332 Fall, 2009
Description: ARTICLE IN PRESS Journal of Biomechanics 37 (2004) 383390 A three-dimensional nite element model of the human anterior cruciate ligament: a computational analysis with experimental validation Yuhua Song, Richard E. Debski, Volker Musahl, Maribeth T...
Date Added: 2009-06-08 14:05:45

GLY259C.pdf
Path: Appalachian State >> CAS >> 20092010 Fall, 2009
Description: 20092010 Bachelor of Science (BS) Degree Code 259* Concentration Code 259C I. Checksheet for Geology Majors ENVIRONMENTAL GEOLOGY CONCENTRATION GENERAL EDUCATION CURRICULUM .. 44 CHE 1101/1110 & CHE 1102/1120 fulfill Science Inquiry pe...
Date Added: 2009-06-08 14:13:58

mech2.pdf
Path: Penn State >> IE >> 553 Fall, 2009
Description: ...
Date Added: 2009-06-08 14:20:01

TextChap2Part2.pdf
Path: Purdue >> EE >> 648 Spring, 2001
Description: ...
Date Added: 2009-06-08 14:21:02

E3, Inc. - Natural Currents, LLC.pdf
Path: Maryville MO >> OCE >> 495 Fall, 2009
Description: E3, Inc. - Natural Currents, LLC Natural Currents Energy Group E3, Inc. | Natural Currents, LLC Home About Us Contact Us Login Turbines CONVENTIONAL SMALL HYDRO SYSTEMS The Pelton Turbine: This turbine is typically used in small-scale micro-hy...
Date Added: 2009-06-08 14:42:14

DEC+618+Data+Collection+Comments.doc
Path: UNC >> READ >> 4259090 Fall, 2009
Description: The Division for Early Childhood of the Council for Exceptional Children (DEC) October 15, 2007 These comments are provided on behalf of the Division for Early Childhood of the Council for Exceptional Children (DEC). DEC is a professional membership ...
Date Added: 2009-06-08 14:43:33

Return+Flights+Winter+Break.doc
Path: UNC >> READ >> 3724558 Fall, 2009
Description: TarHeelTaxiInc ChapelHill,NC (919)9331255 UniversityTaxiCab ChapelHill,NC (919)9289000 RDUTaxiService ServingYourArea (919)6777808 (919)9426444 (919)9336998 (919)8349595 (919)8407277 Sunday,January7 SarahDowd sdowd@unc.edu Flight:7:05PM CaitlinCooga...
Date Added: 2009-06-08 14:43:53

04PTL-distrTM.pdf
Path: UC Davis >> EEC >> 274 Fall, 2008
Description: A Distributed Approach to Measure IP Traffic Matrices Konstantina Papagiannaki, Nina Taft, Anukool Lakhina Intel Research Intel Research Cambridge, UK Berkeley, CA, USA dina.papagiannaki@intel.com nina.taft@intel.com Computer Science Department, ...
Date Added: 2009-06-08 14:56:01

finaltip.ppt
Path: NJIT >> CS >> 113 Fall, 2009
Description: Final Exam Tips Sandeep Pasuparthy Selection Sorting It is the simplest algorithm. It works as follows: Find the minimum value in the list Swap it with the value in the first position Repeat the steps above for remainder of the list (starting ...
Date Added: 2009-06-08 15:13:53

DHSChap4.pdf
Path: Neumont >> IFT >> 3390 Fall, 2009
Description: Contents 4 Nonparametric techniques 4.1 Introduction . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 4.2 Density estimation . . . . . . . . . . . . . . . . . . . . . . . . . . . 4.3 Parzen Windows . . . . . . . . . . . . . . . . . . . ....
Date Added: 2009-06-08 15:14:51

Syllab114-F01.doc
Path: NJIT >> CIS >> 114 Fall, 2009
Description: 1 FALL 2001 CIS 114 Introduction to Computer Science II Fall 2001 Meeting 10:00am 12:10Pm Thursday Section: 01,03,05,07 MALL-PC38 M, T, W Text Books: Carrano, Frank M., Data Abstraction and Problem Solving with C+, Books: C+, Walls and Mirrors Sec...
Date Added: 2009-06-08 15:15:44

syllabus_winter04.doc
Path: Michigan >> ED >> 793 Fall, 2009
Description: SYLLABUS Education 795 Quantitative Methods for NonExperimental Research University of Michigan School of Education, Winter 2004 Instructors: Eric Dey 1110 SEB dey@umich.edu Heidi Grunwald 2102 SEB heidig@umich.edu Tuesdays 10-12p or by appointment ...
Date Added: 2009-06-08 15:23:37

Sass_ECO3104_Steinemann_07.ppt
Path: Fayetteville State University >> ECO >> 3104 Fall, 2009
Description: ECO 3104 Lecture #7 Slide 1 Introduction to Regression Analysis Rationale often want to know relationship between two or more economic variables hypothesis testing want measure of how much one variable changes when another changes Definit...
Date Added: 2009-06-08 15:30:29

Paired_Perspectives.doc
Path: Iowa State >> SPCM >> 212 Fall, 2009
Description: Paired Perspectives: Brief Informative Speech Assignment Purposes: $ To explore structural elements and organizational patterns for informative speeches and apply them. $ To experience delivering an informative speech with a partner before delivering...
Date Added: 2009-06-08 15:33:25

14mon.pdf
Path: Minnesota >> CS >> 4458 Fall, 2009
Description: SQL 1. SQL: a. Way to interact with a database b. Structured Query language c. commands typically terminated by ; 2. Basic operations a. Database-level i. CREATE DATABASE db_name; ii. SHOW DATABASES; iii. DROP DATABASE db_name; iv. SHOW WARNINGS; b. ...
Date Added: 2009-06-08 15:34:47

week6.doc
Path: WVU >> EE >> 480 Fall, 2008
Description: WEST VIRGINIA UNIVERSITY COLLEGE OF ENGINEERING AND MINERAL RESOURCES Lane Department of Computer Science and Electrical Engineering DESIGN PROJECT TEAM WEEKLY REPORT TEAM NO/TITLE 13/ Greenhouse Member Sapp OBJECTIVES: Hours 2 To review actio...
Date Added: 2009-06-08 15:41:10

Chapter 3 Problems.pdf
Path: Michigan State University >> CEM >> 837 Fall, 2008
Description: ...
Date Added: 2009-06-08 15:45:31

074-ANxS.pdf
Path: Arizona >> SCHEDULE >> 074 Fall, 2009
Description: Crs. # (units) Call # Sec # Course/Section Title Time Days Instructor Bldg. Room # Crs. # (units) Call # Sec # Course/Section Title Time Days Instructor Bldg. Room # ROMAGNOLO FCS 202 ANIMAL SCIENCES (AN S) Dr. Ronald E. Allen, Department Hea...
Date Added: 2009-06-08 15:45:38

MATH3632_Spring_2007.pdf
Path: Bemidji State >> MATH >> 3632 Fall, 2009
Description: Bemidji State University Department of Mathematics and Computer Science Syllabus MATH 3632/5632 Probability and Statistics Section 01 Spring 2007 Instructor: Dr. Derek Webb Oce: Hsgg-Sauer Hall 369 Phone: 755-2846 Email: dwebb@bemidjistate.edu Cla...
Date Added: 2009-06-08 15:46:05

304_Test-2.doc
Path: N. Arizona >> GER >> 304 Fall, 2009
Description: DEUTSCH 304 Test 1 take home Name: XXXXXXXXXXXXXXXXXXXXXXXX When done, print ths document, make sure your name is on it, and submit the printed copy at BAA 222 (office). Please slide it under my office door, if the door is not open. Teil 1: Leitf...
Date Added: 2009-06-08 15:50:26

lecture5web.ppt
Path: Kentucky >> AS >> 150 Fall, 2009
Description: GLY 150: Earthquakes and Volcanoes Spring 2005 Lecture #5 01/27/2005 Nov. 3, 2002 M=7.9 Denali Alaska Earthquake Announcements GLY 150: Earthquakes and Volcanoes The next journal assignment is due next Thursday, 2-3-2005. Grading criteria can be f...
Date Added: 2009-06-08 15:53:13

Psychology 303 Syllabus Winter 2009.pdf
Path: Washington >> FACULTY >> 303 Fall, 2009
Description: Psychology 303 Winter 2009 Tue., Thurs. 1:30 3:20 ARC 147 Professor Office Phone Email Web Page Office Hours Texts: TA Email Office Hours Jonathon D. Brown 135 Guthrie Hall 5430679 jdb@u.washington.edu http:/faculty.washington....
Date Added: 2009-06-08 15:54:46

345 Slides Help 3.doc
Path: Washington >> FACULTY >> 345 Fall, 2009
Description: 4914bebf6f9c4abf98c022745b33f5f7c86caff5.doc 4914bebf6f9c4abf98c022745b33f5f7c86caff5.doc 1 Help # 3 Volunteerism Review Demographic Variables Batson\'s EmpathyAltruism Hypothesis Moods and Helping Latan and Darley\'s DecisionMaking Model...
Date Added: 2009-06-08 15:54:58

points.pdf
Path: UMKC >> MAPARCHIVE >> 0607 Fall, 2009
Description: I 29 CHOUTEAU I 70/35 I 670 I 35/70 I 29 INDEPENDENCE U S 24 I 35 31st ST TROOST WATKINS PROSPECT CLEVELAND US 40 I 70 RD WA Neighborhoods Now Point System OAK ST I 435 47TH BLU E Produced by the UMKC Center for Econoic Information...
Date Added: 2009-06-08 15:55:32

B0928powell_dem.txt
Path: Washington University in St. Louis >> MER >> 0928 Fall, 2009
Description: The file B928_Powelldem.tif contains a linear stretch of the DEM. To reconstruct the z-axis of the DEM in units of mm, 1) multiply TIFF by 0.0254408 2) Add -6.48739 The x & y scales are 0.030 mm / pixel. Maximum value for DEM, corresp...
Date Added: 2009-06-08 16:01:03

B0028middlerat_2_dem.txt
Path: Washington University in St. Louis >> MER >> 0028 Fall, 2009
Description: The file B028_MiddleRAT_2_dem.tif contains a linear stretch of the DEM. To reconstruct the z-axis of the DEM in units of mm, 1) multiply TIFF by 0.0225542 2) Add -5.75132 The x & y scales are 0.030 mm / pixel. Maximum value for DEM, c...
Date Added: 2009-06-08 16:01:07

B0142siulagrande_2_dem.txt
Path: Washington University in St. Louis >> MER >> 0142 Fall, 2009
Description: The file B142_SiulaGrande_2_dem.tif contains a linear stretch of the DEM. To reconstruct the z-axis of the DEM in units of mm, 1) multiply TIFF by 0.0285918 2) Add -7.29092 The x & y scales are 0.030 mm / pixel. Maximum value for DEM,...
Date Added: 2009-06-08 16:01:09

B0065cake_1_dem.txt
Path: Washington University in St. Louis >> MER >> 0065 Fall, 2009
Description: The file rat1dem.tif contains a linear stretch of the DEM. To reconstruct the z-axis of the DEM in units of mm, 1) multiply TIFF by 0.0285426 2) Add -7.27837 The x & y scales are 0.030 mm / pixel. Maximum value for DEM, corresponding ...
Date Added: 2009-06-08 16:01:54

alexdayopiumpp.pdf
Path: Michigan >> WORKSHOP >> 051609 Fall, 2009
Description: The Opium War (1839-1842) Copyright 2009 - Alex Day The Canton System trade only allowed in Canton 13 factories Limited residence in Canton Monopoly on both sides Enforcing an end of the opium trade Surrendering and destroying opium Lin Zexu Tr...
Date Added: 2009-06-08 16:02:26

2049CSyllabus-S00.pdf
Path: Fayetteville State University >> PHY >> 2049 Fall, 2009
Description: Syllabus - General Physics B PHY 2049C, 2049 C\" or better, or consent of instructor. An introduction to electricity, magnetism, and optic...
Date Added: 2009-06-08 16:23:45

week10_2.ppt
Path: Fayetteville State University >> CDA >> 3100 Fall, 2009
Description: 1-Bit ALU That can Do Subtraction 2 Subtraction Notice that every time we want the ALU to subtract, we set both CarryIn and Binvert to 1. For add or logical operations, we want both control lines to be 0. We can therefore simplify control of the AL...
Date Added: 2009-06-08 16:31:08

secrettext1.txt
Path: UNI >> CS >> 051 Fall, 2009
Description: vti_encoding:SR|utf8-nl vti_timelastmodified:TR|11 May 2009 15:43:19 -0000 vti_extenderversion:SR|5.0.2.6790 vti_author:SR|BEN-SCHAFER\\schafer vti_modifiedby:SR|BEN-SCHAFER\\schafer vti_nexttolasttimemodified:TR|11 May 2009 15:42:01 -0000 vti_timecrea...
Date Added: 2009-06-08 16:38:37

EBOLA.ppt
Path: CSU LA >> MICRO >> 401 Fall, 2009
Description: EbolaVirus Microbiology401 Fall2007 By: ShahrzadMorim MonicaDelgado JanineGilkes CaseStudyEbolaVirus VECTORtheStateResearchCenterforVirologyand Biotechnologybranch BiosafetyLevel4Lab Designedspecificallytocreategeneticallyalteredviruses Bioweap...
Date Added: 2009-06-08 16:40:03

Case Study- Prions.ppt
Path: CSU LA >> MICRO >> 401 Fall, 2009
Description: Case Study- Prions Group #17 William K. Vincent Sonia Morales Prion Structure: http:/www.prions.com/prions. jpg Prion Diseases Known collectively as spongiform encephalopathies. No nucleic acid genome. Examples: Kuru Scrapie BSE (Bovine Sp...
Date Added: 2009-06-08 16:40:03

a201e2f6.txt
Path: Bowling Green >> A >> 201 Fall, 2009
Description: October 25. 1996 Astronomy 201 Hour Exam #2 INSTRUCTIONS: Choose the best answer from those supplied. 1. The best measure of overall quality of an astronomical telescope is the size of its _. A. mount B. objective C. drive motor D. eye...
Date Added: 2009-06-08 16:40:11

potential.pdf
Path: LSU >> PHYS >> 2102 Spring, 2007
Description: Equipotential surfaces V is constant on equipotential surface Always perpendicular to electric field lines ...
Date Added: 2009-06-08 16:43:30

3901a2004exam1solns.pdf
Path: Uni. Worcester >> ECE >> 4904 Fall, 2008
Description: ...
Date Added: 2009-06-08 16:43:43

rubricyao.pdf
Path: Ill. Chicago >> MTHT >> 400 Fall, 2008
Description: How tall is Yao I scored this as two points for each of the six parts and most people got the key issues and indeed almost full marks. The big difficulty is one with extraneous roots. Second, the author of the article in appropriately used the word `...
Date Added: 2009-06-08 16:43:46

wk03.pdf
Path: Duke >> STA >> 215 Spring, 2008
Description: 1. Suciency A statistic S = S(X) is called sucient (for ) in a model X f n (x | ) if the conditional distribution of X, given S (and of course), does not depend on ; this will be the case exactly when the density function factors as fn (x | ) = g...
Date Added: 2009-06-08 16:43:50

Lecture26.pdf
Path: Kentucky >> NRC >> 380 Fall, 2008
Description: Runoff Processes Across the Stream Corridor 11/01/06 Hydrologic Cycle Components Surface to Air Movement Interception Transpiration Evapotranspiration Infiltration Soil Moisture Ground water Soil Water Surface Water - Runoff Soil Physical Analysi...
Date Added: 2009-06-08 16:45:21

hw2 questions.ps
Path: Berkeley >> EECS >> 12203 Fall, 2008
Description: %!PS-Adobe-2.0 %Creator: dvips(k) 5.86 Copyright 1999 Radical Eye Software %Title: hw2 questions.dvi %CreationDate: Thu Feb 27 11:07:19 2003 %Pages: 3 %PageOrder: Ascend %BoundingBox: 0 0 596 842 %DocumentFonts: CMR12 CMBX12 CMMI12 CMMI8 CMSY10 %EndC...
Date Added: 2009-06-08 16:49:47

2646503_1_Boilerplates.pdf?PHPSESSID=57661aecb8d1a5266889f47a8b06b4fb
Path: Allan Hancock College >> ENGG >> 5204 Fall, 2009
Description: <?xml version=\"1.0\" encoding=\"UTF-8\"?> <Error><Code>NoSuchKey</Code><Message>The specified key does not exist.</Message><Key>499e80edd2b4f2e262bfefbdf431f22f11f85dda.pdf %3FPHPSESSID</Key><RequestId>FC4A1DB2AB8A4627</RequestId><HostId>Mj07rgRQOx9RwRG...
Date Added: 2009-06-08 16:51:15

hw2.pdf
Path: UCSB >> ECE >> 156 Fall, 2009
Description: University of California Department of Electrical and Computer Engineering ECE 156B Synthesis & CAD Homework 2 DUE: In Class, Thursday, Feb 12 Design of Simple Sequential Circuits For each part, you need to turn in (hardcopy in class, email to lylee@...
Date Added: 2009-06-08 16:51:36

COEN243_07AS5.doc
Path: Contra Costa College >> COEN >> 243 Fall, 2009
Description: COEN 243 Assignment 4 Deadline : November 23, 2007 1. ( 25 points) A plateau is a sequence of one or more consecutive occurrences of the same value in an array. For instance, the array [3, 7, 7, 9, 5, 2, 2, 2,7, 5, 5, 1] has the following plateaus ...
Date Added: 2009-06-08 16:51:42

6up-lecture13.pdf
Path: Duke >> CPS >> 104 Fall, 2009
Description: Administrivia HW #4 Due March 21 Designing Single Cycle Control Midterm II March 26 (logic design, arithmetic, data path & control) Projects, Due April 20 What to hand in: Project description: e.g., interpretations of instructions and descript...
Date Added: 2009-06-08 16:52:55

09_6up_gs8.pdf
Path: George Mason >> CS >> 455 Fall, 2008
Description: RPSXWHU 1HWZRUNV 6 ODVV 2XWOLQH ,QWHUQHWZRUNLQJ ,QWHUQHW 3URWRFRO ,3 ,QWHUQHW 5RXWLQJ 3URMHFWV :$1 :$1 ,QWHUQHW LQ WKH EHJLQQLQJ Q Q ,...
Date Added: 2009-06-08 16:55:03

Worries as San Francisco Goes Wireless.doc
Path: CSU San Marcos >> HTM >> 430 Spring, 2008
Description: Some Worries as San Francisco Goes Wireless By LAURIE J. FLYNN Published: April 10, 2006, NY Times SAN FRANCISCO, April 9 - When Mayor Gavin Newsom announced 18 months ago that he intended to provide free wireless access to all of the city\'s 760,000 ...
Date Added: 2009-06-08 16:55:18

Cell Phone and LBS.doc
Path: CSU San Marcos >> HTM >> 430 Spring, 2008
Description: NOVEMBER 6, 2006 The Long Arm of the Cell Phone They\'re becoming increasingly sophisticated tracking devices popular in social networking circles By now, anyone with a Net connection is familiar with social networking sites such as MySpace.com. The ...
Date Added: 2009-06-08 16:55:20

pre-test answers.doc
Path: BYU >> ENGLISH >> 315 Fall, 2009
Description: Key to Style Pretest 1. A 2. C 3. B 4. D 5. A 6. B 7. A 8. C 9. D 10. C 11. A 12. D 13. D 14. B 15. A 16. A 17. A 18. B 19. B 20. B 21. A 22. A 23. A 24. B 25. B 26. B 27. A 28. B 29. A 30. B 31. B 32. A 33. A 34. A 35. A 36. B 37. A 38. B 39. A 40. ...
Date Added: 2009-06-08 17:01:16

asmt04.txt
Path: N. Illinois >> C >> 240 Fall, 2009
Description: CSCI 240 Assignment 04 Due: 07/18/00 (Tue) Summer-00 (80 pts) 0. The main theme of this assignment is to review & apply the topics in: 1) Chapter 5 (Functions)...
Date Added: 2009-06-08 17:02:11

studyguide_film_ongkasbigmoka.pdf
Path: Delaware >> ANTH >> 101 Fall, 2008
Description: Ongka\'s Big Moka: The Kawelka of Papua New Guinea Film Study Guide Who are the Kawelka? Where do they live? Describe this environment. Who is Ongka? What is a \"Big Man\"? What is a Moka? What does this consist of? Who is it given to? What is the signi...
Date Added: 2009-06-08 17:05:22

plan_for_lecture_3.pdf
Path: East Los Angeles College >> EB >> 403 Fall, 2009
Description: Thursday, 25th October 2007 (2-4pm) Lecture 3: An introduction to the financial statements and sole trader accounts Key concepts This lecture covers: The accounting period Introduction to financial statements (balance sheet, profit and loss account...
Date Added: 2009-06-08 17:05:51

output_may_09.txt
Path: Colorado State >> AT >> 541 Fall, 2009
Description: Forecast results from May 9, 2003 Campus Weather Station (FCL) error points Straka 52 40 1 17 Dolan 55 38 1 18 Goering 56 37 1 18 Moore 58 ...
Date Added: 2009-06-08 17:08:20

slac-pub-2522.pdf
Path: Stanford >> PUBS >> 2500 Fall, 2009
Description: SLAC-PUB-2522 Erratum September 1980 (A/I) h A REVIEW OF ACCELERATORINSTRUMENTATION* J.-L. Pellegrin Stanford Linear Accelerator Center Stanford University, Stanford, California 94305 Please replace Fig. 17 on p. 9 with the following: 60 ft ...
Date Added: 2009-06-08 17:09:07

slac-pub-2536.pdf
Path: Stanford >> PUBS >> 2500 Fall, 2009
Description: SLAC-PUB-2536 May 1980 (T/E) NEUTRONWEAR SPIN ROTATION: EXOTIC NUCLEARPHYSICS OR A NhW WEAK FORCE?* L. Stodolsky Stanford Linear Accelerator Center Stanford University, Stanford, California and Max-Planck-Institut f;\'r Physik, Munich, Germany 94305...
Date Added: 2009-06-08 17:09:09

hw10_grad_crit.xls
Path: Acton School of Business >> COMP >> 100 Fall, 2008
Description: Comp100 HW10 Grading criteria Tutorial 3, Case 3 (pp 3.39-3.40) Item: General: Correctly named file with student name inside somewhere. Task #: 1 2a 2b 2c 2d 2e 3 4 5 6 7 8 Misc: Total Pts: Possible Points Notes 5 Check the file properties, if n...
Date Added: 2009-06-08 17:13:26

Evaluation of Consumer Article.doc
Path: Concordia Moorhead >> FNS >> 321 Fall, 2009
Description: Evaluation of Consumer Article Located a consumer article about food/nutrition/health (5 points) Attached article to evaluation (5 points) Evaluated article based on criteria discussed in class Assessed the Promoter\'s Intent (5 points) Assessed the P...
Date Added: 2009-06-08 17:13:45

Waypoints.xls
Path: CSU Northridge >> JHG >> 96848 Fall, 2009
Description: Location Waypoints Education 1 Oviat 2 Planetarium 3 Eucalyptis 4 LiveOak 5 Manzanita 6 SierraTower 7 Latitude 34.1448 34.1440 34.1434 34.1435 34.1432 34.1430 34.1427 14.4800 14.4000 14.3400 14.3500 14.3200 14.3000 14.2700 Longtitude 118.3183 118....
Date Added: 2009-06-08 17:14:21

hw9.pdf
Path: Michigan >> MATH >> 571 Fall, 2008
Description: Math 571 (Winter 2009): Homework 9 Due Date: See web page [i] Let A be a real symmetric matrices. If all its eigenvalues are positive, show that it is symmetric positive definite. On the other hand, if even one of its eigenvalues is negative or zero,...
Date Added: 2009-06-08 17:14:54

sketchesb001.pdf
Path: San Diego State >> ART >> 496 Fall, 2008
Description: ...
Date Added: 2009-06-08 17:15:39

Chapter 1.pdf
Path: East Los Angeles College >> M >> 2620 Fall, 2009
Description: Mathematical Modelling of Fluids 1.1Introduction Fluid dynamics is the study of liquids gases and plasmas Not solids: Fluids can be deformed to an unlimited extent Old subject but still very active research area 1.11 The Continuum Hypothesis 1cc ...
Date Added: 2009-06-08 17:17:19

headlines.docx
Path: San Diego State >> ART >> 496 Fall, 2008
Description: Esther Kim Art 240 Headlines From a necklace to a doll (bear-looking cell phone accessory) - Decklace - RAWR - Dollace - Nell Dhone - Neccessory - The Simple Bear Neckcessities ...
Date Added: 2009-06-08 17:17:59

slac-pub-1032.pdf
Path: Stanford >> PUBS >> 1000 Fall, 2009
Description: SLAC-PUB-1032 VW April, 1972 BREMSSTRAHLUNG MODEL CALCULATION OF HIGH ENERGY NUCLEON-NUCLEON Hector Moreno SCATTERING* Stanford Linear Accelerator Center Stanford University, Stanford, California 94305 ABSTRACT A model calculation of nucleon-nucl...
Date Added: 2009-06-08 17:18:54

book critique.doc
Path: Uni. Westminster >> JIH >> 0329 Fall, 2009
Description: Joey Hellrung COMM-338 Kim Zarkin September 23, 2006 BOOK CRITIQUE Harvesting Minds: How TV Commercials Control Kids By Roy F. Fox Harvesting Minds by Roy F. Fox is a study of how young minds perceive advertisements. Fox\'s study took place in two rur...
Date Added: 2009-06-08 17:20:04

Notes-PDE pt3.pdf
Path: Penn State >> MATH >> 251 Spring, 2008
Description: Second Order Linear Partial Differential Equations Part III One-dimensional Heat Conduction Equation revisited; temperature distribution of a bar with insulated ends; nonhomogeneous boundary conditions; steady-state solution Previously, we have lear...
Date Added: 2009-06-08 17:21:53

SIOP flyer V2.pdf
Path: Acton School of Business >> PSYC >> 1010022008 Fall, 2009
Description: Have you contemplated a career in I-O Psychology? Join us for a free, interactive Webinar! October 30th, 12 1 pm (EST) The upcoming webinar, \"Graduate School and Careers in I-O Psychology\" is a great place to start learning about the exciting caree...
Date Added: 2009-06-08 17:27:51

Project 3.txt
Path: Alabama >> CS >> 357 Fall, 2008
Description: Page 409, #P-8.2. Due Monday 21-Nov. Notes: 1. Read in data from files named: CHAIN_1.txt, CHAIN_2.txt, CHAIN_3.txt, . all located in C:\\ 2. The input keys are any integers. 3. The size of the hash table is a prime p= 17. 4. Implement the hash...
Date Added: 2009-06-08 17:30:19

LE BIOS.doc
Path: NSULA >> GEL >> 16116 Fall, 2009
Description: LE BIOS BIOS signifie Basic Input Output System. Le BIOS est une petite partie logicielle configurable stocke dans votre carte mre qui permet de contrler certaines de ses fonctions. Il est ainsi possible, en configurant correctement le BIOS de sa car...
Date Added: 2009-06-08 17:34:38

F04MPart1.ps
Path: Cincinnati >> P >> 507 Fall, 2009
Description: %!PS-Adobe-2.0 %Creator: dvips(k) 5.86 Copyright 1999 Radical Eye Software %Title: F04MPart1.dvi %Pages: 2 %PageOrder: Ascend %BoundingBox: 0 0 612 792 %DocumentFonts: CMBX12 CMR12 %EndComments %DVIPSWebPage: (www.radicaleye.com) %DVIPSCommandLine: d...
Date Added: 2009-06-08 17:35:05

attachment-0002.doc
Path: CSU Sacramento >> BB >> 20090520 Fall, 2009
Description: DRAFT CEEC Action Plan REVISED Draft 4/22/09 Action Plan Goal The California Engineering Education Council (CEEC) was formed at the request of the Governor as a vehicle for the public and private sector engineers to work together on a common goal, ...
Date Added: 2009-06-08 17:38:09

short.pdf
Path: Maryville MO >> SUIY >> 051706 Fall, 2009
Description: TOWARD POLAR 1,4-DIPHENYLBUTADIENE MATERIALS Yongqiang Sui Dr. Rainer Glaser, Thesis Supervisor ABSTRACT The fast response time of -electrons makes organic materials increasing interesting as highly anisotropic materials. We are especially intereste...
Date Added: 2009-06-08 17:38:18

Review_19_21.pdf
Path: Old Dominion >> PHYS >> 112 Spring, 2003
Description: Equations Ch. 19-21 q1 q2 F =k 2 E= F r q0 V = U q0 q 1 q E=k 2 = r 4 0 r 2 r r r r r F1,net = F12 + F13 + F14 + K F1n 0 = qenc q0 q = q0V r = EA cos V =k q r U = U b - U a = - q0 Ed V = Vb - Va = - Ed U =k 1 2 1 2 mva + qVa = mvb + qVb 2 ...
Date Added: 2009-06-08 17:38:38

questionsmicro.doc
Path: East Los Angeles College >> SCAT >> 3104 Fall, 2009
Description: Microeconomics Theory Questions 20002007 WELFARE AND GENERAL EQUILIBRIUM EITHER 1. Explain why a Walrasian equilibrium allocation is Pareto efficient. How useful is this observation as a guide to policy? (2007) Answered by about 35% candidates. This...
Date Added: 2009-06-08 17:38:48

sta676CPUsas2.txt
Path: N. Arizona >> JAN >> 676 Fall, 2009
Description: Title1 \'CPU page faults\'; Title2 \'Factorial Example - 4 Factors - Profile plots\'; Data anovadat; input seq size alloc mnlfaults; datalines; 1 1 1 3.68 1 1 2 4.04 1 1 3 6.48 1 2 1 4.29 1 2 2 4.65 1 2 3 7.80 1 3 1 5.20 1 3 2 5.57 1 3 3 8.88 2 1 1 4.16 ...
Date Added: 2009-06-08 17:39:20

Neill_2.pdf
Path: Washington >> INSC >> 510 Fall, 2008
Description: ...
Date Added: 2009-06-08 17:44:13

Patron_Interactions.doc
Path: Washington >> LIS >> 570 Summer, 2008
Description: Patron Interactions An Investigation of Methods Used By Librarians to Recognize and Overcome Patron Reticence in the Reference Interview Principal Investigators: Linda Klein, Dara Smith, Jim Foti, Clifton Ng ABSTRACT: One of the responsibilities of ...
Date Added: 2009-06-08 17:44:26

StefanFrank_pathfinder_rtf.rtf
Path: Maryville MO >> SFC >> 9406 Fall, 2009
Description: Stefan Frank\'s Pathfinder on the topic of \"Using the green screen in the foreign language classroom\" Intended Audience: Liberty High School International language staff Topic (Dewey classification: OCLC -007) : This topic is designed to help the inte...
Date Added: 2009-06-08 17:46:46

labsection6.pdf
Path: N.C. State >> CS >> 414 Fall, 2008
Description: Pesticide Labels CS 414 What is a label? A label is the information printed on or attached to the pesticide container Where Can One Find Labels? On the pesticide container Online www.cdms.net Manufacturer\'s websites Labels vs Labeling Labeling...
Date Added: 2009-06-08 17:47:33

PS11 Solutions.pdf
Path: Colorado >> PHYS >> 3210 Fall, 2008
Description: (tstt t 4 co+e 9l;-o _ -o-)- t:aez.*e, a?-w0-e) i, , o r y l d - u U^=(U *L q ) I, r+ I /^ -t ?^aA-g:L^-LnL14D e-: i V = F a0,t^0. ae cerl, o\\ a +L ,=(0 .0 2 fit(- L - urq;\\\'te z_w;(k\"*k :66r+ ) 4\')1 -Lk;le +\" (gl(- ) + -+ Yr + 7 u ?...
Date Added: 2009-06-08 17:48:18

AmeriComp.docx
Path: IUPUI >> A >> 337 Fall, 2009
Description: AmeriComp Background AmeriComp industries manufactures specialized PC components and sells them to other businesses. Customers may send Purchase Orders using either the Web or the regular mail. AmeriComp processes these identically. The following nar...
Date Added: 2009-06-08 17:48:37

Test1ReviewSheet.doc
Path: Arizona >> CS >> 127 Fall, 2008
Description: C Sc 127A Test 1 Review Sheet Spring 2009 Quick Facts o Wednesday, 25-Feb-2009 where we have lectures (CESL 102) o Sit in odd numbered seats until we run out o later arrivals sit in any left that is on an aisle even if net to another person (we will ...
Date Added: 2009-06-08 17:49:41

Homework 1 (solved).pdf
Path: GWU >> CSCI >> 234 Fall, 2009
Description: CSCI 234 Homework #1 George C. Blankenship, Jr. 1. Two blue armies are each poised on opposite hills preparing to attack a single red army in the valley. The red army can defeat either of the blue armies separately but will fail to defeat both blue a...
Date Added: 2009-06-08 17:51:58

T11704Spr96.pdf
Path: Virginia Tech >> CS >> 1704 Spring, 2003
Description: Computer Science 1704 Test 1 Spring 96 Name:_ (print, last first MI) SSN:_ GTA:_ Test Instructions Lab:_ Lecture:_ READ THIS NOW! Failure to read this cover page and follow the described instructions may result in serious repercussions! Failure t...
Date Added: 2009-06-08 17:54:22

Chap5.ppt
Path: Cal Poly Pomona >> PSY >> 334 Fall, 2009
Description: Cognitive Processes PSY 334 Chapter 5 Abstraction of Information into Memory Midterm Results Question 3 Sample Answer Behaviorism dealt more with observing behavior and explaining it through stimulus-response actions. Cognitive psychology deals...
Date Added: 2009-06-08 17:55:19

hw07.pdf
Path: Dickinson State >> EE >> 483 Fall, 2009
Description: JSG Sp\'98 EE 483 - HW Week 7 Temperature Sensors and Linearization A temperature sensor is to be built where the output goes from 0V to +20V as the temperature goes from 0C to +20C. The R vs T relationship for the sensor is given on the following pa...
Date Added: 2009-06-08 17:57:44

faf0506048.pdf
Path: LA Tech >> DOCS >> 0506 Fall, 2009
Description: Verification of Social Security Benefits Dependent Student On your original application you reported a total of $_ received by you in 2004 for social security benefits; and your parent(s) reported a total of $_ received in 2004 for social security b...
Date Added: 2009-06-08 18:00:59

faf0809016.pdf
Path: LA Tech >> DOCS >> 0809 Fall, 2009
Description: LOUISIANA TECH FINANCIAL AID FACTS AWARD LETTERS 1. RESPOND IMMEDIATELY TO YOUR AWARD LETTER Financial Aid Web site: www.latech.edu/naid YOU MUST RESPOND TO YOUR AWARD LETTER! This form details specific information which you may want or need to kn...
Date Added: 2009-06-08 18:01:26

a1000jgsa.txt
Path: Mt. Holyoke >> ASOL >> 1000 Fall, 2009
Description: a1000jgsa -11.0748 4018 -11.0295 4016 -10.9842 4011 -10.9389 4041 -10.8936 4057 -10.8483 4019 -10.8030 3974 -10.7577 3994 -10.7124 4041 -10.6671 4047 -10.6218 4033 -10.5765 4009 -10.5312 3987 -10.4859 4017 -10.4406 4055 -10.3953 4071 -10.3500 4067 -1...
Date Added: 2009-06-08 18:08:19

uniprocPres.pdf
Path: NMT >> CS >> 328 Fall, 2009
Description: Applying UML in The Unified Process Ivar Jacobson Rational Software email: ivar @rational.com Before the UML 1960\'s - 70\'s COBOL, FORTRAN, C Structured analysis and design techniques 1980\'s - early 1990\'s Smalltalk, Ada, C+, Visual Basic Early gene...
Date Added: 2009-06-08 18:17:21

HW2_sol.pdf
Path: Utah >> ECE >> 3110 Fall, 2008
Description: Assignment 2: Problem 1: Problem 3: Problem 2: Problem 4: Problem 5: Problem 7: Problem 6: ...
Date Added: 2009-06-08 18:17:25

sample.txt
Path: Arizona >> LING >> 408 Spring, 2008
Description: firstname secondname a1 a2 a3 Fred Jones C C C Mary Smith A B B Albert Gznork B A A Mike Hammond F F F ...
Date Added: 2009-06-08 18:29:43

week5.slides.pdf
Path: UCSB >> LING >> 115 Fall, 2008
Description: Week 5 notes [form] = meaning; FUNCTION [form] = meaning different [form] sound change different meaning semantic change Semantic change: a words meaning changes independently of its form Broadening: words conceptual space grows dog, bird, pilot s...
Date Added: 2009-06-08 18:30:19

Get Started With Course Hero Today!

Get study guides, join study groups, and more!
Sign up in seconds with your Facebook account!
Course Hero is a Facebook Application Partner.
Click below to sign-up for FREE.
 

Our Social Learning Network was built to provide students and key learning partners like professors a platform to share, meet and collaborate while accelerating their comprehension of course-related theories and concepts. We are committed to providing you immediate access to a growing wealth of study materials and an unparalleled academic network of students, professors and other key partners.

Why do you care? Because you want the best grade possible and at times need a 24/7 resource that’s responsive to your needs.

What People Are Saying About Course Hero

“I was going to fail my Evidence exam, but then I found a great outline on Course Hero!”
- Kim Cowan, Cornell University



“I worked for tens of hours on my chemistry lab reports this semester, and now I can publish my hard work to thousands of people who care to read about what I found.”
- David Grauer, Princeton University




“Many times, students learn best from other students, their peers, rather than from a teacher.  Course Hero provides such a forum for students to teach students.”
- Somerset Perry, Georgetown University


“Course Hero is a great new research tool for college students.  Students can find lots of pertinent information to their studies that they previously could not find or have access to.  It’s for sure an educational innovation and potentially an educational revolution.”
- Andy Suiter, UCLA and UC Davis



“As a freshman, Course Hero will help me to decide what I am actually interested in studying in college.”
- Caity Feindt, Ithaca College



“I have found lecture notes on corporate finance created by students from multiple schools, which has really helped me learn more about the subject.”
- John Stacey III, UCSB



“I study less and learn more with Course Hero.”
- John Sweazey, CU-Boulder



 

Explore the benefits of joining Course Hero's social learning network.

Get millions of study materials now!

Need lecture notes for a missed class or want insightful explanation of the theories and concepts you learn in class? Look no further, Course Hero’s Study Materials empowers you to find a broad and deep set of materials that can help you right now!

Click below to sign-up for FREE.
 

Get over 200,000 textbook solutions now!

Having difficulty with your homework and need documents that are relevant for your Textbook? Don't be frustrated. Course Hero's Textbook Help presents you study materials from many college courses.

Click below to sign-up for FREE.
 

Meet over 300,000 students and your fellow classmates now!

Want to meet your current classmates or those that took the class last year? Don’t worry or have anxiety. Course Hero’s Study Groups gives you the seamless opportunity to develop both anonymous or direct relationships with those classmates whom you want to meet and get help from right now!

Click below to sign-up for FREE.
 

Course Hero is not sponsored or endorsed by any college or university.