Course Solutions And Notes - ch18sol2 49
| lecture2.ppt Path: BU >> EC >> 518 Fall, 2009 Description: Defining the Project Goal, Deliverables, and Milestones Lecture Packet 2 2008 John W. Brackett What is a Project? A project is characterized as follows: a one-time effort is planned starting and ending dates are defined a project team is assembl... Date Added: 2009-06-16 19:33:43 |
| My Role in Adaptive Education.pdf Path: Wisc Stevens Point >> APAUL >> 241 Fall, 2009 Description: My Role in Adaptive Education In order to teach my future physical education class, I must have an understanding of adaptive education and what I can do. Without this knowledge, may be setting all my students up for failure and not allowing them to r... Date Added: 2009-06-16 19:33:49 |
| 41C-OvrviewOfFoodProcesing.ppt Path: Montana >> BIO >> 102 Fall, 2009 Description: CHAPTER 41 ANIMAL NUTRITION Section C: Overview of Food Processing 1. The four main stages of food processing are ingestion, digestion, absorption, and elimination 2. Digestion occurs in specialized compartments Copyright 2002 Pearson Education, I... Date Added: 2009-06-16 19:34:15 |
| in2.txt Path: Yale >> CS >> 223 Fall, 2009 Description: bqc... Date Added: 2009-06-16 19:35:35 |
| classesS.txt Path: CSU Fullerton >> OPS >> 435 Fall, 2009 Description: # classes script - place a list of students into course sections section=A while read input do echo \"UNX510$section $input\" > /tmp/classes.temp.$ section=$(echo $section | tr [A-N] [B-NA]) done < classlist.txt sort -k1,1 -k3 /tmp/classes.temp.... Date Added: 2009-06-16 19:36:50 |
| make_addition_plot_b.ps Path: RIT >> PHYS >> 312 Fall, 2009 Description: %!PS-Adobe-2.0 %Title: make_addition_plot_b.ps %Creator: gnuplot 4.0 patchlevel 0 %CreationDate: Wed May 16 09:25:53 2007 %DocumentFonts: (atend) %BoundingBox: 50 50 554 770 %Orientation: Landscape %Pages: (atend) %EndComments /gnudict 256 dict def g... Date Added: 2009-06-16 19:41:24 |
| Day21.pdf Path: Rose-Hulman >> ME >> 410 Fall, 2009 Description: ME 410 Day 21 It is also possible to calculate the imep based on this information. W mQ imep = c = f f LHV = Vd V1 V2 f mq* 1 V11 r c f q* f q* imep = = V1 1 RT1 rc 1 1 m rc P1 rc Now, R = c p c v = ( 1)c v q* 1 rc ... Date Added: 2009-06-16 19:44:00 |
| 556fin.ps Path: University of Louisiana at Lafayette >> INTERVAL >> 555 Fall, 2009 Description: %!PS-Adobe-2.0 %Creator: dvips 5.58 (gTeX distribution 2.2) Copyright 1986, 1994 Radical Eye Software %Title: 556fin.dvi %CreationDate: Mon Apr 27 17:31:22 1998 %Pages: 3 %PageOrder: Ascend %BoundingBox: 0 0 612 792 %EndComments %DVIPSCommandLine: f:... Date Added: 2009-06-16 19:44:41 |
| lecture3.ps Path: NJIT >> ECE >> 777 Fall, 2009 Description: %!PS-Adobe-3.0 %Title: Lecture 3 %Creator: PSCRIPT.DRV Version 4.0 %CreationDate: 09/26/01 08:06:25 %BoundingBox: 10 15 601 783 %Pages: (atend) %PageOrder: Special %Requirements: %DocumentNeededFonts: (atend) %DocumentSuppliedFonts: (atend) %Document... Date Added: 2009-06-16 19:46:14 |
| MelissaS_Cover.pdf Path: UNC Greensboro >> ENG >> 621 Fall, 2008 Description: Military deployment is not just a problem with which only military spouses and their families have to contend. It\'s a national problem, affecting children in cities and towns across the nation, not just on military bases. This book is addressed to th... Date Added: 2009-06-16 19:47:09 |
| rubric_jump_up.xls Path: Pittsburgh >> PHYS >> 0475 Fall, 2008 Description: Evaluation: Lab Report 3 Group: Missing Excel. Poor Fair Section Points 0 0 1 2 3 Section Scores Comments 0 Title (only negative points awarded) Describes lab concisely, adequately, appropriately N/AN/AN/A Author list complete, with roles an... Date Added: 2009-06-16 19:48:43 |
| SCALE-UP Rubric Lab01.pdf Path: Pittsburgh >> PHYS >> 0475 Fall, 2008 Description: GENERAL GUIDELINES FOR WRITTEN LAB REPORTS Title A good title should describe lab concisely, adequately, appropriately. List the students who worked on the lab, your group number, and the roles each of you played (Manager, Recorder, Skeptic). If a gr... Date Added: 2009-06-16 19:48:43 |
| R-Series Motor Drawings.pdf Path: CSU Chico >> MECH >> 140 Fall, 2009 Description: Catalog 8000-3/USA Motor Dimensions ZETA ZETA Series CE Motor Dimensional Drawings Size 23 Frame, O Series Dimensions in inches (mm) 0.200 (5.08) dia (4) on 2.625 (66.68) BC 45 2.25 (57.2) 1.86 (47.2) 0.2500(6.350) 0.2495(6.337) Shaft Dia 13.5 (34... Date Added: 2009-06-16 19:49:31 |
| short.pdf Path: Maryville MO >> CARRS >> 101608 Fall, 2009 Description: HUB ARC SELECTION FOR LESS-THAN-TRUCKLOAD CONSOLIDATION Sean Carr Dr. Wooseung Jang, Thesis Supervisor ABSTRACT For more than twenty years, shipment consolidation has been utilized as a method to significantly decrease the cost of transporting goods... Date Added: 2009-06-16 19:49:33 |
| A History of Disempowerment.doc Path: Laurentian >> ANTH >> 200503 Fall, 2009 Description: A History of Disempowerment Bhils, Bhilalas, Tadvis and Vasawas in the Narmada Valley Map of the Dams Introduction to a History of the Hill Tribes Topography: The Narmada River is about 2,000 km. long, rising in the central plains and dropping throu... Date Added: 2009-06-16 19:49:34 |
| ECE801 Tuesday Thursday Fall Schedulenew.doc Path: Clemson >> ECE >> 801 Fall, 2009 Description: ECE 801 Course Schedule/Assignments CLASS# 1 DATE Aug 25 TOPICS Models of Linear SystemsLinear Systems and State Equations Linearization of Nonlinear Equations. Vector and Vector SpacesVectors, Vector Spaces, Gram-Schmidt Procedure, Subspaces and Vec... Date Added: 2009-06-16 19:49:38 |
| freedman_abs.txt Path: RIT >> PHYS >> 240 Fall, 2009 Description: Abstract We report on the discovery of 30 new Cepheids in the nearby galaxy M81 based on observations using the Hubble Space Telescope (HST). The periods of these Cepheids lie in the range of 10-55 days, based on 18 independent epochs using the HST ... Date Added: 2009-06-16 19:50:35 |
| lect11.pdf Path: Duke >> STAT >> 101 Fall, 2009 Description: 11.0 Surveys Random Samples Bias and Variance Problems 1 11.1 Random Samples In a simple random sample of n units from a population, each unit is equally likely to be chosen, each pair of units is equally likely to be chosen, and so forth, un... Date Added: 2009-06-16 19:52:10 |
| pp7sol.pdf Path: Washington University in St. Louis >> CSE >> 260 Fall, 2009 Description: CSE 260 Digital Computers: Organization and Logical Design Practice Problems 7 Solutions Jon Turner 1. If a sequential circuit is operated using a clock that has a frequency of 50 MHz, what is the time between consecutive rising clock edges? The t... Date Added: 2009-06-16 19:54:41 |
| hw4.pdf Path: Delaware >> CPEG >> 421 Fall, 2008 Description: CPEG 421: Topics in Compiler Design: The Software and Hardware Tradeoffs Handout: Homework #4 Issue Date: Tuesday, April 8, 2008 Due Date: Tuesday, April 22, 2008 Instructions Please write the answer to each problem on one sheet of paper. Be as conc... Date Added: 2009-06-16 19:54:57 |
| review2.pdf Path: Michigan State University >> HAMIL >> 199 Fall, 2009 Description: J. Ross Hamilton ATL 110 Sect. 009 Frank Manista 9/19/02 Prenatal Structuring of Offspring and its Ethical Dilemmas One of the questions that has recently plagued me has been that of which is about the genetic structuring of our offspring. I ask myse... Date Added: 2009-06-16 19:55:53 |
| CSE396ps10.pdf Path: SUNY Buffalo >> CSE >> 396 Fall, 2009 Description: CSE396, Fall 2007 Problem Set 10 (the last) Due Thu. Dec. 6 The Final Exam is on Thursday Dec. 13, 11:45am2:45pm in Clemens 322. It will be open-book, open-notes. It will cover all of the course material, Chapters 15 and 7, skipping the regular-la... Date Added: 2009-06-16 19:57:02 |
| HINTS_Fall_exam3_2005.doc Path: Penn State >> METEO >> 414 Fall, 2008 Description: Meteo 414, Fall 2005 Study suggestions for the third exam For Meteo 414, I favor questions of the short answer (a few sentences) or problem solving type. I often used a fill-in-the-blank or yes/no question followed by a \"Why?\" question requesting a d... Date Added: 2009-06-16 19:59:56 |
| q5_soln.pdf Path: University of Illinois, Urbana Champaign >> MATH >> 181 Fall, 2008 Description: ... Date Added: 2009-06-16 20:03:39 |
| preq3.pdf Path: University of Illinois, Urbana Champaign >> MATH >> 221 Fall, 2008 Description: Math 221 AD6 Pre-Quiz 3 TA: Rosona Eldred Sep 9th, 2008 1. Taylor is asked to calculate the following limit: x2 - x - 6 x3 x2 - 5x + 6 lim Name: Taylor says \"Well, since lim x2 - x - 6 exists and lim x2 - 5x + 6 exists, then my x3 x3 first step sho... Date Added: 2009-06-16 20:03:43 |
| ADP 2007 1 9 Readability factors.doc Path: East Los Angeles College >> LING >> 402 Fall, 2009 Description: ACADEMIC DISCOURSE PRACTICES Characteristics of a good essay Argumentation Check that: Your position has been made clear. Opinion is not presented as fact. Argumentation and claims are explained and well supported. Possible ways of doing this ar... Date Added: 2009-06-16 20:06:38 |
| rfc1087.txt Path: Arkansas Tech >> CS >> 4303 Fall, 2009 Description: Network Working Group Internet Activities Board Request for Comments: 1087 January 1989 Ethics and the Internet Status of this Memo This memo is ... Date Added: 2009-06-16 20:08:10 |
| cs212_exam_1.pdf Path: Binghamton >> CS >> 212 Fall, 2009 Description: CS212 Spring 2009 Exam 1 ... Date Added: 2009-06-16 20:08:23 |
| sq2.doc Path: Idaho >> HARR >> 4057 Fall, 2009 Description: Nicholas C Harris Drake - Monsters August 31, 2005 SQ# 2 Medusa 1) What is the essence of Medusa\'s crime or \"sin\"? The essence of Medusa\'s crime lies within her vanity. She thinks herself to be more beautiful than Athena. \"She was once a beautiful ma... Date Added: 2009-06-16 20:09:25 |
| 3stats tables HO.pdf Path: Idaho >> FCS >> 504 Spring, 2008 Description: ... Date Added: 2009-06-16 20:10:35 |
| JennieO_turkey_contract.ppt Path: Maryville MO >> AGEC >> 3256 Fall, 2009 Description: 1. 17 pages Cover Page is NOT \"part of the contract\" 1. Is this plain language? What is the purpose of the cover page? Is it required by statute? Would Missouri growers get the same cover page? 1 2. 2. Why is this important? propert... Date Added: 2009-06-16 20:10:52 |
| csc231l01m.ppt Path: Cal Poly >> CSC >> 231 Fall, 2009 Description: CSC-231m Lecture 1 Introduction History of Computers What You Will Need 1 Today\'s Topics Who IS this guy in front of the room? How will the course be taught? A brief history of computers. An overview of computer hardware. What is MATLAB? 2 Ma... Date Added: 2009-06-16 20:10:58 |
| eof.ps Path: N.C. State >> ST >> 810 Fall, 2008 Description: ... Date Added: 2009-06-16 20:16:47 |
| syl_344_spr_07.pdf Path: New Mexico >> ECE >> 344 Fall, 2009 Description: Microprocessors ECE 344 - Spring 2007 Email: pollard@ece.unm.edu Office Hrs: Mon. & Wed. 10 AM Noon (Other times by appointment) Web Info: www.ece.unm.edu/faculty/pollard Text: There is no commercially available textbook for this class. This means t... Date Added: 2009-06-16 20:21:37 |
| 595_asg3_06.pdf Path: New Mexico >> ECE >> 595 Fall, 2008 Description: EECE 595 Embedded System Design Assignment 3: State Machine and Control System Problems Due Monday of Finals Week Modification of problem 8.3: Describe the elevator UnitControl and also the RequestResolver; these elements discussed in the text and s... Date Added: 2009-06-16 20:21:54 |
| physics.pdf Path: UCF >> MANUAL >> 0102 Fall, 2009 Description: 2001-2002 UNIVERSITY OF CENTRAL FLORIDA TRANSFER SERVICES HOTLINE (407) 823-5959 WEB SITE http:/pegasus.cc.ucf.edu/~relation PHY 4912 Directed Independent Research 3 hrs (should be done in the area of specialization) Laboratory requirements PHY 3802L... Date Added: 2009-06-16 20:26:36 |
| ep_fl_dat.txt Path: Berkeley >> ASTRO >> 00106709 Fall, 2009 Description: # Ep dEp lprob lEiso dlEiso 67.040 0.054 -4.90e-06 117.097 0.109 67.097 0.061 -4.38e-05 117.097 0.103 67.163 0.070 1.81e-05 117.097 0.102 67.238 0.081 -1.85e-04 117.097 0.102 67.325 0.092 -3.21e-04 117.097 0.102 67.423 0.106 -5.08e-04 117.097 0.102 6... Date Added: 2009-06-16 20:27:54 |
| carbonyles-60.pdf Path: NSULA >> CHM >> 19078 Fall, 2009 Description: T. Ollevier Chimie organique II CHM-19078 5. Certains aldhydes (l\'actaldhyde est reprsent ici) ont t convertis en imidazolines selon la raction suivante. Le produit est un analogue azot d\'un actal. crivez le mcanisme dtaill de cette raction. H N +... Date Added: 2009-06-16 20:28:50 |
| MATH11219 Assignment 3 Model Solutions.doc Path: Allan Hancock College >> MATH >> 11219 Fall, 2009 Description: MATH11219 Assignment 3 Model Solutions Print out these solutions and take them with you to the exam. Get in touch if any questions arise. Question 1. OK, seeing the numerator is nowhere near being the derivative of the denominator allowing us to use... Date Added: 2009-06-16 20:29:30 |
| tarea3.ps Path: UC Davis >> MATH >> 114 Fall, 2009 Description: %!PS-Adobe-2.0 %Creator: dvipsk 5.58f Copyright 1986, 1994 Radical Eye Software %Title: tarea3.dvi %Pages: 2 %PageOrder: Ascend %BoundingBox: 0 0 612 792 %DocumentPaperSizes: Letter %EndComments %DVIPSCommandLine: dvips -o tarea3.ps tarea3.dvi %DVIPS... Date Added: 2009-06-16 20:31:06 |
| Winters.xls Path: UMKC >> BDS >> 545 Fall, 2008 Description: Data Entry Sheet This spreadsheet can support : The fitted up to 26 Observations Seasonality 4 The forcasted up to 6 Observations (Press \'Ctrl+a\' to change the number of the fits and the forecasts.) (Press \'Ctrl+k\' to fit the WINTERS model.) (Press \'... Date Added: 2009-06-16 20:33:38 |
| tutorial2.pdf Path: ECCD >> SCS >> 1805 Fall, 2009 Description: COMP/MATH 1805 Discrete Structures Tutorial 2 May 19, 2009 1. Recall that, for nite universes of discourse, the quantier notations and are essentially shorthand for conjunctions and disjunctions. If the universe of discourse consists only of the t... Date Added: 2009-06-16 20:34:44 |
| tutorial6_2_.pdf Path: Allan Hancock College >> COMP >> 5116 Fall, 2009 Description: NETS3007/3907 Network Protocols Tutorial 8 (TCP - 2) 1. What is the maximum size of the TCP header? Minimum size? 2. One of the TCP options permits a receiver to specify the maximum segment size it is willing to accept. Why does TCP support an optio... Date Added: 2009-06-16 20:35:52 |
| log bound.xls Path: Minnesota >> CS >> 5541 Fall, 2008 Description: actual path cost 10 20 30 40 50 60 70 80 90 100 110 120 130 140 150 160 170 180 190 200 210 220 230 240 250 260 270 280 290 300 310 320 330 340 350 360 370 380 390 400 410 420 430 440 450 460 470 480 490 500 510 1 1.3 1.48 1.6 1.7 1.78 1.85 1.9 1.95 ... Date Added: 2009-06-16 20:36:06 |
| handout 19.pdf Path: UMass (Amherst) >> RESE >> 211 Fall, 2009 Description: ... Date Added: 2009-06-16 20:36:45 |
| proj2_f99_p4.pdf Path: Minnesota >> ME >> 5241 Fall, 2008 Description: ME 5241 Computer Aided Engineering Fall 1999 Project #2, Part 4 Multi-Dimensional Search Function (due Thursday, 10/28/99) Write a function to perform a conjugate gradient or BFGS search in a multi-dimensional search space having any dimension. Und... Date Added: 2009-06-16 20:39:13 |
| Lab B final grades.pdf Path: UMBC >> ANTH >> 250 Fall, 2009 Description: Anthropology 250-001B Grades A 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 B ID C D E Final Grade Case /25 21 21.5 17.75 14 12.6 16.9 11.5 17.75 10.75 17.75 F G H I J K L 262038 A 263731 A286476 B292897 C 301163 D 303361 B303781 B... Date Added: 2009-06-16 20:41:23 |
| Final Poster Design.pptx Path: RIT >> P >> 09203 Fall, 2009 Description: P09203 20082009 RP1: Second GenENRATION 1KG Motor Module Sponsor: Dr. Edward Hensel Mechanical Engineering Department Faculty Guide: Dr. Wayne Walter Mechanical Engineering Department Team Members from left to right: Greg Leaper (ME) Michael Ega... Date Added: 2009-06-16 20:43:27 |
| pp342346.pdf Path: Virginia Tech >> CS >> 4984 Fall, 2008 Description: Chapter I11 TRADE SECRECY A. INTRODUCTION In the early days of software, trade secrets were the primary means of protection. Three major changes affecting the use of trade protection occurred in the 1980s. As demonstrated in the previous chapters, c... Date Added: 2009-06-16 20:44:53 |
| lect5_filter1.ppt Path: ECCD >> COMP >> 4900 Fall, 2009 Description: Filtering (I) Dr. Chang Shu COMP 4900C Winter 2008 Agenda Getting to know images. Image noise. Image filters. Digital Images An image - rectangular array of integers Each integer - the brightness or darkness of the image at that point N: # of ro... Date Added: 2009-06-16 20:44:55 |
| Homework_2_Key.pdf Path: Fayetteville State University >> BCH >> 5505 Fall, 2009 Description: Homework 2 Key BCH5205 Michael S. Chapman 9/24/2005 BCH5205: Homework 2 (c) M.S.Chapman 1 For the following molecular fragments, show likely directions of possible H-bonds with other molecules, showing the directions with arrows pointing from don... Date Added: 2009-06-16 20:46:53 |
| E-101 (ELECTRICAL).pdf Path: Penn State >> JRT >> 5027 Fall, 2009 Description: ... Date Added: 2009-06-16 20:48:04 |
| Cytokinins - Lateral Roots & Rhizobia.pdf Path: Maryland >> PLSC >> 400 Fall, 2008 Description: The Plant Journal (2004) 38, 203214 doi: 10.1111/j.1365-313X.2004.02038.x Cytokinins play opposite roles in lateral root formation, and nematode and Rhizobial symbioses Dasharath Prasad Lohar1,y, Jennifer E. Schaff1, James G. Laskey2, Joseph J. Kie... Date Added: 2009-06-16 20:49:46 |
| hopfield95.pdf Path: Berkeley >> VS >> 298 Fall, 2008 Description: ... Date Added: 2009-06-16 20:53:14 |
| hw8-key.pdf Path: Washington >> GENOM >> 453 Fall, 2009 Description: EVOLUTIONARY GENETICS (Genome 453) Homework 8: due November 29 A certain songbird exists in two types, Coastal and Inland, separated by a desert. The Inland form differs from the Coastal form by several chromosome rearrangements. As a result, if we... Date Added: 2009-06-16 20:53:52 |
| Population growth.doc Path: Uni. Westminster >> JLK >> 0627 Fall, 2009 Description: Population growth-water, food, supplies Portland Oregon ex. Of limited use (research) public transports Traffic, Give proposition, that population growth needs to be limited Give my data that says why this is a problem Give an example of how to stop ... Date Added: 2009-06-16 20:54:07 |
| hw2-sum2006.pdf Path: Texas >> CS >> 341 Fall, 2008 Description: ... Date Added: 2009-06-16 20:55:30 |
| sn1984l_1984_09_04.ps Path: Southern Oregon >> D >> 1984 Fall, 2009 Description: ... Date Added: 2009-06-16 20:55:46 |
| S09 IFS440 Use Case Template.doc Path: YCP >> DRAGON >> 440 Fall, 2009 Description: Heading Section Use Case Name: System Name: Author(s): Date: Narrative: Actor(s): Output(s): Precondition(s): Postcondition(s): Trigger: Others: Verb + adjective + object The name of the system Your name(s) Date last revised A paragraph or two that d... Date Added: 2009-06-16 20:57:26 |
| ans_wk03.doc Path: Allan Hancock College >> COIS >> 12041 Fall, 2009 Description: #C#ans_wk03.doc#[}p\\Wu#I# .zw#\'HUF*liI{Z#edJ#3ISRhg2 #e ? t0#M#J#wcWZGq#?{}9 NNe%: bc#P# ^>{,uU#g/#g>#b\\#|Y#/+b#8N#bQ! vK}#q upg6#v!F!w?_Ya?@?Mz#U=? #2#z/ xy!J>:Wq=nMF7hh1#<yjNzDmB#HZ;yX}^{ in#_B Vxq:4#?:>#CxW#3: #ow\\&#rYyru\\%7^#+O\'L#-q#... Date Added: 2009-06-16 20:58:10 |
| CSC127B.doc Path: Arizona >> CS >> 227 Fall, 2008 Description: Chapter 12 Interfaces Goals Understand what it means to implement a Java interface Use the Comparable interface to have any type of elements sorted and binary searched 12.1 Java Interfaces Java has 422 interfaces. Of the 1,732 Java classes, 646... Date Added: 2009-06-16 20:58:31 |
| L14A.ppt Path: Elon >> PHY >> 111 Fall, 2009 Description: PHYSICS DEPARTMENT Sound Waves 14.1-14.4 with Dr. Anthony Crider STUDENT LEARNING OBJECTIVES Sound as a Longitudinal Wave Range of Human Hearing The Speed of Sound in Air The Speed of Sound in Other Stuff Intensity and Decibels Transverse & L... Date Added: 2009-06-16 21:01:48 |
| fa-1-sol.pdf Path: Berkeley >> CS >> 170 Fall, 2006 Description: CS 170 (Clancy) Fall 2000 Problem 2, exam 1 Solutions to relevant spring 2000 exam problems Here\'s Prim\'s algorithm, modified slightly to use C syntax. MSTPrim (G, w, r): Q = V[G]; for (each u Q) { key[u] = ; } key[r] = 0; [r] = 0; while (Q not em... Date Added: 2009-06-16 21:02:16 |
| mat271.ps Path: ASU >> MAT >> 271 Fall, 2009 Description: %!PS-Adobe-2.0 %Creator: dvips(k) 5.85 Copyright 1999 Radical Eye Software %Title: mat271.dvi %Pages: 4 %PageOrder: Ascend %BoundingBox: 0 0 612 792 %EndComments %DVIPSWebPage: (www.radicaleye.com) %DVIPSCommandLine: dvips mat271 %DVIPSParameters: dp... Date Added: 2009-06-16 21:04:35 |
| a5.doc Path: St. Thomas >> PERSONAL >> 601 Fall, 2009 Description: CSIS512 Assignment 5: Algorithms Text: Robert Lafore, Data Structures and Algorithms in Java, 2nd Edition, SAMS 2003. ISBN: 0-672-32453-9 P313. Questions: 6.1; 6.3 P112. Questions: 3.1; 3.2; 3.3; 3.5 ... Date Added: 2009-06-16 21:04:53 |
| 5550-S2007-Barker.pdf Path: Southern Oregon >> CAS >> 5550 Fall, 2009 Description: History of Science 5550 Cognitive Studies of Science Prof. Peter Barker Office: PHSC 617 tel. : 325-2242 e-mail: BarkerP@ou.edu Course Information Class meets: W 6:30 - 9:30 pm, PHSC 627 (HSCI conference room). Office hours: TuTh 11:0012:00 or by ap... Date Added: 2009-06-16 21:05:04 |
| rlist6.txt Path: Utah >> SPIN >> 134 Fall, 2009 Description: Block: 6 Size: 644 - Printing 115 polynomials . Maximum Degree: 8 -> -q^8+2q^7-q^6 Maximum Coefficient: 20 -> 2q^6-10q^5+20q^4-20q^3+10q^2-2q - 0 1 q-1 -q+1 -q^2+2q-1 q^2-2q+1 q^2-q -q^2+q -q^3+2q^2-q q^3-2q^2+q q^3-2q^2+2q-1 q^3-q^2 q^2-3q+2 q^4-... Date Added: 2009-06-16 21:07:57 |
| lab7.pdf Path: Berkeley >> EE >> 1301 Fall, 2008 Description: University of Minnesota EE 1301: Introduction to Computing Systems Spring 2003 Lab 7 Advanced LC-2 Assembly Language Programming (50 points) Reading: The LC-2 simulator manual and Chapters 7-10 of Patt and Patel. Goal: This lab will further develop y... Date Added: 2009-06-16 21:16:42 |
| rb.pdf Path: George Mason >> CS >> 310 Fall, 2008 Description: x y z y x z a b c d a b c d w y w x y z x z e a b c d a b c d e w w y x y z x z e a b c d e a b c d r s y r s x y z x z e a b c d f a b c d e f r s r y s x y z x z e a b c d f e a b c d f 50 insert 67 3... Date Added: 2009-06-16 21:18:10 |
| google.ppt Path: Berkeley >> I >> 213 Spring, 2009 Description: SIMS213: UserInterfaceDesign& Development MartiHearst Tues,Feb6,2007 ThisWeek MoreonUserResearch DesigningInterview/SurveyQuestions CognitiveConsiderations Affordances Mappings MentalModels NormansActionCycle UserResearch@Google SlidesbyDanRu... Date Added: 2009-06-16 21:19:26 |
| grades.txt Path: ASU >> CSE >> 434 Fall, 2008 Description: 00072356 1 100 55 100 97 95 40 97 100 87 00049879 2 51 50 100 50 70 37 20 60 67 00052695 3 63 38 85 73 70 30 20 50 72 00092959 4 0 44 100 70 85 44 92 100 66 00095938 5 62... Date Added: 2009-06-16 21:19:48 |
| reading guide 7.docx Path: Uni. Westminster >> KSS >> 0130 Fall, 2009 Description: Kelly Stevens Reading Guide #7 EDUC 343 Spring 2008 1. In reading, On Solid Ground, I noticed a difference between what I have come to know as a \"typical center\". Taberski talks about how organization is essential and that if materials are in place ... Date Added: 2009-06-16 21:21:34 |
| 16-GPGPUreductions.4p.pdf Path: UCSC >> CMPE >> 220 Fall, 2008 Description: Tue Nov 13 12:24:13 PST 2007 Tue Nov 13 12:24:13 PST 2007 <> <> 11 23 46 3 42 6 67 98 1 ... Date Added: 2009-06-16 21:22:39 |
| Krathwohl & Smith 2005 Chap 5.pdf Path: North Texas >> GEOG >> 4800 Fall, 2008 Description: w0 R K SHE E T 4.3 (coni.) CHAPTER 5 The Method Section CHAPTER CONTENTS c~a~. whY~Y$hIdl~ . appropri;i_1Y~ . qU~ih~ or lnad~1lJ? Cleady ~ ~ Illy study will both build UpOrt,. Section 1: General Considerations 76 Adapt the Material on M... Date Added: 2009-06-16 21:23:27 |
| ma676ps6.pdf Path: Kentucky >> MA >> 676 Fall, 2008 Description: MA676 Spring 2009 Homework Problem Set #6 Due: Friday, 17 April 2009 April 7, 2009 These problems are on the material in chapter 3 of Stein-Shakarchi. These problems are due Friday, 17 April 2009. Problem discussion Friday, 10 April at 4PM. ( WZ mean... Date Added: 2009-06-16 21:25:05 |
| lecture33.ppt Path: Arizona >> NATS >> 101 Fall, 2006 Description: NATS 101 Lecture 33 Natural Climate Variability What is Climate Change? Climate change - A significant shift in the mean state and event frequency of the atmosphere. Climate change is a normal component of the Earths natural variability. Climate ... Date Added: 2009-06-16 21:25:35 |
| mktg 4.doc Path: Uni. Westminster >> ACC >> 1105 Fall, 2009 Description: Alissa Christensen MKTG 300-01 Spring, 2007 Writing Assignment 4 1. The primary data collection method in the VW article is the Primary data using a mix of Observational data. This company is getting into their customers lives. They are observing the... Date Added: 2009-06-16 21:25:44 |
| section_R.3_post_lecture_notes.pdf Path: Kennesaw >> MATH >> 1111 Fall, 2008 Description: Lecture Notes Section R.3 p.18, Polynomials (algebraic expressions) Definitions 12x 0 12 1 12 Term an element separated by a or - within a polynomial Within a term we can have coefficients, variables and exponents Coefficient leading numeric p... Date Added: 2009-06-16 21:26:27 |
| 2411_assign_3.doc Path: Minnesota >> STAT >> 2411 Fall, 2008 Description: Stat 2411 S 2008 Assignment #3 Due Friday Feb 15 Section Problems 5.3 15t 22t 23t 24, 27, 28t 31t 33t 34t 35t 5.4 43t 44t 49, 51, 54t 55 6.4 6.47*, 6.49* 6.6 6.54, 6.55, 6.56. 6.57, 6.62, 6.63, 6.64, 6.67t 6.69* For the problems marked * , write down... Date Added: 2009-06-16 21:27:44 |
| lec25.ps Path: Berkeley >> CS >> 280 Fall, 2008 Description: #%-12345X@PJL JOB @PJL SET RESOLUTION = 600 @PJL ENTER LANGUAGE = POSTSCRIPT %!PS-Adobe-3.0 %Title: Microsoft Word - CS280lec.doc %Creator: Windows NT 4.0 %CreationDate: 13:11 5/3/1999 %Pages: (atend) %BoundingBox: 13 13 599 780 %LanguageLevel: 2 %Do... Date Added: 2009-06-16 21:28:51 |
| key8.ps Path: Washington >> B >> 571 Fall, 2009 Description: %!PS-Adobe-2.0 %Creator: dvips(k) 5.92b Copyright 2002 Radical Eye Software %Title: h8.dvi %Pages: 1 %PageOrder: Ascend %BoundingBox: 0 0 612 792 %DocumentFonts: CMR17 CMR12 CMR10 CMMI10 CMTT10 CMR7 CMEX10 %EndComments %DVIPSWebPage: (www.radicaleye.... Date Added: 2009-06-16 21:29:28 |
| chapter7small.pdf Path: JMU >> MATH >> 220 Fall, 2008 Description: Section 7.1 What Are Point and Interval Estimates of Population Parameters? May 11, 2009 1 7 Statistical Inference: Intervals Confidence 7.1 What Are Point and Interval Estimates of Population Parameters? In this chapter we discuss point estimat... Date Added: 2009-06-16 21:30:22 |
| assign8.pdf Path: Allan Hancock College >> WEB >> 902 Fall, 2009 Description: UNIVERSITY OF WOLLONGONG School of Mathematics and Applied Statistics STAT902. Advanced Data Analysis Assignment 8 Due: 2:30pm Wednesday, 2nd May, 2007. BUGS preliminaries This assignment deals mainly with fitting and making inference for Bayesian ... Date Added: 2009-06-16 21:32:03 |
| hw3.pdf Path: Walla Walla University >> CPTR >> 350 Fall, 2009 Description: Cptr350 Homework #3 DUE: Wednesday, January 28, Start of class Objective Gain an understanding of the issues involved in computer arithmetic. To Do Do the following problems from chapter 3 of your textbook: 3.4.2 (Multiplication) 3.6.4-6 (Multipl... Date Added: 2009-06-16 21:32:41 |
| mid-term_2002.pdf Path: USF >> EEL >> 6935 Fall, 2008 Description: EEL 6935 WBG Semiconductors I MIDTERM EXAM March 5, 2002 Instructions: This is a closed book, closed notes test. You are allowed only your calculator and a writing instrument. All work is to be completed by the individual alone. All tables and graph... Date Added: 2009-06-16 21:32:44 |
| l22.ps Path: Rutgers >> CS >> 520 Fall, 2009 Description: %!PS-Adobe-2.0 %Creator: dvips 5.528 Copyright 1986, 1994 Radical Eye Software %Title: l22.dvi %CreationDate: Wed May 1 15:12:56 2002 %Pages: 12 %PageOrder: Ascend %BoundingBox: 0 0 612 792 %DocumentFonts: CMR12 CMR17 CMTI12 CMSY10 CMBX12 CMMI12 %End... Date Added: 2009-06-16 21:33:01 |
| lab24.doc Path: Evergreen >> ACADEMIC >> 0203 Fall, 2009 Description: DRAFT of Lab 2.4: Mass + Spring + Rubber band Differential Equations, Fall 2002, TESC Text = Differential Equations (2002, ed.2) by Blanchard, Devaney, and Hall (pp.221-223) 10.Jan. 2003 - E.J. Zita __ Overview: We investigate a mass on a spring wit... Date Added: 2009-06-16 21:33:05 |
| Explaining.pdf Path: Arizona >> MATH >> 302 Fall, 2008 Description: Making Sense of Explaining Why Adapted from Sybilla Beckmann A Good Explanation Question: Use the meaning of fractions to explain why 2 2 57 = 3 3 57 114 = 171 .) Do not use multiplying by 1 to explain this. (In other words, explain why 2 3 Solu... Date Added: 2009-06-16 21:33:45 |
| hw2sol-spr2001.ps Path: Georgia Tech >> CS >> 4251 Fall, 2008 Description: %!PS-Adobe-2.0 %Creator: dvipsk 5.526a Copyright 1986, 1993 Radical Eye Software %Title: hw2sol.dvi %Pages: 4 %PageOrder: Ascend %BoundingBox: 0 0 612 792 %EndComments %DVIPSCommandLine: dvips hw2sol.dvi -o %DVIPSParameters: dpi=300, comments removed... Date Added: 2009-06-16 21:34:56 |
| Limiting Reagents Practice Problems.pdf Path: MSU Billings >> CHEM >> 115 Fall, 2009 Description: Limiting Reactants and Yield Practice Problems These problems will help you practice a variety of skills you will need to learn for the Chapter 6 unit. In each of the following problems, you must first determine the correct chemical formula for each ... Date Added: 2009-06-16 21:36:25 |
| verilog_intro.pdf Path: SMU - Cox School of Business >> CSE >> 3100 Fall, 2009 Description: Verilog Example / Description of simple circuit Fig. 3-37 module smpl_circuit (A,B,C,x,y); input A,B,C; output x,y; wire e; and g1(e,A,B); not g2(y,C); or g3(x,e,y); endmodule Some Verilog Syntax Approximately 100 keywords (lowercase) Verilog IS c... Date Added: 2009-06-16 21:37:27 |
| pictograph.xls Path: U. Houston >> CUIN >> 3111 Fall, 2008 Description: Number of Students Colors Blue Red Yellow Purple Green # 6 3 4 5 6 7 6 5 4 3 2 1 0 Blue Red Favorite Color # Yellow Color Purple Green Favorite Color Blue Red Yellow Purple Green # Green ... Date Added: 2009-06-16 21:38:53 |
| Math181worksheet13key.pdf Path: Iowa State >> MATH >> 181 Fall, 2008 Description: ... Date Added: 2009-06-16 21:39:29 |
| Math182worksheet6key.pdf Path: Iowa State >> MATH >> 182 Fall, 2008 Description: ... Date Added: 2009-06-16 21:39:41 |
| Visual - Social Learning Theory.doc Path: Fayetteville State University >> MMC >> 6469 Fall, 2009 Description: Social Learning Theory or Social Cognitive Theory Concept Reciprocal Determinism Behavioral Capability Expectations Definition Behavior changes result from interaction between person and environment; change is bidirectional Knowledge and skills to ... Date Added: 2009-06-16 21:41:52 |
| Chapter8_Nov_29_05.ppt Path: UMass (Amherst) >> CS >> 453 Fall, 2009 Description: Chapter 8: Network Security Chapter goals: understand principles of network security: r security in practice: r firewalls r security in application, transport, network, link layers cryptography and its many uses beyond \"confidentiality\" r authe... Date Added: 2009-06-16 21:42:53 |
| 8.4.pdf Path: Millersville >> MATH >> 467 Fall, 2009 Description: ... Date Added: 2009-06-16 21:42:57 |
| TabathaGriffith_card.pdf Path: North Texas >> CECS >> 3220001 Spring, 2009 Description: Ha ea v wo e f l nd ru Da ! y ... Date Added: 2009-06-16 21:46:12 |
| Attitude.pdf Path: North Texas >> CECS >> 3220001 Spring, 2009 Description: ... Date Added: 2009-06-16 21:47:30 |
| org_xtra_reading.pdf Path: Ill. Chicago >> CHEM >> 114 Fall, 2008 Description: ... Date Added: 2009-06-16 21:52:46 |
| L10Relational&LogicalOps.ppt Path: UMBC >> CMSC >> 104 Fall, 2006 Description: Relational and Logical Operators Topics Relational Operators and Expressions The if Statement The if-else Statement Nesting of if-else Statements Logical Operators and Expressions Truth Tables Reading Sections 2.6, 4.10, 4.11 Relational Op... Date Added: 2009-06-16 21:54:50 |
| intro.ppt Path: SUNY Stony Brook >> CS >> 373 Fall, 2009 Description: CSE/MAT 373 Giordano Fusco (substituting for Prof. Himanshu Gupta) Logistics Web Page: http:/www.cs.sunysb.edu/~hgupta/373 Textbook: Prof. Steve Skiena\'s manuscript; Will be distributed in class for $20 or so. Grading: 50% assignments, 20% m... Date Added: 2009-06-16 21:55:06 |
| IDS.pdf Path: San Diego State >> ES >> 0405 Fall, 2009 Description: Information and Decision Systems OFFICE: Student Services 2411 TELEPHONE: (619) 594-5316 FAX: (619) 594-3675 In the College of Business Administration A Member of AACSB International-The Association to Advance Collegiate Schools of Business. State... Date Added: 2009-06-16 21:57:19 |
| ART.pdf Path: San Diego State >> ES >> 0607 Fall, 2009 Description: OFFICE: Art 505 TELEPHONE: 619-594-6511 FAX: 619-594-1217 E-MAIL: artinfo@mail.sdsu.edu http:/www.sdsu.edu/art Art In the College of Professional Studies and Fine Arts school offers a Master of Arts degree (30 units) in all of these emphases and a M... Date Added: 2009-06-16 21:57:55 |
| PSFA.pdf Path: San Diego State >> ES >> 0304 Fall, 2009 Description: Professional Studies and Fine Arts OFFICE: Professional Studies and Fine Arts 212 TELEPHONE: (619) 594-5124 FAX: (619) 594-4987 Faculty Faculty assigned to teach Professional Studies and Fine Arts courses are drawn from the Schools of Art, Design and... Date Added: 2009-06-16 21:58:30 |
| Lecture_19_Douglass_J.pdf Path: Rutgers >> CHEM >> 308 Fall, 2009 Description: ... Date Added: 2009-06-16 22:01:16 |
| adv380j.pdf Path: Texas >> ADV >> 391 Fall, 2009 Description: ADV 380J Spring 1996 Leckenby INTRODUCTION TO RESEARCH METHODS IN ADVERTISING Required Texts: Earl Babbie, The Practice of Social Research , Seventh edition, 1995. Reading Packet for ADV 380J at Longhorn Copies Office Hours: 12:00-1:00 p.m., Wed... Date Added: 2009-06-16 22:01:57 |
| readme.txt Path: Columbia >> JK >> 2079 Fall, 2009 Description: For the correct permission, use the following command. chmod 705 fn.ft ... Date Added: 2009-06-16 22:03:21 |
| Matlab Lab Notes 2 symbolic.doc Path: Benjamin Franklin Institute of Technology >> MY >> 1202 Fall, 2009 Description: Aerospace Practicum Introduction to MATLAB Lecture #2 Based on Chapter 15 of Engineering Fundamentals: An Introduction to Engineering By: Saeed Moaveni 2005 Nelson Students provided with a copy of Chapter 15 0: Finish any sections not completed from... Date Added: 2009-06-16 22:03:38 |
| Feb_6th.docx Path: SUNY Stony Brook >> AMS >> 31209 Fall, 2009 Description: February 6th Sampling from the normal population Theorem. Let be a random sample from a normal population . Then, we have the following: 1. 2. 3. and are independent. (Simple) Random Sample Each subject in the population has the same chance to b... Date Added: 2009-06-16 22:05:05 |
| sol2.pdf Path: SUNY Stony Brook >> AMS >> 301 Summer, 2008 Description: AMS 301.3 Fall, 2008 Homework Set # 2 - Solution Notes # 4, Supplement II: A graph with n vertices can have at most n = n(n-1) vertices; this would be the case 2 2 of a complete graph, Kn , in which all n vertices have degree (n - 1). Thus, if we h... Date Added: 2009-06-16 22:05:12 |
| problem1.pdf Path: SUNY Stony Brook >> AMS >> 102 Summer, 2008 Description: ITS 102-S14 Spring 2009 Estie Arkin Fun with Graphs Problem # 1 I invited three married couples to my home for dinner. Upon arrival, my 6 guests and I shake hands with some of the others. No person shakes hands with his/her spouse. Suppose I know ... Date Added: 2009-06-16 22:05:31 |
| slac-pub-2355.pdf Path: Stanford >> PUBS >> 2250 Fall, 2009 Description: SLAC-PUB-2355 July 1979 (T/E) COMMENT ON CABIBBO-SUPPRESSED NONLEPTONIC L. F. Abbott, Stanford P. Sikivie D DECAYS* and Mark B. Wise 94305 Stanford Linear Accelerator Center University, Stanford, California We discuss used to explain decays does n... Date Added: 2009-06-16 22:07:43 |
| Fall 2008 Car Roll Lab Instructions.pdf Path: Berkeley >> ME >> 107 Fall, 2009 Description: Fall 2008 Car-Roll Lab An Exercise in Building a Numerical Model Instructor: Bryan Boyce Email: bryan.boyce@berkeley.edu, Office Hours: Friday 1 pm -3 pm Overall Objectives The Car-Roll Lab is intended to further the understanding of Professor Dibble... Date Added: 2009-06-16 22:07:57 |
| Exercise3.pdf Path: Illinois Tech >> MATH >> 662 Fall, 2009 Description: PROBLEMS FOR MATH 662, WEEK 3 (SUMMER 2003) 1. Prove that the following two graphs are not isomorphic. Then compute the characteristic polynomial for each graph. What conclusion can you draw? 2. Suppose that the eigenvalues of a simple graph G are ... Date Added: 2009-06-16 22:09:05 |
| Solution 5.pdf Path: S.F. State >> FIN >> 535 Fall, 2008 Description: Page 128-129 Questions: 3. Who are the market participants in the foreign exchange market? Answer: The market participants that comprise the FX market can be categorized into five groups: international banks, bank customers, non-bank dealers, FX brok... Date Added: 2009-06-16 22:14:07 |
| slac-pub-1987.pdf Path: Stanford >> PUBS >> 1750 Fall, 2009 Description: SLAC-PUB-1987 LBL-6720 July 1977 WE) RADIATIVE DECAYS OF THE $(3684) INTO HIGH MASS STATES* W. Tanenbaum, M. S. Alam, A. M. Boyarski, M. Breidenbach G. J. Feldman, G. Hanson, J. A. Jai%, R. R. Larsen, D. Luke*, V. Ltith, H. L. Lynch*, J. M. Paterson... Date Added: 2009-06-16 22:16:17 |
| Hw01.txt Path: N.C. State >> CSC >> 651 Fall, 2009 Description: <!DOCTYPE html PUBLIC \"-/W3C/DTD XHTML 1.0 Transitional/EN\" \"http:/www.w3.org/TR/xhtml1/DTD/xhtml1-transitional.dtd\"> <html xmlns=\"http:/www.w3.org/1999/xhtml\" lang=\"en-US\" xml:lang=\"en-US\"> <head> <title>Login Required</title> <link rev=\"made\" hr... Date Added: 2009-06-16 22:18:41 |
| outline12.pdf Path: N.C. State >> SOC >> 306 Fall, 2008 Description: Criminology De Coster I. II. Recap Social Control Theory A. Gender? B. Age? Gottfredson and Hirschi\'s Low Self-Control Theory A. Crime vs. criminality B. Low self-control 1. What is it? 2. Where does ... Date Added: 2009-06-16 22:19:05 |
| lab_6.doc Path: N.C. State >> TT >> 601 Fall, 2008 Description: TT331 Monday June 8th 2009 PERFORMANCE EVALUATION OF TEXTILE MATERIALS Laboratory #6 Strength of Woven Fabrics and Seams Student Learning Outcomes: 1. In this assignment you will gain first hand experience of measuring the tensile breaking force a... Date Added: 2009-06-16 22:20:45 |
| prscfoil.pdf Path: N.C. State >> CSC >> 234 Fall, 2008 Description: Options Topic Student Choice Homework DIVOVFL STRING CONVERT REVERSE SPACEWAR FLOAT - interrupt handler - string instructions - test a program - recursive code - write to video buffer - work with floating point SC Assignment 1 SC Assignment ... Date Added: 2009-06-16 22:21:12 |
| Chapter 18- Thermodynamics.ppt Path: N. Arizona >> CHM >> 152 Fall, 2008 Description: Entropy 2) an analytical chemist turns into a procedure; 3) a physical chemist turns i... Date Added: 2009-06-16 22:21:46 |
| answers-act20.pdf Path: Kentucky >> MA >> 109 Fall, 2008 Description: ... Date Added: 2009-06-16 22:22:54 |
| Developmental Spelling Sp 04.ppt Path: Valdosta >> ECED >> 4300 Fall, 2008 Description: Developmental Spelling: Stages and Teaching Strategies Tonja L. Root, Ed.D. Reading Education Valdosta State University Valdosta, Georgia 31698 1 Precommunicative Spelling: \"Role Play Writing\" C... Date Added: 2009-06-16 22:24:35 |
| csc341l09.ppt Path: Cal Poly >> CSC >> 341 Fall, 2009 Description: CSC-341 Lecture 9 End Conditions MATLAB Spline Toolbox Bezier Curves B-Splines 1 Today\'s Topics End conditions for splines. The MATLAB spline and curve fitting toolboxes. Video tutorials from MathWorks. Bezier curves. 2 Natural Splines, Condit... Date Added: 2009-06-16 22:25:00 |
| HW4_solu_S06.pdf Path: Iowa State >> EE >> 422 Fall, 2009 Description: Solution for HW # 4 for Course EE422 (S\'06) Q1) (modified 12.4-2) A TV signal bandlimited to 4.5 MHz is to be transmitted by binary PCM. The receiver output signal-to-quantization-noise (SNR) is required to be 40 dB. (Hint: Use (12.64). Bpcm = 2nB, ... Date Added: 2009-06-16 22:25:08 |
| sp09_lab1.docx Path: Missouri S&T >> EE >> 265 Fall, 2009 Description: Laboratory #1 Due no later than January 30, 2009 Write a Matlab script that will generate a sine wave of amplitude 500 mV, at 1 kHz, and a phase of 45 degrees. Make the signal 1 second long. Do all of the following: 1. Plot the sine wave over a 1 sec... Date Added: 2009-06-16 22:25:17 |
| Feb28_08.pdf Path: Georgia Tech >> CEE >> 3770 Fall, 2008 Description: 1 2 3 4 5 6 ... Date Added: 2009-06-16 22:29:05 |
| homework_answer_key_2.pdf Path: Washington >> CHEM >> 457 Fall, 2008 Description: ... Date Added: 2009-06-16 22:30:37 |
| notes_21.pdf Path: Columbia >> GMG >> 4000 Fall, 2009 Description: ... Date Added: 2009-06-16 22:32:19 |
| bmx00z.txt Path: University of Illinois, Urbana Champaign >> ATMOS >> 20090326 Fall, 2009 Description: UPPER AIR CALCULATIONS AND PLOTTING (Ver 5.49-LINUX-X11) Current filename: /mnt/noaaport/nwstg/convert/09032612_upa.wxp Date: 1200Z 26 MAR 09 Searching for KEET. Searching the city database file for: KEET . Date:1200Z 26 MAR 09 Station: KEET W... Date Added: 2009-06-16 22:34:50 |
| sequences.2.txt Path: Virginia Tech >> CS >> 1044 Fall, 2000 Description: PREDICTED: similar to double homeobox Homo sapiens (Human) MALPTPSDGTLPAEARGLGRSRRLVWTPSQSEALQACFERNPYPDIATRVPLAQAIGILEPRVQIWFQNGRSRQLRQHRWESRPWPWRRGPQEGRRKRTAVTGSQTTVLL hypothetical protein LOC401152 Homo sapiens (Human) MEVDAPGVDGRDGLRERRGFSEGGRQNF... Date Added: 2009-06-16 22:35:18 |
| topic06.ps Path: SMU - Cox School of Business >> ENGR >> 8361 Fall, 2009 Description: %!PS-Adobe-2.0 %Creator: dvips(k) 5.78 Copyright 1998 Radical Eye Software (www.radicaleye.com) %Title: topic06.dvi %Pages: 4 %PageOrder: Ascend %Orientation: Landscape %BoundingBox: 0 0 612 792 %EndComments %DVIPSCommandLine: dvips topic06 %DVIPSPar... Date Added: 2009-06-16 22:35:42 |
| conc03.rtf Path: Allan Hancock College >> ITEC >> 200 Fall, 2009 Description: PostgraduateProfessionalDevelopmentPrograms DivisionofInformationandCommunicationSciences ITEC200FOUNDATIONSOFSOFTWAREENGINEERING ITEC200WEEK03CONCEPTUALQUESTIONS Thisworksheetiscomprisedofsomequestionsthatstudentsdoaspreliminaryworkandthen somegrou... Date Added: 2009-06-16 22:36:50 |
| Test1Asolpage1.pdf Path: ECCD >> MATH >> 1007 Fall, 2009 Description: ... Date Added: 2009-06-16 22:37:25 |
| prset6.pdf Path: ECCD >> STAT >> 2605 Fall, 2009 Description: ... Date Added: 2009-06-16 22:37:33 |
| ch052.pdf Path: Valdosta >> CS >> 1301 Fall, 2008 Description: Chapter 5 Methods Sections Pages Review Questions 5.15.11 142166 118 Method Example 1. This is of a main() method using a another method, f. Programming Exercises 222 (evens), 30 public class FirstMethod { public static void main... Date Added: 2009-06-16 22:39:31 |
| HW5.doc Path: Midwestern State University >> HW >> 344 Fall, 2009 Description: Homework Problems for Multi-Period Planning Problem 1. Solve the Shoeco example without back order option (in my lecture note) by both LINDO and Excel. For LINDO solution make sure that you define each decision variable clearly. Total Cost: $ 68, 075... Date Added: 2009-06-16 22:40:52 |
| week_4.pdf Path: University of Illinois, Urbana Champaign >> PHYS >> 100 Fall, 2008 Description: Physics 100 Week 4 1) Two cannon balls, each with mass 20 kg, are fired from ground level over a flat plateau. Ball A is fired with an initial speed of 250 m/s at an angle of 30 degrees from the horizontal, and Ball B is fired from the same spot with... Date Added: 2009-06-16 22:49:54 |
| Quiz I - 1998.doc Path: Wyoming >> GEOL >> 2020 Fall, 2008 Description: Name_ Geol 2020 Introduction to Petrology Quiz I I. 15 pts. The following questions refer to a melt with composition X in the phase diagram for the system Di-An, which is given below: 1. Show the path followed by the melt composition as crystallizati... Date Added: 2009-06-16 22:50:31 |
| sol2.pdf Path: Old Dominion >> CS >> 471 Fall, 2008 Description: CS471: Operating System Concepts Fall 2005 (Lecture: W 8:00-10:40 AM) Homework #2 Points: 20 Due: September 21, 2005 Solution 6.1 To prove property (a) we note that each pi enters the critical section only if the flag[j] = false. Since only pi can up... Date Added: 2009-06-16 22:52:19 |
| autoppslides.pdf Path: Auburn >> FINC >> 4210 Spring, 2008 Description: Overview FINC 4210 Property Insurance Business Auto Insurance Not in text L. Lee Colquitt Department of Finance Covered Autos Liability Physical Damage Conditions Additional Coverages and Endorsements Covered Autos business auto form provi... Date Added: 2009-06-16 22:52:52 |
| unit8.pdf Path: Rollins >> PHY >> 121 Fall, 2009 Description: PHY121 General Physics II _ Spring 2003 Monday, March 31 - Thursday, April 3 Reading Assignments: M. Mar. 31 Text 29.1 - 29.3 Problems 1, 3 The wave-particle duality; thermal radiation and Planck\'s postulate; introduction to the photoelectric effect.... Date Added: 2009-06-16 22:54:44 |
| caroline.doc Path: S.F. State >> IR >> 720 Fall, 2009 Description: Caroline Emery Professor Pentony, IR 725 March 15, 2005 First Article: Jack Levy. 1986. \"Organizational Routines and the Causes of War.\" International Studies Quarterly, Vol. 30, No. 2 (June), pp. 193-222. Levy\'s Central Ideas: Rigid military plans m... Date Added: 2009-06-16 22:55:09 |
| pwa3.doc Path: E. Michigan >> IS >> 215 Fall, 2008 Description: Assignment No. 3 Solution Prepared by Justin McDade Problem No.1 The following four guiding principles will be used in writing the content on my business webpage: Lines and Linework Using Bullets Using Multiple, Specific Headlines Color Lines and... Date Added: 2009-06-16 22:57:03 |
| slac-pub-9769.pdf Path: Stanford >> PUBS >> 9750 Fall, 2009 Description: SLAC-PUB-9769 Revised - April 2008 Observation of the dynamic beta effect at the Cornell Electron-Positron Storage Ring with the CLEO detector D. Cinabro Wayne State University, Detroit, Michigan 48202 M. Chadha, S. Chan, C. O\'Grady, J. S. Miller, ... Date Added: 2009-06-16 22:59:25 |
| Lecture22.4up.pdf Path: Wisconsin >> CS >> 538 Fall, 2008 Description: SML is Interactive You enter a definition or expression, and SML returns a result with an inferred type. The command use \"file name\"; Basic SML Predefined Types Unit loads a set of ML definitions from a file. For example (SML responses are in blu... Date Added: 2009-06-16 22:59:51 |
| 0413da22.ps Path: UVA >> CS >> 655 Fall, 2008 Description: %!PS-Adobe-3.0 %Title: Microsoft PowerPoint - 0413da22 %Creator: PSCRIPT.DRV Version 4.0 %CreationDate: 04/13/99 09:21:50 %BoundingBox: 16 9 597 784 %Pages: (atend) %PageOrder: Special %Requirements: %DocumentNeededFonts: (atend) %DocumentSuppliedFon... Date Added: 2009-06-16 23:01:49 |
| BioEng 498 lecture 3.ppt Path: University of Illinois, Urbana Champaign >> BIOE >> 498 Fall, 2008 Description: Mechanics of Materials line defects Micro scale Planar defects: grains & boundaries Macro scale Geometry Bulk material properties Mechanical, ... Date Added: 2009-06-16 23:04:00 |
| finalPresentationOLD.ppt Path: Berkeley >> IS >> 213 Spring, 1999 Description: Is213 Final Presentation Leticia Valdez Cecilia Jiang John Fritch Diane Ghorbani School of Information Management & Systems Presentation Agenda Intro Heuristic Evaluation Compare to 1st Interactive Prototype Formal Usability Study Pilot Stud... Date Added: 2009-06-16 23:07:14 |
| lab5.pdf Path: Michigan State University >> STT >> 421 Fall, 2008 Description: Lab 5: Java applets for understanding regression STT 421: Summer, 2004 Vince Melfi There are some nice java applets related to understanding regression and correlation available on the web. Today we\'ll use two of these to improve our intuition about ... Date Added: 2009-06-16 23:08:35 |
| week3.pdf Path: Michigan State University >> STT >> 421 Fall, 2008 Description: Week 3 Reading and Exercises STT 421: Summer, 2004 Vince Melfi Here are reading assignments and exercises we\'ll be covering during the week of May 30th. The assignments are listed on the days we\'ll be covering the material in class. Unless I explicit... Date Added: 2009-06-16 23:08:36 |
| agenda03.ps Path: Michigan State University >> ACC >> 470 Fall, 2009 Description: %!PS-Adobe-2.0 %Creator: dvips(k) 5.86 Copyright 1999 Radical Eye Software %Title: agenda03.dvi %Pages: 1 %PageOrder: Ascend %BoundingBox: 0 0 612 792 %EndComments %DVIPSWebPage: (www.radicaleye.com) %DVIPSCommandLine: dvips agenda03.dvi %DVIPSParame... Date Added: 2009-06-16 23:08:47 |
| Final2008.pdf Path: UMass (Amherst) >> CHEM >> 490 Fall, 2009 Description: 5/19/08 Final Exam Chem 490 Spring 2008 Name Look for reference information (equations, pathways, structures, etc) following the 25 exam questions. There are a mix of multiple choice problems (worth 2-3 points each) and longer problems (point v... Date Added: 2009-06-16 23:09:36 |
| assign5_plan.doc Path: Texas A&M >> INST >> 6037 Fall, 2009 Description: Emmanuel N. Okafor INST 6037 Dr. Bump Unit3 Sec 1: Graphic Animation 6/8/2009 Title of Lesson: Creating a stay in school animation using Macromedia Flash Author(s): Emmanuel N. Okafor Mentor Teacher: Subject Area(s):Graphic Communication . TEKS Scho... Date Added: 2009-06-16 23:12:26 |
| Fall 2008 Exam 1 A.doc Path: Texas Tech >> BA >> 5301 Fall, 2009 Description: ACCT 5301 Fall 2008 Exam #1, Form A 1 DIRECTIONS: Place your name, Form Letter, and Row Number in the Upper Right of your paper. Number your paper from 1 to 15 down the left column. MULTIPLE CHOICE (1 point each). 1. The sufficiency of earnings may b... Date Added: 2009-06-16 23:15:00 |
| hw10_soln.pdf Path: Pittsburgh >> MATH >> 0280 Fall, 2008 Description: \'*ft{t 02@ [s+5\'.rwq,g tO D,. lrtdal \' c AOC, .\\ \\ Zrc-\\ @t-t.,*iq^, N=1 ,/,u t. \\/ t lLl V {tt t, ilL o0 00 /L vt I/.a\" L: {/n ,o ,. 1t \'l 0k{ lt \'/ tiy Y\" | 9{, \'{\" i* t... Date Added: 2009-06-16 23:21:04 |
| 2861_001.pdf Path: Purdue >> MA >> 266 Summer, 2001 Description: ... Date Added: 2009-06-16 23:21:07 |
| cv.pdf Path: Cornell >> CK >> 275 Fall, 2009 Description: Chulmin Kim Cornell University Department of Statistical Science Email: ck275@cornell.edu http:/www.people.cornell.edu/pages/ck275 210 Lake St. #9A Ithaca, NY 14850 USA (617) 459 8882 Education 2007/05 2006/05 2005/08 Cornell University, Department ... Date Added: 2009-06-16 23:23:42 |
| ls.pdf Path: UCSB >> CS >> 130 Fall, 2009 Description: CS 230 \' Local.Search-0 $ CS 230 \' Local.Search-1 $ UCSB TG % CS 230 \' Local.Search-2 $ CS 230 \' Local.Search-3 $ UCSB TG % CS 230 \' Local.Search-4 $ CS 230 \' Local.Search-5 $ UCSB ... Date Added: 2009-06-16 23:23:51 |
| stein.pdf.pdf Path: UCSB >> CS >> 230 Fall, 2009 Description: CS 230A \' Steiner.Tree-0 $ CS 230A \' Steiner.Tree-1 $ UCSB TG % CS 230A \' Steiner.Tree-2 $ CS 230A \' Steiner.Tree-3 $ UCSB TG % ... Date Added: 2009-06-16 23:23:58 |
| 100208_Lecture11.1.pdf Path: Arizona >> GEO >> 218 Fall, 2009 Description: Geos 218: Geological Disasters & Society Oct. 2, 2008: Volcanism Abbott Ch. 8 Magma properties, eruption styles, and types of volcanoes The 3 Vs of volcanism: viscosity, volatiles, and volume 1 Explosiveness of Eruptions less viscous more viscou... Date Added: 2009-06-16 23:26:53 |
| cobit 4.0.pdf Path: UNC Charlotte >> MBAD >> 7090 Spring, 2008 Description: 4.0 Control Objectives Management Guidelines Maturity Models COBIT 4.0 The IT Governance Institute The IT Governance Institute (ITGI) (www.itgi.org) was established in 1998 to advance international thinking and standards in directing and controllin... Date Added: 2009-06-16 23:27:06 |
| Lab8.pdf Path: Eastern Oregon >> CS >> 161 Fall, 2009 Description: CS 161 Lab Activity: Lists Enter these statements in Python Interactive and observe what happens. Try to make sense of what you see based on the material covered in class. It\'s important to pay attention to the results of each example and to think ab... Date Added: 2009-06-16 23:30:50 |
| 20040909 Thursday ugis 147b lecture.doc Path: Berkeley >> UGISC >> 147 Fall, 2009 Description: 1 of 3 4907646ea9c1f50b1f06bc6cad45601a9a75766d.doc 20040909 Thursday ugis 147b lecture fenella cannel biyuti inside/outside connection authentic how are you are? Interiority how\'s your biyuti? Is not exteriority biyuti suggests there is not space we... Date Added: 2009-06-16 23:32:34 |
| 325-ch01-hw.pdf Path: Mt. Holyoke >> HOME >> 325 Fall, 2009 Description: Ch 1: 2,5,7,(bonus 8),11,13,15,18,28,33 (BONUS: 22) ... Date Added: 2009-06-16 23:32:46 |
| ch04[1].ppt Path: Warner Pacific >> PHS >> 301 Fall, 2009 Description: Chapter 4 Alkanes: Nomenclature, Conformational Analysis, and an Introduction to Synthesis Shapes of Alkanes \"Straight-chain\" alkanes have a zig-zag orientation when they are in their most straight orientation 5 Straight chain alkanes are also cal... Date Added: 2009-06-16 23:36:15 |
| BLEEDER1x.pdf Path: Wisconsin >> HVREVIEW >> 091603 Fall, 2009 Description: R14 R15, R16, R17 = 100 = 100 = PMT mounting pad No components to be mounted within 1mm of pad OD Total (R1.R13) = 70 MOhm (+/-5%) See Table S2.1 for value ratios. C1, C2, C3 C4, C5, C6 C7, C8, C9 C10, C11 = 10nF = 4.7nF = 3.3nF = 2.2nF TBR R14 ... Date Added: 2009-06-16 23:42:00 |
| SATTINGER.pdf Path: Concordia Chicago >> ECON >> 350 Fall, 2009 Description: 3/30/2001Sattinger, (Oxford Economic Papers) March, 2001 1 To eliminate indeterminacy, we can introduce a continuum. (but keep rank ordering). Assume we have one worker to one rm assignment setup: Homogenous output of rms: F (`, c) 2 assume F` ... Date Added: 2009-06-16 23:42:15 |
| Untitled-12.pdf Path: Georgia Tech >> GTG >> 396 Fall, 2009 Description: 010100001010 000000111101 1 0100101011100 11 001101011001100 01 1000001101001010100 001 00011010100000011111 1101 100010111010101010010 001100 1001100101101011110010 1101010 011011010110101101011011 0000011101 010 000101010101000111001011 11010101010... Date Added: 2009-06-16 23:43:07 |
| HW12.pdf Path: Loyola Maryland >> MA >> 251 Fall, 2009 Description: Math 251: Problem Set 12 Due: November 25, 2008 Section 5.4: 1, 3, 7, 11, 25, 29, 35, 51 Section 5.5: 1, 5, 9, 11, 13, 19, 25, 39, 53 Discovery Project: pg 379 1 ... Date Added: 2009-06-16 23:43:16 |
| Pledged1.pdf Path: Loyola Maryland >> MA >> 251 Fall, 2009 Description: Math 251: Pledged Set 1 Due: September 9, 2008 This is a pledged set. Therefore, no outside help from book, calculator, or other people. 1. What is a function? What are its domain and range? 2. What is an odd function? How can you tell if a function ... Date Added: 2009-06-16 23:43:19 |
| Day 10, Great Depression and a New Deal Slide List.doc Path: Delaware >> ARTH >> 231 Fall, 2008 Description: 1 Day 10 Department of Art History, University of Delaware Thurs., Mar. 8, Gibson, Spring 2007 ARTH 231, AMERICAN ART II: FROM THE GILDED AGE TO THE PRESENT The Great Depression and a New Deal for the Arts Terms to know (for \"The New Deal\"): America... Date Added: 2009-06-16 23:44:32 |
| Proofs-3E.pdf Path: Adelphi >> M >> 301 Fall, 2009 Description: Introduction to Proofs Section 3.5 Preview The Division Algorithm (Due: Monday, 9 March.) Read section 3.5 (pages 128 - 137) and write solutions to preview activity 2. The division algorithm looks simple, but looks can be deceiving. As a conditional... Date Added: 2009-06-16 23:45:32 |
| questions5_10.pdf Path: Stanford >> POLISCI >> 181 Fall, 2009 Description: PS 181C Discussion Questions May 10, 2002 Due in my email inbox by 8:00am on Tuesday May 14 1) Compare Aldrich\' argument for why activists are extreme to Fiorina\' Which s s. do you find more persuasive? 2) Evaluate Fiorina\' argument about the \"Dark ... Date Added: 2009-06-16 23:48:04 |
| ch13hashing.ppt Path: Vassar >> CS >> 102 Fall, 2008 Description: Chapter 13 (excerpts) Advanced Implementation of Tables CS102 Sections 51 and 52 Marc Smith and Jim Ten Eyck Spring 2008 2006 Pearson Addison-Wesley. All rights reserved 13 B-1 AVL Trees An AVL tree A balanced binary search tree Can be searched... Date Added: 2009-06-16 23:50:21 |
| UCRrape.pdf Path: Minnesota >> D >> 3925 Fall, 2009 Description: FORCIBLE RAPE DEFINITION Forcible rape, as defined in the Uniform Crime Reporting Program, is the carnal knowledge of a female forcibly and against her will. Assaults or attempts to commit rape by force or threat of force are also included; however,... Date Added: 2009-06-16 23:51:25 |
| 06012204.pdf Path: Wisconsin >> SH >> 060122 Fall, 2009 Description: ... Date Added: 2009-06-16 23:52:13 |
| week 10.pdf Path: Allan Hancock College >> CHEM >> 1108 Fall, 2009 Description: CHEM1108 Problem Sheet 8 (Week 10) Work through the ChemCAL module \"Organic Acids and Bases\". 1. Consider the compounds F, G, H, I, J and K. C (F) CH CH3OCH2CH2OCH2Br (G) O CH3 CH3 CH3 CH3 CH3 C OCH2OCH3 CH3 (H) H C H (K) C CH2OH O CH3OCH2 (I) C OC... Date Added: 2009-06-16 23:52:45 |
| week 11.pdf Path: Allan Hancock College >> CHEM >> 1405 Fall, 2009 Description: CHEM1405 Problem Sheet 9 (Week 11) Work through the ChemCAL module \"Organic Acids and Bases\" 1. Alcohols, thiols and phenols are all organic acids. Complete the following table by giving the structures of the conjugate bases of the acids, and by ins... Date Added: 2009-06-16 23:52:51 |
| week5.pdf Path: WVU >> EE >> 480 Fall, 2008 Description: WEST VIRGINIA UNIVERSITY COLLEGE OF ENGINEERING AND MINERAL RESOURCES Lane Department of Computer Science and Electrical Engineering DESIGN PROJECT TEAM WEEKLY REPORT TEAM NO/TITLE 13 Member Damian Christey Hours 10 DATES: Feb 5 - 11 Cum. Hours 40 ... Date Added: 2009-06-16 23:54:55 |
| Homework 1 - Solution.xls Path: CSU Fullerton >> ISDS >> 361 Fall, 2009 Description: Qeusiton 8.16 Given z Answer P(Z<1.50) 0.9332 1.50 Qeusiton 8.18 Given z Answer P(Z<1.50) 0.0559 -1.59 Qeusiton 8.21 Given za zb P(Z<zb) P(Z<zA) Answer P(-1.40<Z<0.6) -1.40 0.60 0.73 0.08 0.6450 Question 8.22 Given z P(Z<z) Answer P(Z>-1.44) 0.... Date Added: 2009-06-16 23:56:46 |
| Fall 07Chapter 2.ppt Path: YCP >> BUS >> 495 Fall, 2009 Description: Evaluating a Firms External Environment Chapter 2 Objectives Understand the import role that the competitive environment plays on firms Gain an understanding of Porters Five Forces and how the tool is applied as part of an industry analysis. Hav... Date Added: 2009-06-16 23:58:15 |
| rare.doc Path: Mt. Marty >> PH >> 1745 Fall, 2009 Description: Sampling Methods for Rare Events Basic Ideas: When we survey rare events, the conventional methods of sampling and estimation may be unsatisfactory. Even a large sample may not provide enough rare events. In such cases we may consider using the foll... Date Added: 2009-06-16 23:58:25 |
| telephone.doc Path: Mt. Marty >> PH >> 1745 Fall, 2009 Description: Sampling in Telephone Surveys (Chapter 15) Basic ideas: Telephone surveys are used as alternatives to costly personal interviews. There are other advantages of telephone surveys: They can be completed more quickly; the process of interviewing can b... Date Added: 2009-06-16 23:58:26 |
| ch 10.ppt Path: Drexel >> TAX >> 341 Fall, 2009 Description: Chapter 10 Deductions and Losses: Certain Itemized Deductions Eugene Willis, William H. Hoffman, Jr., David M. Maloney and William A. Raabe Copyright 2004 South-Western/Thomson Learning Itemized Deductions (slide 1 of 2) Personal expenditures that... Date Added: 2009-06-16 23:59:45 |
| hw10soln.pdf Path: LSU >> PHYS >> 1201 Fall, 2008 Description: ... Date Added: 2009-06-17 00:01:32 |
| L6_Decision-making.ppt Path: Allan Hancock College >> BUSN >> 8030 Fall, 2009 Description: Chapter 6 Decision Making: The Essence of a Manager\'s Job Robbins, Bergman, Stagg, Coulter: Management 4e 2006 Pearson Education Australia Decision making q Decision: definition r Making a choice from two or more alternatives. q The decision-... Date Added: 2009-06-17 00:03:10 |
| absoluteness.pdf Path: North Texas >> MATH >> 6010 Fall, 2008 Description: L EMMA 1. Let T be a tree on Z for some set Z and let be an inaccessible cardinal. There is a tree T on and map e : T T preserving the tree order such that for all P V , V P |= p[T ] = p[T ]. Proof. Pick biger than with V modeling a reas... Date Added: 2009-06-17 00:03:14 |
| 1.ppt Path: UF >> CGS >> 3460 Fall, 2008 Description: CGS 3460 Course Web Site Get CISE Account Student Breakdown Scheduling Registrar\'s Webpage 34 Scheduled Periods 65 Minute Periods 65 * 34 = 2210 Minutes of Class 75 Minute Periods 2210 / 75 = 29.467 Classes Cancel 4 Classes and go 75 min... Date Added: 2009-06-17 00:05:23 |
| Sward03.pdf Path: UCCS >> CS >> 534 Fall, 2009 Description: AdaSlicer: An Ada Program Slicer Ricky E. Sward Department of Computer Science U.S. Air Force Academy, CO 719-333-7664 A.T. Chamillard Computer Science Department University of Colorado at Colorado Springs Colorado Springs, CO 80933 719-262-3150 ri... Date Added: 2009-06-17 00:06:01 |
| Lesson3.pdf Path: UCCS >> CS >> 534 Fall, 2009 Description: CS 534 Software Maintenance Fall 2004 Lesson 3, 31 Aug 2004 Software Maintenance Processes Reading Chapters 4-5 Recap of Common Development Software Life Cycle Models Waterfall Once through, do each step once Requirements, Design, Coding, Integ... Date Added: 2009-06-17 00:06:02 |
| week5.pdf Path: WVU >> EE >> 180 Fall, 2009 Description: WEST VIRGINIA UNIVERSITY COLLEGE OF ENGINEERING AND MINERAL RESOURCES Lane Department of Computer Science and Electrical Engineering DESIGN PROJECT TEAM WEEKLY REPORT TEAM NO/TITLE 13 Member Damian Christey Hours 10 DATES: Feb 5 - 11 Cum. Hours 40 ... Date Added: 2009-06-17 00:06:15 |
| Lecture 7.ppt Path: Laurentian >> BIOL >> 200901 Fall, 2009 Description: Stream biology can be greatly impacted when watersheds are hydrologically disturbed by deforestation Scouringflashiness of the hydrograph scour and gravel shift. Siltation overland flow vs percolation fine particle transport to streams. plug up inte... Date Added: 2009-06-17 00:08:12 |
| lecture8sch.pdf Path: Duke >> X >> 110 Fall, 2009 Description: Outline for today Objective for today: Continue discussion of the scheduling policies for choosing which process to run when. Processor Scheduling We\'ve talked about how: mechanisms to support process abstraction (context switch, timer interrupts, q... Date Added: 2009-06-17 00:10:19 |
| 01-ven3xds07d.xls Path: UC Davis >> ATT >> 0707 Fall, 2009 Description: Sheet (1) Cust ID 1036146 1037024 1041544 1034658 1037867 1043459 1026549 0940357 1021692 0969593 0941048 1044795 1038346 1039389 1038442 1022815 0810828 1034792 1041610 1033785 1042277 1038779 1025084 1041625 1021004 1043460 1045526 0973127 1034663 ... Date Added: 2009-06-17 00:10:49 |
| lec11.ps Path: Wisconsin >> ECE >> 902 Fall, 2009 Description: %!PS-Adobe-2.0 %Creator: dvips 5.58 Copyright 1986, 1994 Radical Eye Software %Title: lec11.dvi %CreationDate: Mon Apr 19 21:41:53 1999 %Pages: 10 %PageOrder: Ascend %Orientation: Landscape %BoundingBox: 0 0 612 792 %EndComments %DVIPSCommandLine: dv... Date Added: 2009-06-17 00:13:02 |
| lec22_2.ps Path: Wisconsin >> ECE >> 902 Fall, 2009 Description: %!PS-Adobe-2.0 %Creator: dvips 5.58 Copyright 1986, 1994 Radical Eye Software %Title: lec22.dvi %CreationDate: Tue Jun 8 05:55:44 1999 %Pages: 3 0 %PageOrder: Ascend %Orientation: Landscape %BoundingBox: 0 0 612 792 %EndComments %BeginProcSet: PStoPS... Date Added: 2009-06-17 00:13:13 |
| DE-IX104.pdf Path: Neumont >> INSTRU >> 004 Fall, 2009 Description: INDEX DU FONDS NO 104: CORRESPONDANCE - DESTINATAIRES ARCENAUX, J.-T. , 104.1 BEAUBIEN, JEAN, 104.3 BEAUREGARD, FERNAND, 104.3 BEDARD, ROMEO, 104.3 BERTIN, LUCIEN, 104.4 BOUDREAU-NELSON, LEONE, 104.4 BOULANGER, TREFFLE, 104.4 CHIASSON, ALICE, 104.4 C... Date Added: 2009-06-17 00:14:05 |
| DE-IX104.pdf Path: Neumont >> INSTRU >> 104 Fall, 2009 Description: INDEX DU FONDS NO 104: CORRESPONDANCE - DESTINATAIRES ARCENAUX, J.-T. , 104.1 BEAUBIEN, JEAN, 104.3 BEAUREGARD, FERNAND, 104.3 BEDARD, ROMEO, 104.3 BERTIN, LUCIEN, 104.4 BOUDREAU-NELSON, LEONE, 104.4 BOULANGER, TREFFLE, 104.4 CHIASSON, ALICE, 104.4 C... Date Added: 2009-06-17 00:14:05 |
| ma-inx77.pdf Path: Neumont >> INSTRU >> 003 Fall, 2009 Description: INDEX DU FONDS NO 77: MANUSCRITS A.C.J.C. DE L\'ARCHIDIOCSE DE MONCTON - ACTIVITS - 1938, 77.198 ACADIENS DE LA NOUVELLE-COSSE - CORRESPONDANCE 1949, 77.244 ACADIENS DE LA NOUVELLE-COSSE - ENQUTE, 77.244 ACADIENS DE LA NOUVELLE-COSSE - STATISTIQUES, 7... Date Added: 2009-06-17 00:16:17 |
| 20 manthegeologicagent.pdf Path: University of Hawaii - Hilo >> GG >> 101 Fall, 2009 Description: Earth Systems Human Impacts Synthesized by R.B. Husar, Washington University Earth in the Cosmos Incoming and Outgoing Radiation in the Earths Atmosphere Fig. 23.6 Core Mantle Lithosphere Atmoshere System Major Reservoirs and Fluxes of the Ear... Date Added: 2009-06-17 00:18:08 |
| Class_Man.mch.prf.pdf Path: East Los Angeles College >> CIA >> 1325 Fall, 2009 Description: Y HbtyyI G c s E f `sw w}sEz}sd hf Q D w G w GT G i g v x w p Q vT w d |G{WgI0exHDF p I TT Q f DT r DI TT Q f d ~ r D TT f d sp)WIi hgI0ee&T c D TT Q f d G }`... Date Added: 2009-06-17 00:19:34 |
| 1308_homework_3_20.pdf Path: Trinity U >> MATH >> 1308 Spring, 2009 Description: MATH 1308 Calculus B Spring 2009 Homework Due Date: Mar. 20th Problem 1. Find the eigenvalues and eigenvectors of the matrices below. If the eigenvalues are not real numbers, you do not need to find the eigenvectors. 4 0 a) A = 1 3 b) A = c) A = ... Date Added: 2009-06-17 00:19:47 |
| PPG6_Proj03_Diamond.pdf Path: Washington University in St. Louis >> DOCS >> 158 Fall, 2009 Description: Form Approved Through 11/30/2010 Department of Health and Human Services Public Health Services LEAVE BLANK-FOR PHS USE ONLY. Type Activity Number Review Group Formerly Council/Board (Month, Year) OMB No. 0925-0001 Grant Application Do not exceed c... Date Added: 2009-06-17 00:22:55 |
| BA271-Fall04-PublicGradebook.xls Path: Oregon State >> BA >> 271 Fall, 2008 Description: Fluffy Spreadsheet Competition Producer Tutorial Video Project Prerequsite Exam (raw score) Last 4 digits of OSU ID Prerequsite Exam Basic Website Final Website WebsitePlan Adjustment Query Quiz Access #1 Access #2 Access #3 Access #4 4... Date Added: 2009-06-17 00:24:47 |
| shell-handout.ps Path: East Los Angeles College >> COMS >> 20805 Fall, 2009 Description: %!PS-Adobe-2.0 %Creator: dvips(k) 5.86 Copyright 1999 Radical Eye Software %Title: shell.dvi %Pages: 6 0 %PageOrder: Ascend %Orientation: Landscape %BoundingBox: 0 0 596 842 %DocumentFonts: Helvetica-Bold Helvetica Courier-Bold Symbol %+ Times-Roman ... Date Added: 2009-06-17 00:26:59 |
| YPL079W.t2k.w0.5-logo.pdf Path: UCSC >> YPL >> 079 Fall, 2009 Description: YPL079W.t2k w0.5 3 2 1 M V A F D L V L L E I L R R K SR K I I K G R S V XXXXXXXXXX XXXXXXXXXXXXXXXXXXXXXXXXX XXXXXXXXXXXX N K S T A T G T K G R K XX H K G L F Y L K S M K E I M F K H E S L P V T L S Y V R Y F E E V G S A T... Date Added: 2009-06-17 00:27:34 |
| After Cost Cuts-Wolfgang Bernhard.pdf Path: NYU >> B >> 012301 Fall, 2009 Description: Article View Page 1 of 3 Back to Article View Databases selected: Multiple databases. After Cost Cuts, Chrysler\'s Bernhard Turns to Selling Cars Sholnn Freeman. Wall Street Journal. (Eastern edition).New York, N.Y.: Nov 4, Author(s): Publication ... Date Added: 2009-06-17 00:29:10 |
| Web Design Tutorial Text.pdf Path: Ball State >> WEB >> 604 Fall, 2009 Description: Web Design Tutorial Text Sarah Smith-Robbins February 5, 2004 NOTE: This content was not created independently of the web site. It was created specifically for this project. The text was expanded as the site was built. Main In web design, Feng Shui p... Date Added: 2009-06-17 00:30:09 |
| test3_fall08_with_solutions_2.pdf Path: New Mexico >> MATH >> 120 Fall, 2008 Description: ... Date Added: 2009-06-17 00:30:41 |
| mse3.rtf Path: Texas State >> PHYS >> 1310 Fall, 2008 Description: vti_encoding:SR|utf8-nl vti_author:SR|wg06 vti_modifiedby:SR|wg06 vti_timecreated:TR|23 Jun 2006 22:41:07 -0000 vti_timelastmodified:TR|23 Jun 2006 22:41:07 -0000 vti_cacheddtm:TX|23 Jun 2006 22:40:24 -0000 vti_filesize:IR|115753 vti_extenderversion:... Date Added: 2009-06-17 00:31:23 |
| spec_pc.txt Path: Berkeley >> ASTRO >> 00282003 Fall, 2009 Description: # tmin tmax 3.29783 456.82381 [ksec] ;instrument XRT ;exposure 69241.378 ;xunit kev ;bintype counts 0.000000 0.010000 0.000000 0.000000 0.010000 0.020000 0.000000 0.000000 0.020000 0.030000 0.000000 0.000000 0.030000 0.040000 0.00000... Date Added: 2009-06-17 00:31:36 |
| Ramey_RBC.pdf Path: Berkeley >> ECON >> 161 Fall, 2008 Description: NBER WORKING PAPER SERIES IS THE TECHNOLOGY-DRIVEN REAL BUSINESS CYCLE HYPOTHESIS DEAD? SHOCKS AND AGGREGATE FLUCTUATIONS REVISITED Neville Francis Valerie A. Ramey Working Paper 8726 http:/www.nber.org/papers/w8726 NATIONAL BUREAU OF ECONOMIC RESEA... Date Added: 2009-06-17 00:33:17 |
| ma201_quiz3_solns.pdf Path: Bucknell >> NCR >> 006 Fall, 2009 Description: ... Date Added: 2009-06-17 00:33:35 |
| pset6.pdf Path: Caltech >> CNS >> 187 Fall, 2008 Description: CNS 187 - Neural Computation Problem Set 6 Handed out: Due: 7 Nov 2008 14 Nov 2008, 4pm Each subproblem is weighted equally, totally 100 points. You must not examine problem sets or solution sets from previous years of this class, or similar relat... Date Added: 2009-06-17 00:35:20 |
| birthday.pdf Path: ASU >> STP >> 421 Fall, 2008 Description: Birthday Problem n 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 P(0) 1.000 0.997 0.992 0.984 0.973 0.960 0.944 0.926 0.905 0.883 0.859 0.833 0.806 0.777 0.747 0.716 0.685... Date Added: 2009-06-17 00:37:12 |
| hw-4.ps Path: Oregon State >> CS >> 533 Fall, 2008 Description: %!PS-Adobe-2.0 %Creator: dvips(k) 5.95a Copyright 2005 Radical Eye Software %Title: hw-4.dvi %Pages: 2 %PageOrder: Ascend %BoundingBox: 0 0 595 842 %DocumentFonts: CMBX12 CMR10 CMMI10 CMMI8 CMEX10 CMSY6 CMSY8 CMR8 %+ CMSY10 CMBX10 %DocumentPaperSizes... Date Added: 2009-06-17 00:38:05 |
| pricing.pdf Path: Clemson >> MYWEB >> 901 Fall, 2009 Description: Block Pricing and the Distribution of Demand M.T. Maloney Clemson University Introduction This is a paper about pricing strategies. Under most circumstances, a single price is not the revenue maximizing scheme for a seller facing a downward sloping d... Date Added: 2009-06-17 00:38:39 |
| xey.pdf Path: Clemson >> MYWEB >> 901 Fall, 2009 Description: 901 Notes Department of Economics Clemson University On the Function: xey This is an odd functional form. Figure 1 shows the function in three space. In one dimension, the function is linear; in the other, increasing at an increasing rate. Looked a... Date Added: 2009-06-17 00:38:40 |
| sol3.ps Path: East Los Angeles College >> DMA >> 0809 Fall, 2009 Description: %!PS-Adobe-2.0 %Creator: dvips(k) 5.96.1 Copyright 2007 Radical Eye Software %Title: sol3.dvi %CreationDate: Tue Oct 28 14:16:15 2008 %Pages: 2 %PageOrder: Ascend %BoundingBox: 0 0 595 842 %DocumentFonts: CMR12 CMBX12 CMMI12 CMEX10 CMMI8 CMMI6 CMSY10... Date Added: 2009-06-17 00:40:26 |
| mt95_1.pdf Path: University of Iowa >> EXAMS >> 53030 Fall, 2009 Description: ... Date Added: 2009-06-17 00:48:56 |
| Homework 4 Solutions.doc Path: Washington >> CSSS >> 508 Fall, 2009 Description: Homework 4 Solutions CS&SS 508 Winter 2009 Assigned: Feb 21, 2009 Due: Mar. 6, 2009 Lecture 7 1) Load the incomedata from the homework page of the class website. Use the tapply() function to compute the mean income for each of the three different ag... Date Added: 2009-06-17 00:49:33 |
| PSY202_Exam4_IndividualAnswers.xls Path: Washington >> PSY >> 222 Fall, 2009 Description: tmpExportScr Last4 0038 0053 0060 0062 0076 0097 0175 0201 0217 0243 0300 0397 0450 0472 0484 0494 0536 0539 0569 0612 0655 0658 0668 0683 0689 0709 0743 0744 0745 0763 0791 0807 0811 0849 0946 0957 1001 1022 1023 1104 1142 1153 1178 1208 1210 1223 1... Date Added: 2009-06-17 00:50:21 |
| 6.1_Intro2NetworkServers.ppt Path: ECPI >> CIS >> 151 Fall, 2009 Description: Creating and Using Servers Servers for LANs and WANs Modified for ECPI Department of Computer Information Sciences mtaylor v2007-4 Objectives Types of Servers Explain how to use a server in a home or office network Install a server Set up a ser... Date Added: 2009-06-17 00:56:14 |
| Quiz #6.doc Path: ECPI >> CIS >> 204 Fall, 2009 Description: <?xml version=\"1.0\" encoding=\"UTF-8\"?> <Error><Code>NoSuchKey</Code><Message>The specified key does not exist.</Message><Key>499f744d31e74e8b207a264ff090f323182479e2.doc</Key><RequestId>1 28F3B37D7A25940</RequestId><HostId>YnEOrU3TvfGMoz49Jjo703gHPWL... Date Added: 2009-06-17 00:56:34 |
| S07L7_George1.pdf Path: UCSB >> ECON >> 120 Fall, 2008 Description: Ten Largest Cities -1880 New York Philadelphia Brooklyn Chicago Boston St. Louis Baltimore Cincinnati San Francisco New Orleans 1,206,299 847,170 566,663 503,185 362,839 350,518 332,313 255,139 233,959 216,090 +48% +50% +112% +349% +104% +117% +57% +... Date Added: 2009-06-17 00:58:02 |
| YCL030C.t2k.dssp-ehl2-logo.pdf Path: UCSC >> YCL >> 030 Fall, 2009 Description: YCL030C.t2k DSSP-EHL2 2 1 C C C C C E H E C C C C C C X X X X X X X X X X X X 10 20 30 40 E 2 1 H T E H T S H E T E E 2 1 C CCCCCCCE X X X X X X X X 51 60 70 80 90 S T S E T T H HH CCC X X X CXHHCHCCCCCCCHCCCCCCCCCHCCCCCX... Date Added: 2009-06-17 00:58:07 |
| EE3054_lec1.pdf Path: Cal Poly >> EE >> 3054 Fall, 2009 Description: Discrete-Time Signals and Systems 1 Preliminaries Notation for a discrete-time signal: x[n] If the discrete-time signal is obtained by taking samples of a continuoustime signal, then x[n] = x(nTs ). Ts is called the \"sampling period\", i.e., the amo... Date Added: 2009-06-17 00:59:38 |
| distpres.ppt Path: Georgia Tech >> CS >> 7210 Fall, 2008 Description: Determining Global States of Distributed Systems Presented by Sanjeev R. Kulkarni References 1. \"Distributed Snapshots: Determining Global States of Distributed Systems\", K. Mani Chandy and Leslie Lamport, ACM Transactions on Computer Systems, vol 3... Date Added: 2009-06-17 01:02:46 |
| study_guide_book.ps Path: Berkeley >> PSYCH >> 127 Fall, 2009 Description: #%-12345X@PJL JOB @ @PJL ENTER LANGUAGE = POSTSCRIPT %!PS-Adobe-3.0 %Title: Microsoft Word - study_guide_book.doc %Creator: PSCRIPT.DRV Version 4.0 %CreationDate: 10/29/01 12:49:16 %BoundingBox: 13 13 599 779 %Pages: (atend) %PageOrder: Special %Requ... Date Added: 2009-06-17 01:03:25 |
| HW1.pdf Path: Texas >> PHY >> 385 Fall, 2008 Description: Phy 385K Spring 2008 Read Chapters 1 & 2 of Jose and Saletan. Homework 1 due in class on February 5: Chapter 1 Problems 2, 7, 17, 27 Chapter 2 Problems 1, 3, 7, 9 and the Computer Problem: Create a surface of section plot for the standard map given o... Date Added: 2009-06-17 01:04:28 |
| Geostatistics - 2D.pdf Path: BYU >> CE >> 547 Fall, 2008 Description: GMS TUTORIALS Geostatistics 2D Two-dimensional geostatistics (interpolation) can be performed in GMS using the 2D Scatter Point module. The module is used to interpolate from sets of 2D scatter points to any of the other object types (meshes, grid... Date Added: 2009-06-17 01:09:22 |
| Haskell.pdf Path: Taylor IN >> CSE >> 382 Spring, 2009 Description: Taylor University Computer Science and Engineering Bill Toll Spring 2009 COS 382 Language Structures Haskell The Sieve of Eratosthenes ASSIGNED: May 4, 2009 DUE: May 13, 2009 SUBMISSION: Submit your Haskell program as a .hs file through moodle. NO... Date Added: 2009-06-17 01:09:55 |
| stat_model.pdf Path: Michigan State University >> CSE >> 484 Fall, 2008 Description: Introduction to Statistical Modeling Rong Jin 1 Why Statistical Modeling? Vector space model for information retrieval Both documents and queries are vectors in the term space Relevance is measured by the similarity between document vectors and que... Date Added: 2009-06-17 01:11:32 |
| SPAN.pdf Path: San Diego State >> GB >> 9900 Fall, 2009 Description: Spanish In the College of Arts and Letters Faculty Theodore V. Higgs, Ph.D., Professor of Spanish, Chair of Department Ernesto M. Barrera, Ph.D., Professor of Spanish C. Ben Christensen, Ph.D., Professor of Spanish Margarita G. Hidalgo, Ph.D., Profes... Date Added: 2009-06-17 01:12:50 |
| proj2.ps Path: UConn >> CSE >> 262 Fall, 2009 Description: %!PS-Adobe-2.0 %Creator: dvips(k) 5.86 Copyright 1999 Radical Eye Software %Pages: 1 %PageOrder: Ascend %BoundingBox: 0 0 596 842 %EndComments %DVIPSWebPage: (www.radicaleye.com) %DVIPSCommandLine: dvips -f %DVIPSParameters: dpi=600, compressed %DVIP... Date Added: 2009-06-17 01:14:30 |
| 2008_06_24JFC_GAB.pdf Path: UWI Mona >> SECTION >> 1310 Fall, 2009 Description: Legislative Fiscal Bureau One East Main, Suite 301 Madison, WI 53703 (608) 266-3847 Fax: (608) 267-6873 June 24, 2008 TO: Members Joint Committee on Finance Bob Lang, Director FROM: SUBJECT: Government Accountability Board: Section 13.10 Requ... Date Added: 2009-06-17 01:15:12 |
| 8.Mortality Transitions.doc Path: UNC >> SOCI >> 830 Fall, 2008 Description: 1Reading Note Guide Monday, September 22 Mortality Transitions Reading 1: Preston, Samuel H. And Etienne van de Walle. 1978. Urban French Mortality in the Nineteenth Century. Population Studies 32:275-297. What is the basic argument of this article... Date Added: 2009-06-17 01:15:49 |
| final.pdf Path: Washington >> CS >> 505 Fall, 2009 Description: Computer Science notes 110 minutes 10 points per question 90 points total Name: Please write any long answers on the back of the exam or on a separate piece of paper. 1. Suppose the following M... Date Added: 2009-06-17 01:21:29 |
| opt-mark.v2.pdf Path: Washington >> CS >> 401 Fall, 2009 Description: Compiler Passes Analysis of input program (front-end) character stream Lexical Analysis Synthesis of output program (back-end) Intermediate Code Generation intermediate form Optimization intermediate form Code Generation target language 2 Optimiz... Date Added: 2009-06-17 01:21:42 |
| NFA2Reg.pdf Path: Washington >> CS >> 322 Fall, 2009 Description: CSE 322 Introduction to Formal Models in Computer Science Regular expressions from Finite Automata The key idea for the construction that creates a regular expression from a finite automaton is to allow edge labels that are regular expressions. Sipse... Date Added: 2009-06-17 01:21:52 |
| 02analysis-4up.pdf Path: Washington >> CS >> 417 Winter, 2009 Description: CSE 417: Algorithms and Computational Complexity Define Efficiency \"Runs fast on typical real problem instances\" Pro: sensible, bottom-line-oriented 2: Analysis Winter 2007 Larry Ruzzo Con: moving target (diff computers, compilers, Moore\'s law) hi... Date Added: 2009-06-17 01:22:11 |
| SQLConsTrigs.ppt Path: Washington >> CS >> 444 Fall, 2009 Description: SQL: Constraints and Triggers Chapter 6 Ullman and Widom Certain properties we\'d like our database to hold Modification of the database may break these properties Build handlers into the database definition Keys: Fundamental Constraint In the C... Date Added: 2009-06-17 01:22:29 |
| p561.8.pptx Path: Washington >> CSEP >> 561 Fall, 2009 Description: P561:NetworkSystems Week8:Contentdistribution TomAnderson ClicktoeditMastersubtitlestyle RatulMahajan TA:ColinDixon 6/8/09 Today Scalablecontentdistribution Infrastructure Peertopeer Observationsonscalingtechniques 6/8/09 22 Thesimplestcase:... Date Added: 2009-06-17 01:24:18 |
| lecture07.ps Path: Washington >> LECTURE >> 444 Fall, 2009 Description: #%-12345X@PJL JOB @PJL JOB NAME = \"Microsoft PowerPoint - lecture07.htm\" @PJL SET ECONOMODE=OFF @PJL ENTER LANGUAGE = POSTSCRIPT %!PS-Adobe-3.0 %Title: Microsoft PowerPoint - lecture07.htm %Creator: Pscript.dll Version 5.0 %CreationDate: 10/9/2000 12... Date Added: 2009-06-17 01:24:39 |
| Geisbauer.pdf Path: ECCD >> BIOL >> 1003 Fall, 2009 Description: 660 Brightness discrimination and neutral point testing in the horse Gudrun Geisbauer, Ulrike Griebel, Axel Schmid, and Brian Timney Abstract: Equine brightness discrimination ability and color discrimination were measured using a two-choice discri... Date Added: 2009-06-17 01:24:59 |
| syl.pdf Path: Washington >> CS >> 531 Fall, 2009 Description: CSE 531 Automata, Computability, Complexity Course Organization Fall 1997 W. L. Ruzzo Handout 1 30 Sep 97 Larry Ruzzo 415 Sieg 543-6298 ruzzo@cs.washington.edu Oce Hours: TBA Instructor TA Ed Hong edhong@cs.washington.edu Oce Hours: W 11:30{12:... Date Added: 2009-06-17 01:26:31 |
| hw3-sol.ps Path: Washington >> CS >> 531 Fall, 2009 Description: %!PS-Adobe-2.0 (TeXPS: dvi->PostScript Driver dvitps, Version 3.11 of September 5, 1990\ )print flush %Creator: quinault:ruzzo (Larry Ruzzo,415 Seig,206-543-6298) %DocumentPaperSizes: Letter %Title: Dvi to PostScript converter, Version 3.11 of Septem... Date Added: 2009-06-17 01:26:37 |
| project2.pdf Path: Washington >> CS >> 401 Fall, 2009 Description: Project 2: The MiniJava Parser Due: Wednesday, May 3, 12:30 pm, by turn-in. In this assignment you will extend the initial MiniJava parser and AST representation with the extensions described in the course project description handout. You should ext... Date Added: 2009-06-17 01:27:50 |
| CSE596.02.9.pdf Path: Washington >> CSEP >> 524 Fall, 2009 Description: Interprocessor Communication There are two main differences between sequential computers and parallel computers - multiple processors and the hardware to connect them together. That hardware is the most important part of the design. 1 Basics of Net... Date Added: 2009-06-17 01:28:33 |
| 305n081005.pdf Path: Alabama >> ME >> 305 Fall, 2008 Description: ... Date Added: 2009-06-17 01:30:34 |
| 09_handout.pdf Path: Allan Hancock College >> CS >> 4317 Fall, 2009 Description: Outline XML and Databases Lecture 9 Properties of XPath 1. XPath Equivalence 2. No Looking Back: How to Remove Backward Axes 3. Containment Test for XPath Expressions Sebastian Maneth NICTA and UNSW CSE@UNSW - Semester 1, 2009 Useful Functions... Date Added: 2009-06-17 01:30:44 |
| Gregg Coord Chem rev 2004.pdf Path: Allan Hancock College >> VSJ >> 110 Fall, 2009 Description: Coordination Chemistry Reviews 248 (2004) 12151224 Review Interfacial processes in the dye-sensitized solar cell Brian A. Gregg National Renewable Energy Laboratory, 1617 Cole Boulevard, Golden, CO 80401, USA Received 25 August 2003; accepted 9 Feb... Date Added: 2009-06-17 01:32:46 |
| YDR524W-C.t2k.str2-logo.pdf Path: UCSC >> YDR >> 524 Fall, 2009 Description: YDR524W-C.t2k STR2 2 1 CC 1 C SC X XXXXXXXX C H C C C H H H H H C H H X X H XXXXXS X H H T H H H T H C H CC HHY HZZHA Z AMCZ A Y Y Z M C AAC X X X C C H H H XXXXXXXX 10 H H 20 MK RSY KTLPTYFF SFFGPFKERAVFLL V L A C X ... Date Added: 2009-06-17 01:33:15 |
| YDR505C.t2k.w0.5-logo.pdf Path: UCSC >> YDR >> 505 Fall, 2009 Description: YDR505C.t2k w0.5 5 4 3 2 1 LD M F E I V XX I P L A S D S T X X XXXXXXX L I V A X X K N S T T V S L N G L L L YK Y V XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX N F L V I D EFR V Y L E I V E N V K F D F L D V E K K I R N N G D G P I K L E ... Date Added: 2009-06-17 01:36:21 |
| ME537-Exam2_09SOLN.doc Path: BYU >> ME >> 537 Fall, 2009 Description: ME 537 - Exam 2 March 12, 2009 (Open book, limited to 1 hr. 50 min.) Name_Solution_ (2 5) 1. Given the listed parameters and entry state vo and ao, will a pure S-curve profile be used to reach the set speed vs? Show the work used to draw your conclus... Date Added: 2009-06-17 01:36:48 |
| homework7.pdf Path: Wisconsin >> CS >> 726 Fall, 2008 Description: CS726, Fall 2006 Homework 7 (due Monday 10/30/06) 1. Exercise 5.9 from the text. 2. Exercise 5.10 from the text. 3. Exerecise 5.11 from the text. 4. Exercise 6.2 from the text. 5. Exercise 6.3 from the text. 1 ... Date Added: 2009-06-17 01:37:10 |
| hw6.pdf Path: UCSD >> ECE >> 161 Fall, 2008 Description: Homework Set Five ECE 161C Department of Electrical and Computer Engineering University of California, San Diego Nuno Vasconcelos Spring 2009 Due May 28, 2009 1. Suppose x(n1 , n2 ) is a periodic sequence of period N1 N2 . ~ a) show that the seq... Date Added: 2009-06-17 01:38:15 |
| Millionaire.ppt Path: U. Houston >> CUIN >> 3111 Fall, 2008 Description: 50:50 15 14 13 12 11 10 9 8 7 6 5 4 3 2 1 $1 Million $500,000 $250,000 $125,000 $64,000 $32,000 $16,000 $8,000 $4,000 $2,000 $1,000 $500 $300 $200 $100 Welcome to Who Wants to be a Millionaire Math Style Mark E. Damon - All Rights Reserved Anothe... Date Added: 2009-06-17 01:41:10 |
| self.doc Path: Penn State >> MXY >> 159 Fall, 2009 Description: 1. Qu significan las siguientes palabras: Salles Brouiller-brouilleurs Sonneries Dej Despuis Sous-sol Passer-passait FNCF Cacher-cache Interdit Retentir-retentit Veiller-veill? 2. Mira el texto, cul crees que es el tema? Por qu? 3. En parejas, uno v... Date Added: 2009-06-17 01:42:37 |
| slac-pub-1687.pdf Path: Stanford >> PUBS >> 1500 Fall, 2009 Description: I SLAC-Pm-1687 December 1975 (T) QUANTUM DYNAMICSOF A QUARK-BINDING BUBBLE IN TWO-SPACEONE-TIME DIMENSIONS* R. C. Giles and S. - H. H. Tye Stanford Linear Accelerator Center Stanford University, Stanford, California 94305 ABSTRACT We discover tha... Date Added: 2009-06-17 01:44:06 |
| lab3-s08.pdf Path: Arizona >> PHYS >> 586 Fall, 2008 Description: Phys 586 Laboratory Lab 3 Goal: In this lab you will do initial work with several inorganic scintillators. Reading: Knoll 307-327 Lab: 1. There are three inorganic scintillators: NaI(Tl), Lu2 SiO5 (Ce), and BaF2 . Using the 137 Cs source, make a sket... Date Added: 2009-06-17 01:45:24 |
| lecture26[3].ppt Path: Georgia Tech >> CS >> 1321 Fall, 2008 Description: CS 1321 CS1321: Introduction to Programming Georgia Institute of Technology College of Computing Lecture 26 April 11, 2002 The Big Picture Modeling traffic Collections, e.g. a Queue Enqueue, Dequeue, IsEmpty? Independent of what goes on the que... Date Added: 2009-06-17 01:45:32 |
| notes_lecture_notes_wk2.pdf Path: Washington >> CHEM >> 152 Fall, 2008 Description: ... Date Added: 2009-06-17 01:46:02 |
| notes_lecture_notes_wk2_10_05.pdf Path: Washington >> CHEM >> 152 Fall, 2008 Description: ... Date Added: 2009-06-17 01:46:02 |
| YIL177C.t2k.str2-logo.pdf Path: UCSC >> YIL >> 177 Fall, 2009 Description: T ZAA ZHA ZA ZC CC A CC HZ HYHHHZAZHAHHCYZ Z S C CZ YYYYTZHHCAZ Z H C M Z AA Y S Z Z A E Q S C AYYHATC HZHSZCSCYM ACTEY THZHGECSHCZCCCAASEASZSSH T Y Y Q ZCSZZHZZATS C A Q A E S C H S C C E Y S S C H T E Z P P Z M H P C A T Y T Y X X XXM X X XXXXXXXXX... Date Added: 2009-06-17 01:46:23 |
| YIL101C.t2k.str2-logo.pdf Path: UCSC >> YIL >> 101 Fall, 2009 Description: YIL101C.t2k STR2 3 2 1 CC B Z XXXX T Y H H CCXXC S X Z Z Z CCYCS S Y S T XXXXXXXXXXXXCHXX C G G S CTTCZCZCSSC SS YZC T C CC C Y Q Y A T A A Q S S S T G G Z C H T H X C T T H X T H H X X XXXXX H C Z QCCCYZC Y H Z H C M M M S Z M H M H ... Date Added: 2009-06-17 01:47:01 |
| YIL101C.t2k.stride-ebghtl-logo.pdf Path: UCSC >> YIL >> 101 Fall, 2009 Description: YIL101C.t2k EBGHTL 3 2 1 CC 1 CTHT T CCEEETCEETTTC TTTTTCTTEECTCCCETXTCCHX H T C C C C T X X X X X X E E E E 10 20 30 40 E 3 2 1 C T E T H E T T E X 51 60 70 80 90 H 3 2 1 E T E T H T H HHHHHHHHHHH 101 110 T CTTHT ECCCT... Date Added: 2009-06-17 01:47:01 |
| YIL134C-A.t2k.w0.5-logo.pdf Path: UCSC >> YIL >> 134 Fall, 2009 Description: YIL134C-A.t2k w0.5 2 1 M L VVA V L L I I I 10 20 30 40 E 2 1 I L V H E H XXXXXXXXXXXXXXXXX Y I I I I V V V V S S S A LL F LL RN V L L I T A V C A PY F L 51 T 60 IA LLS LFSSRNTV CAPY E 50 1 XXXXXXXXXXXXXX X XX X MV VGS EFNNTADV ... Date Added: 2009-06-17 01:47:15 |
| handout7-AR model.pdf Path: Minnesota >> DANG >> 0088 Fall, 2009 Description: Apec 8212-Sp\'05 Handout 7 Recitation 04/22/05 TA: Hai-Anh Dang The second-order autoregressive process Consider an AR (2) model yt= c+ a1 yt-1+a2 yt-2+t (1) Assume the model is covariance-stationary, then the mean of (1) can be obtained by taking t... Date Added: 2009-06-17 01:48:29 |
| Bus 315 - Cover Page.pdf Path: Sveriges lantbruksuniversitet >> BUS >> 315 Fall, 2009 Description: Simon Fraser University Faculty of Business Administration Bus 315 Investments Instructor: Jorge Cruz Lopez Assignment # _ by Student 1 Name (Last, First):_ Student 1 Student Number:_ Student 2 Name (Last, First):_ Student 2 Student Number:_ ... Date Added: 2009-06-17 01:49:04 |
| Storyboard.doc Path: N. Arizona >> ETC >> 667 Fall, 2008 Description: Title/Home Page Main Menu page that will take the student to each section of the lesson. This is a sample of an instructional page from the theme development section of the yearbook workshop: This is an interactional page from the theme section of... Date Added: 2009-06-17 01:50:38 |
| old Memo 2 Note.doc Path: UF >> EIN >> 3101 Fall, 2009 Description: Memorandum To: From: Date: Re: EIN 3101 C students S. Lawphongpanich and K. Stanfill January 5, 2006 Memo # 2 Memo # 2 should contain the following: 1) The class activities on January 18/19, 23, and 30. a) For the lecture by Professor D. W. Hearn on... Date Added: 2009-06-17 01:50:46 |
| cong2.pdf Path: N. Illinois >> SEC >> 420 Fall, 2009 Description: Even More Amazing Powers of COMPUTATION explained A number is divisible by 3 (or 9 or 2) if and only if it is congruent to 0 modulo 3 (or 9 or 2). When we write a number, we write in base 10: 3875 = 3 103 + 8 102 + 7 101 + 5 100 . Therefore,... Date Added: 2009-06-17 01:51:30 |
| cyclic.pdf Path: N. Illinois >> SEC >> 420 Fall, 2009 Description: Cyclic Subgroups The simplest way to get subgroups of a group is to take an element of the group and all its \"powers.\" an = a a n times a -n =a -1 a-1 = (an )-1 n times a0 = e The collection of all the powers of a is denoted a . It... Date Added: 2009-06-17 01:51:33 |
| pc_evlist.txt Path: Berkeley >> ASTRO >> 00324744 Fall, 2009 Description: output00324744000_999/sw00324744000xpcw3po_cl.evt output00324744001_999/sw00324744001xpcw3po_cl.evt ... Date Added: 2009-06-17 01:52:45 |
| Quiz11key.pdf Path: Utah >> MATH >> 1210 Fall, 2008 Description: ... Date Added: 2009-06-17 01:53:43 |
| jmhomework4.pdf Path: Pittsburgh >> MATH >> 0220 Fall, 2008 Description: \' %iP#$hTh2i%#1%V#9!fP!(0Tf%m%#\"!(!TiiD 9 H $\"9 | \" k $ HD\" 1 6 5 A\" 5 R 5 A\" $ $9D R D D R #iTivlfxe w \' 9 r #$hjl~TelQ%ir!V#92i}2r26 s iq 9 H $\" 9 \" H u 6 5 R 9 5 11 \" D 11 6 u1 6 \' i9 9 H $\" $ | \" k $ HD \" 1 6 5 A \" 5 R 5 A \"... Date Added: 2009-06-17 01:53:55 |
| Activation Records.ppt Path: Texas >> EE >> 312 Fall, 2008 Description: vti_encoding:SR|utf8-nl vti_timelastmodified:TR|13 Feb 2004 19:32:57 -0000 vti_extenderversion:SR|5.0.2.6417 vti_author:SR|ENS504-BFQRK11\\chase vti_modifiedby:SR|ROO\\chase vti_timecreated:TR|29 Jan 2003 17:22:11 -0000 vti_title:SR|PowerPoint Presenta... Date Added: 2009-06-17 01:54:30 |
| ch18 Path: Keller Graduate School of Management >> ACCT >> ACC557 Spring, 2009 Description: ... Date Added: 2009-06-18 14:55:24 |
| 27137.txt Path: UNC >> DOCS >> 27137 Fall, 2009 Description: Project Gutenberg\'s The Scholfield Wool-Carding Machines, by Grace L. Rogers This eBook is for the use of anyone anywhere at no cost and with almost no restrictions whatsoever. You may copy it, give it away or re-use it under the terms of the Proje... Date Added: 2009-06-18 19:35:00 |
| IET3322_FCAR_SP09.doc Path: SPSU >> IET >> 3322 Fall, 2009 Description: Southern Polytechnic State University Department of Industrial Engineering Technology Faculty Course Assessment Report Spring 2009 Course Code : IET3322 Course Title : Work Measurement and Ergonomics Instructor : Robert Atkins Catalog Description: An... Date Added: 2009-06-18 19:36:13 |
| s_w_2002.pdf Path: East Los Angeles College >> EC >> 112 Fall, 2009 Description: Contributions to Political Economy (2002) 21, 111134 ECONOMIC DEVELOPMENT IN THE SHADOW OF THE CONSENSUS: A STRATEGIC DECISION-MAKING APPROACH ROGER SUGDEN AND JAMES R. WILSON* L\'institute (Institute for Industrial Development Policy), Birmingham Bu... Date Added: 2009-06-18 19:36:22 |
| T0486.t06.w0.5-logo.pdf Path: UCSC >> T >> 0486 Fall, 2009 Description: T0486.t06 w0.5 4 3 2 1 M HH H H H H S S G VD L G TE N L YF Q S MG A GR R E S E P RP T S AR Q L DG I R NI V L SN P K K R NT L S L A M L K S L Q SD I L H D A D SN D L K V I I IS A E G P V F SS G H D L K E LT 10 20 30 40 50 60 70 80 90 1 H 4 3 2 1 ZYZ... Date Added: 2009-06-18 19:37:38 |
| userprog.ps Path: Virginia Tech >> CS >> 3204 Fall, 2000 Description: %!PS-Adobe-2.0 %Creator: dvips 5.55 Copyright 1986, 1994 Radical Eye Software %Title: userprog.dvi %Pages: 2 %PageOrder: Ascend %BoundingBox: 0 0 612 792 %EndComments %DVIPSCommandLine: dvips -o userprog.ps userprog.dvi %DVIPSParameters: dpi=300, com... Date Added: 2009-06-18 19:38:19 |
| fig17.03.ps Path: Pittsburgh >> CS >> 2710 Spring, 2008 Description: ... Date Added: 2009-06-18 19:39:22 |
| quiz4_sol.pdf Path: Wisconsin Milwaukee >> PHYS >> 105 Fall, 2009 Description: H# A9 T g $ $ f $ $ $ 2VvX\'f\"\'vXX\'Q\'QXV\'9dt D g g Q $ 4XQ (\"X0\'A%XX`\'A%es U@X\"\'#d(VXVw4%(e( # X%dXVvR 2 H# $ BD A $ 9 $ # Q AD9D... Date Added: 2009-06-18 19:40:03 |
| 060918dbs_dystonia.pdf Path: George Mason >> ECE >> 590 Fall, 2008 Description: Neurosurg Focus 17 (1):E1, 2004, Click here to return to Table of Contents Deep brain stimulation for hyperkinetic disorders ERWIN B. MONTGOMERY JR., M.D. Department of Neurology, National Primate Research Center, University of WisconsinMadison, Wis... Date Added: 2009-06-18 19:41:41 |
| high16.txt Path: Idaho >> ME >> 451 Fall, 2008 Description: 0.000 0.075 0.002 0.066 0.005 0.030 0.007 0.029 0.010 0.022 0.012 0.021 0.015 0.056 0.018 0.096 0.020 0.079 0.022 0.084 0.025 0.053 0.027 0.055 0.030 0.066 0.032 0.047 0.035 0.032 0.037 0.010 0.040 0.049 0.043 0.067 0.045 0.059 0.047 -0.031 0.050 -0.... Date Added: 2009-06-18 19:42:08 |
| work 6n.rtf Path: East Los Angeles College >> BALL >> 0888 Fall, 2009 Description: WORK FOR WEEK 6 Question 1: Consider the following structure: Domain: {1,2,3} a: 1 b: 3 P: {2} R: {<1,2>,<2,3>,<1,3>} Using the formal (Tarski) rules for the semantics of Lovely, determine the truth values, in this structure, of the following sentenc... Date Added: 2009-06-18 19:43:15 |
| YOR061W.t2k.dssp-ehl2-logo.pdf Path: UCSC >> YOR >> 061 Fall, 2009 Description: YOR061W.t2k DSSP-EHL2 2 1 CC 1 C X X X X X X X H X X 10 20 30 40 E 2 1 S E T T E EEE X X CCCC 51 60 70 80 90 H 2 1 T CCCCEE X E H H X X X X X H H H H H X X CCCCCCCCCC E EEEEEEE 110 X X X CCCCECCCCCCECC CE C H H E X E X X ... Date Added: 2009-06-18 19:43:50 |
| ong_writing.pdf Path: Gonzaga >> COML >> 509 Fall, 2009 Description: ... Date Added: 2009-06-18 19:45:32 |
| 02B-CharacterOfDesign.ppt Path: Washington >> INFO >> 360 Fall, 2009 Description: Character of Design INFO 360 A Spring 2009 Agenda Announcements What is design? Elements of interaction design Principles of interaction design Usability (criteria) Assignment #1 What\'s next? Announcements Your questions, comments & announc... Date Added: 2009-06-18 19:47:14 |
| Week7-Processes-1up.pdf Path: Toledo >> CSC >> 209 Fall, 2009 Description: Compilers, Interpreters, Libraries Comparing compilers and interpreters Shared vs. non-shared libraries. Layers of System Software cat less vi date gcc nedit grep ddd csh (or bash or ksh) libc C Interface to Unix system services Unix system servic... Date Added: 2009-06-18 19:47:26 |
| EBUS major.ppt Path: TCU >> BJONES >> 20263 Fall, 2009 Description: BIS Major @ Neeley Integrated*Real*Connected*Personal Dr. Beata M. Jones b.jones@tcu.edu Assoc. Prof. of Professional Practice in Business Information Systems http:/activewin.4jobs.com/JS/CareerResources/Cartoon/ReferralForm.asp Career Examples o... Date Added: 2009-06-18 19:50:32 |
| 16990.pdf Path: Doane >> MAJORS >> 26241 Fall, 2009 Description: CLASSICS What can I do with this degree? AREAS EDUCATION Teaching Research Administration EMPLOYERS Universities and colleges Elementary and secondary schools, public and private STRATEGIES Ph.D. required for college/university teaching. Earn gradu... Date Added: 2009-06-18 19:51:00 |
| s1_2closure.pdf Path: Fayetteville State University >> MAD >> 3105 Fall, 2009 Description: 2. CLOSURE OF RELATIONS 21 2. Closure of Relations 2.1. Definition of the Closure of Relations. Definition 2.1.1. Given a relation R on a set A and a property P of relations, the closure of R with respect to property P , denoted ClP (R), is smalles... Date Added: 2009-06-18 19:52:50 |
| Chapter 12.doc Path: CUNY Baruch >> PHYSICS >> 207 Fall, 2009 Description: Chapter 12 P12.1 Take torques about P. m1 g l l p = -n 0 + d m1 g + d m b gd - m 2 gx = 0 + + 2 2 l 2 CG x nO l nP mb g d P m2 m2 g We want to find x for which x= n0 = 0 . l ( m1 + m b ) d + m 1 2 m1 O m2 l ( m1 g + m b g ) d + m 1 g... Date Added: 2009-06-18 19:53:16 |
| BST1.doc Path: Michigan >> LATIN >> 231 Fall, 2008 Description: LAT 231 BASIC SKILLS TEST 1 DIRECT IONS : Using the dictionary entries provided, give part of speech and form identification, all possibilities , and translation for each word below. DO NOT TRANSLATE NOUNS; TRANSLATE SUBJUNCTIVES AS INDICATIVES ( 1... Date Added: 2009-06-18 19:54:04 |
| CmpE226-essays-reqs.doc Path: San Jose State >> CMPE >> 226 Fall, 2008 Description: CmpE 226: Database Systems & Design Essays\' Requirements Team-Oriented! 1. An essay value is five points. 2. Select a 10 database notions or concepts as EBTs and BOs for your essay and email them to me and I will assign two or three concepts to you.... Date Added: 2009-06-18 19:54:41 |
| acidbasesaltskey.pdf Path: Michigan State University >> CEM >> 262 Summer, 2008 Description: ... Date Added: 2009-06-18 19:55:00 |
| Day3.txt Path: Mich Tech >> CS >> 1131 Fall, 2008 Description: I. Goals today: Ensure Everyone has an Account and has used the lab Very basic introduction to: Facilities: Lab Software: Eclipse and the submit program Language: Simple Java program and the Animator (The submit program... Date Added: 2009-06-18 19:57:14 |
| YDR210W-A.t2k.str2-logo.pdf Path: UCSC >> YDR >> 210 Fall, 2009 Description: YDR210W-A.t2k STR2 3 2 1 CC T CC CCC C C T T T CGGG C GHHH SSSTSSSZZZZSGGGSZS YA C HGH SSSHGSST H S S S SHHCCCCT T STTTSTTZSYYYZTCSYSC T H S X XXSXXXXXTXXXXXZXXXXXXSHZZXXSXXCSCHBX X X X X X X X X X T X T G C S C CCC Z C C C T T CC Y S S ... Date Added: 2009-06-18 19:57:46 |
| Disorders of Attention.ppt Path: Virgin Islands >> PSYC >> 315 Fall, 2009 Description: Disorders of Attention Psychology 315 February 7, 2008 Disruption of cerebral circulation resulting in neurologic deficits of acute onset. Stroke Attention deficits are influenced by site of lesion Diagrams: Ropper, A. & Brown, R. (2005). Adam... Date Added: 2009-06-18 19:58:57 |
| gradesheet1.xls Path: U. Houston >> CUIN >> 3111 Fall, 2008 Description: English Language Arts Spring 2003 Student Name Brian Moro Emmett Turman Alice Panchoo Cheille Eligon Mary Hart Nygel Wallace Jack Sim Ethan Allen Susan Hicks Star Francis 800 700 600 500 400 300 200 100 0 1 2 3 4 5 6 7 8 Star Francis Susan Hicks Etha... Date Added: 2009-06-18 19:59:19 |
| homework2.pdf Path: Missouri S&T >> CLASS >> 481 Fall, 2009 Description: Physics 481: Solid State Physics - Homework 2 due date: Tuesday Feb 5, 2008 Problem 1: Reciprocal lattice in three dimensions (10 points) Consider a Bravais lattice with primitive vectors a1 , a2 , a3 . The primitive vectors b1 , b2 , b3 of the rec... Date Added: 2009-06-18 19:59:26 |
| notesWk4.pdf Path: Washington >> BOT >> 113 Fall, 2009 Description: Week 4; Monday Announcements: First lecture exam on Friday (covers material through last Friday and Arboretum field trip) Review session Wed at 5:30 in 132 HCK Handout: Cladograms of green plants and angiosperms Lecture: Caryophyllidae, aka Caryophyl... Date Added: 2009-06-18 20:02:59 |
| lec3.xls Path: NYU >> PAGES >> 3176 Fall, 2009 Description: 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 A B C D Bond Yield Calculations (Citicorp 7-1/8, settles 6/16/95, matures 3/15/04) quote = 101.26 n= 18 coupon rate = 7.13 coupon freq = 2 coupo... Date Added: 2009-06-18 20:04:20 |
| YBL005W-B.t2k.stride-ebghtl-logo.pdf Path: UCSC >> YBL >> 005 Fall, 2009 Description: 3 2 1 CCC CHHHHHHHHHH C TTT TXEXTX T E H E X X C X X X X X X X X X T X TH HTCGTHHHHHHHHHHTTTC THG CCT X X X X X T C T E C C E E E C E E E H G H H C C X X X X X X X X XXXXXXXXXX 301 310 320 330 340 H 3 2 1 T H T H HH 351 C H C C C ... Date Added: 2009-06-18 20:04:46 |
| YBL029C-A.t2k.CB_burial_14_7-logo.pdf Path: UCSC >> YBL >> 029 Fall, 2009 Description: YBL029C-A.t2k CB_BURIAL_14_7 3 2 1 AA A 10 20 30 40 F A E A D A D A D A D D A D A D B D B D A D E A F 3 2 1 F X X X X E F A X X A A C CC C C C CCDCCBCCCC CCC D XXDDXXXXXXCXXDDXDDDCDXDDXXDDXDDXDDXDCC A C B E AAA BB B X X B A B ... Date Added: 2009-06-18 20:05:06 |
| DNS100 syllabus F2005.doc Path: UMES >> DNSC >> 100 Fall, 2009 Description: 1 University of Maryland Eastern Shore Fall, 2005 First Experience Seminar Year Course: First Year Experience Seminar Instructors: DNSC 100 Carver Hall, Room3118 jsingleton@mail.umes.edu Carver Hall, Room agpotter@mail.umes.edu Carver Hall, Room 2... Date Added: 2009-06-18 20:06:27 |
| Background.pdf Path: UWO >> CS >> 2210 Fall, 2009 Description: h 7aI`Fg3#pfpucfCEfs7UsA8eb`I d gxCs#t\'48\'EDs8SPEHGGE\'BB@8642 0( ! ! ! 1... Date Added: 2009-06-18 20:06:33 |
| Mergesort2.ps Path: UWO >> CS >> 2210 Fall, 2009 Description: %!PS-Adobe-3.0 %Pages: (atend) %BoundingBox: 0 0 612 792 %HiResBoundingBox: 0.000000 0.000000 612.000000 792.000000 %. %Creator: Aladdin Ghostscript 550 (pswrite) %CreationDate: 2001/11/26 15:55:21 %DocumentData: Clean7Bit %LanguageLevel: 2 %EndComme... Date Added: 2009-06-18 20:06:38 |
| Assignment14b.txt Path: University of Hawaii - Hilo >> ICS >> 312 Fall, 2009 Description: TITLE HOMEWORK 14B: DISK AND FILE OPERATIONS ; This program will read the first sector of a 3.5 inch ; floppy disk file directory. .MODEL SMALL .STACK 100H .DATA BUFFER DB 512 DUP(0) ERRORMSG DB \'ERROR$\' .CODE MAIN PROC ; Initialize D... Date Added: 2009-06-18 20:07:29 |
| hwk2.solutions.pdf Path: Johns Hopkins >> MATH >> 212 Fall, 2009 Description: ... Date Added: 2009-06-18 20:08:02 |
| multicasting.pdf Path: VCU >> CMSC >> 602 Fall, 2008 Description: Logical Clock, Group Communication and Multicasting CMSC 602 Advanced Operating Systems More on Vector Group Communication Matrix Clock Reading 3.4.2 to 3.4.4, 4.1.5, 9.2, 12.3.3 Ju Wang, 2003 Fall Virginia Commonwealth University More on Vect... Date Added: 2009-06-18 20:09:25 |
| prob06.pdf Path: Rutgers >> PHYSICS >> 382 Fall, 2008 Description: ... Date Added: 2009-06-18 20:12:36 |
| rose_red_ramp.txt Path: JMU >> MAP >> 430 Fall, 2009 Description: Rose Red Ramp 0 0.0 (1.0, 0.6, 0.6, 1.0) 1.0 (0.4, 0.0, 0.0, 1.0) ... Date Added: 2009-06-18 20:12:51 |
| M115_HM39.doc Path: Humboldt State University >> MATH >> 115 Fall, 2008 Description: Math 115 Homework # 39 Scale the graph to fit the given Sinusoidal equation. Name_ 1 Include clearly labeled bold line axes for the input and output variables. Give four evenly spaced calibration values per axis. 2 A.) h( t ) = -2 + 8 cos 16 ( t... Date Added: 2009-06-18 20:16:41 |
| Lecture30.ps Path: Wisconsin >> CS >> 538 Fall, 2008 Description: <?xml version=\"1.0\" encoding=\"UTF-8\"?> <Error><Code>NoSuchKey</Code><Message>The specified key does not exist.</Message><Key>49156377018c8a5815e9bf856502383b90171a8e.ps</Key><RequestId>FD A4DBD230A8306B</RequestId><HostId>ArlQPmPTZy5MqLvnNGwi6mttAsNF... Date Added: 2009-06-18 20:17:34 |
| ep_nflu.txt Path: Berkeley >> ASTRO >> 00150314 Fall, 2009 Description: # Ep lNiso 1.803 139.836 3.578 139.196 30.155 138.684 33.204 138.521 34.143 137.859 35.858 137.178 36.562 138.740 37.183 139.035 38.035 137.457 38.057 137.217 38.446 137.797 39.120 137.500 39.369 138.318 39.883 137.904 40.331 138.271 40.463 138.008 4... Date Added: 2009-06-18 20:18:08 |
| 201 Past Projects.pdf Path: GWU >> BADM >> 130 Fall, 2009 Description: MANAGEMENT 201, 262 AND 290 GROUP PROJECTS TQM, Interactive Planning and the Viable System Model 12/21/2007 Spring 1989 (262) Using a Structured Change Process to Address the Problems of The Falls Church Regina Lightfoot, Ern Reynolds, Norma Tovar In... Date Added: 2009-06-18 20:18:34 |
| c3ans3.pdf Path: ASU >> EDP >> 554 Fall, 2009 Description: Answers to Homework 3 1. Sample distributions give the various values of college satisfaction and their frequency for the younger and older students in our samples. Graphically, There are comparable distributions at the population level. In other wo... Date Added: 2009-06-18 20:18:47 |
| error.txt Path: Texas >> ASE >> 463 Fall, 2009 Description: <html> <head> </head> <body> <body bgcolor=\"black\" text=\"blue\"> <br><center><h2>9.0 Error</h2></center> <br> <br> <p class=\"MsoNormal\" style=\"margin-right:2.15pt;text-indent:.5in;line-height: normal\">At the collegiate classroom level it is difficult... Date Added: 2009-06-18 20:19:01 |
| lecture.txt Path: UF >> CGS >> 2414 Fall, 2008 Description: = CGS 2414 Lecture 7 ep@cise.ufl.edu = Intro to Objects Object - something in the physical world Think of an object as a more complex data type Sometimes it is convenient to group several variables that represent something public c... Date Added: 2009-06-18 20:20:31 |
| mgp00007.txt Path: UF >> CGS >> 2414 Fall, 2008 Description: FtoC! With what we know, lets analize a simple version of the FtoC algorithm in Java public class FtoC { public static void main(String[] args) { / initialize the value to convert double fahrenheit = 98.6... Date Added: 2009-06-18 20:20:44 |
| mgp00008.txt Path: UF >> CGS >> 2414 Fall, 2008 Description: Search for Characters indexOf() is also overloaded to allow searching for a single character / 0123456789012345678901234 String str1 = \"Albert, the Florida Gator\"; int index; index = str1.indexOf( \'a\' )... Date Added: 2009-06-18 20:21:24 |
| mgp00006.txt Path: UF >> CGS >> 2414 Fall, 2008 Description: Blah, blah, blah! Examples, please! Ok, but first understand how interfaces work! To handle an ActionEvent, we must define anActionListener object with the method to perform the action The interface template: public interface ActionListene... Date Added: 2009-06-18 20:21:35 |
| mgp00054.txt Path: UF >> CGS >> 2414 Fall, 2008 Description: <?xml version=\"1.0\" encoding=\"UTF-8\"?> <Error><Code>NoSuchKey</Code><Message>The specified key does not exist.</Message><Key>49b1b6ac14eb9e5e633fc962cdc4310a8d5726d8.txt</Key><RequestId>985D14C9C9C677E9</RequestId><HostId>IsR0Ut/2XuuprHoTrAUwHvlTJEeh... Date Added: 2009-06-18 20:22:34 |
| ex10_018.xls Path: Auburn >> STAT >> 2610 Fall, 2008 Description: Year 1985 1986 1987 1988 1989 1990 1991 1992 1993 1994 1995 1996 1997 1998 1999 2000 Stocks 12.8 34.6 28.8 23.3 8.3 17.1 50.6 97 151.3 133.6 140.1 238.2 243.5 165.9 194.3 309 Bonds 100.8 161.8 10.6 5.8 1.4 9.2 74.6 87.1 84.6 72 6.8 3.3 30 79.2 6... Date Added: 2009-06-18 20:23:48 |
| RenaissanceArt3a copy.ppt Path: Michigan State University >> ISP >> 213 Fall, 2009 Description: Interlude Artistic Revolution #2 The Renaissance Realism Period Medieval Art Medieval Art ISP213H reminder of the project I\'m testing an idea: That it is useful and maybe fun to look at the history of physics in the context of another techniqu... Date Added: 2009-06-18 20:24:11 |
| chap18.pdf Path: Lincoln U. CA >> CHEMISTRY >> 3411 Fall, 2009 Description: Chemistry 3411 - Chapter 18 (Ethers & epoxides) I. Ethers are very often used as solvents for organic reactions that involve strongly basic reagents. This is because ethers are polar enough to dissolve the reagents yet chemically inert to such basic ... Date Added: 2009-06-18 20:24:25 |
| 3135f08p1001.pdf Path: University of Regina >> HIST >> 3135 Fall, 2009 Description: Monday, September 29, 2008: The Historical Context of New France, 1663-1685 OUTLINE A. FRENCH MERCANTILISM B. FRENCH-CANADIAN SOCIETY UNDER THE OLD REGIME C. POLITICAL CHANGE IN THE COLONY OF NEW FRANCE IN 1663 D. IROQUOIS DIPLOMACY AND THE EFFECTS O... Date Added: 2009-06-18 20:27:48 |
| hackftp_moron.txt Path: CSU Bakersfield >> CS >> 280 Fall, 2009 Description: MORONIC HACKING FROM 24.93.94.60 (clt94-060.carolina.rr.com). This fellow is stupid enough to leave his NETBIOS ports enabled so when I do nbtstat -A 24.93.94.60 I get the following: NetBIOS Remote Machine Name Table Name ... Date Added: 2009-06-18 20:28:45 |
| m201rv3.pdf Path: CSU Bakersfield >> MATH >> 201 Fall, 2008 Description: G d} S Qu ` Q ` )m`gdamf8ekTQ 2dQ r q W S d d q `u } q |y q ` `f f S Qu f S r u W Q Hf r q } S X\'gem`gwzn Eea~TTqeazuwodalxd#v\'uuT~xf S `u uW r q | Yk S Qu f ` Q ` `u q | ` uW Qu }Sf v S c mavTTwgda#juzuedjTgefvau3gw2uy @ owu ... Date Added: 2009-06-18 20:29:02 |
| x222mod3.ps Path: CSU Bakersfield >> MATH >> 212 Spring, 2008 Description: %!PS-Adobe-2.0 %Creator: dvips(k) 5.86 Copyright 1999 Radical Eye Software %Title: x222mod3.dvi %CreationDate: Tue Apr 18 10:59:33 2000 %Pages: 4 %PageOrder: Ascend %BoundingBox: 0 0 612 792 %EndComments %DVIPSWebPage: (www.radicaleye.com) %DVIPSComm... Date Added: 2009-06-18 20:29:07 |
| c360lab2.pdf Path: CSU Bakersfield >> CS >> 360 Fall, 2009 Description: ... Date Added: 2009-06-18 20:29:14 |
| tmp.txt Path: CSU Bakersfield >> CS >> 321 Fall, 2009 Description: / is one (advfs) file system (root_domain#root mounted on /) Note inode=2 for \".\" = / (the filesystem root): device /tmp: Inode RecLen Maj Min Name File_Mode Link Uid Skip 00000025 0014 . 004 1 ... Date Added: 2009-06-18 20:29:30 |
| 25781.txt Path: UNC >> DOCS >> 25781 Fall, 2009 Description: Project Gutenberg\'s The Ghost Breaker, by Charles Goddard and Paul Dickey This eBook is for the use of anyone anywhere at no cost and with almost no restrictions whatsoever. You may copy it, give it away or re-use it under the terms of the Project ... Date Added: 2009-06-18 20:33:33 |
| 420L14Membrane Structure & Function.ppt Path: Maryland >> BSCI >> 421 Fall, 2008 Description: Membrane Structure When I was a boy, I used to sing a song in the temple: A true disciple knows another\'s woes as his own. He bows to all and despises none.\" 1. Membrane fu... Date Added: 2009-06-18 20:34:32 |
| physicsdef.doc Path: CSU Northridge >> JJV >> 7820 Fall, 2009 Description: What is physics? What is physics? Often you hear physics defined as: 1) The study of the physical world 1) The science of matter and energy . that is a pretty broad definition! But physics is indeed the most fundamental of all the sciences, Ernest Ru... Date Added: 2009-06-18 20:35:16 |
| ChandlerCoherence.ps Path: Sveriges lantbruksuniversitet >> STAT >> 804 Fall, 2009 Description: %!PS-Adobe-3.0 %DocumentNeededResources: font Helvetica %+ font Helvetica-Bold %+ font Helvetica-Oblique %+ font Helvetica-BoldOblique %+ font Symbol %DocumentMedia: a4 595 841 0 () () %Title: R Graphics Output %Creator: R Software %Pages: (atend) %O... Date Added: 2009-06-18 20:36:29 |
| Adaptive Behavior Reflection.pdf Path: Wisc Stevens Point >> JPRUS >> 832 Fall, 2009 Description: Jerry Prusinski Education 351 Section 4 October 14, 2008 Adaptive Behavior Reflection It is a privilege to be part of the Education program today. I am excited to be part of an evolving profession that seems to change every year in technology, teachi... Date Added: 2009-06-18 20:37:04 |
| Exam 2 2000.pdf Path: Willamette >> EXAMS >> 330 Fall, 2009 Description: 1 ExSci 330 The Science of Nutrition Exam #2 (this exam is worth 25% of your final grade) Please answer all the questions. Relax, and good luck! 1. The most reliable food sources for zinc is (are): a) meats and seafood b) orange juice c) dark gree... Date Added: 2009-06-18 20:38:21 |
| Lecture37.pdf Path: Delaware >> PHYS >> 313 Fall, 2008 Description: Lecture 37 5/14/07 Lasers III Solid state, gas, liquid lasers Semiconductor lasers Lasers and inertial confinement fusion Review: improving underwater vision Lecture quiz 313 Review: laser requirement To achieve lasing 1. Lasing medium in which pop... Date Added: 2009-06-18 20:40:35 |
| Metacognitive Strategies.doc Path: Stanford >> EDUC >> 39106 Fall, 2009 Description: Meta-cognitive Strategies By Jullien Gordon Scenario: You just received your GRE scores back and they are below average. You have 4 weeks to retake the exam and submit your applications before the deadline. The last time you took the test, you studie... Date Added: 2009-06-18 20:40:55 |
| chapitre11.pdf Path: Neumont >> IFT >> 1010 Fall, 2009 Description: Chapter 11: Rcursivit Presentation slides for Java Software Solutions Foundations of Program Design Second Edition by John Lewis and William Loftus Java Software Solutions is published by Addison-Wesley AddisonPresentation slides are copyright 2000... Date Added: 2009-06-18 20:42:35 |
| SB14eChap12.ppt Path: UT Arlington >> MANAGEMENT >> 3320 Fall, 2009 Description: <?xml version=\"1.0\" encoding=\"UTF-8\"?> <Error><Code>NoSuchKey</Code><Message>The specified key does not exist.</Message><Key>4928ed03bd7f7a50eee38d9e870024a21f9d944d.ppt</Key><RequestId>A 4D8C7AEE3A88DF1</RequestId><HostId>Wz4ctSpUM5ac0TtbEqTRJxJDKgW... Date Added: 2009-06-18 20:45:30 |
| leafs.txt Path: UNI >> CNS >> 121 Fall, 2009 Description: options ls=72; data leafs; input treatmentType leafSize nicotineContent; cards; 1 27.7619 10.0655 1 27.8523 9.4712 1 21.3495 9.1246 1 31.9616 11.3652 1 19.4623 11.3976 1 12.2804 11.2936 1 21.0508 10.6805 1 19.5074 8.1280 1 26.2808 10.5066 1 26.146... Date Added: 2009-06-18 20:46:47 |
| FinalSolutions.pdf Path: Caltech >> EE >> 126 Fall, 2009 Description: EE/Ma 126a Error-Correcting Codes December 11, 2004 Solutions to Final Examination R. J. McEliece 162 Moore Problem 1. (Graded by Wei-Hsin) R() = 1 log2 1 bits/sample; C = 1/2 bits/second. 2 Therefore 1 C =- samples/second. R() log2 Problem 2. (G... Date Added: 2009-06-18 20:50:03 |
| Lecture18.pdf Path: Caltech >> EE >> 126 Fall, 2009 Description: EE/Ma 126b Lecture 18 Last Revised February 21, 2004 Outline R. J. McEliece Caltech Three useful Inequalities A \"Practical\" Code for the 2-Adder MAC? The Gaussian MAC An Interesting (Counter) Example. 1 Three Useful Inequalities Theorem A. I... Date Added: 2009-06-18 20:50:16 |
| Chambliss-Mundanity of Excellence.pdf Path: Wesleyan >> SOC >> 244 Spring, 2009 Description: ... Date Added: 2009-06-18 20:50:18 |
| SCALE-UP Rubric Lab01.pdf Path: Pittsburgh >> PHYS >> 0174 Fall, 2008 Description: GENERAL GUIDELINES FOR WRITTEN LAB REPORTS Title A good title should describe lab concisely, adequately, appropriately. List the students who worked on the lab, your group number, and the roles each of you played (Manager, Recorder, Skeptic). If a gr... Date Added: 2009-06-18 20:53:20 |
| YBR200W-A.t2k.stride-ebghtl-logo.pdf Path: UCSC >> YBR >> 200 Fall, 2009 Description: YBR200W-A.t2k EBGHTL 3 2 1 C TECX H X X C E E E E G H C E H H E E H G T X X X X X X X X X X X E E 10 20 30 40 E 3 2 1 T T C H E T E T T E H T X X X X CT C T 51 DR TG C 50 1 C EEEE TTTTT E C E TE X ML LCF HMCQRIMW LPFDLMKWRRFHC... Date Added: 2009-06-18 20:55:46 |
| pr10.pdf Path: Wisconsin >> BME >> 300 Fall, 2008 Description: Timing Device for Strobe Light to find Vocal Cord Vibration Frequency BME 300/200 Progress Report #10 12/3/02 Project Title: Team Members: Clients: Advisor: Date: Timing device for a strobe light to help find the frequency of vocal cord vibration ... Date Added: 2009-06-18 20:56:21 |
| T305_Proj2DesignText.doc Path: Allan Hancock College >> COMM >> 12030 Fall, 2009 Description: #FC#T305_Proj2DesignText.doc#\\}p\\ul#1D#B28 `YdK6+! O66}bb7 i@L!h#B#_;QRn#~1#{>6}(| >[Dr*G#?$R%#>#B,#wk22_)B\\7 _WzDo1Nn^N Ms5#Wz]|K#<v #oq#A#.g.#*#W?#hh#n#J#9V %... Date Added: 2009-06-18 20:56:33 |
| Vioxx Settlement.ppt Path: Wayne State University >> WEEK >> 7550 Fall, 2009 Description: Analysts See Merck Victory in Vioxx Settlement By ALEX BERENSON New York Times Published: November 10, 2007 Settlement For the drug maker Merck to pay almost $5 billion to settle lawsuits from people who contended that the painkiller Vioxx caused t... Date Added: 2009-06-18 20:57:07 |
| Umlaute.doc Path: Laurentian >> GERM >> 200803 Fall, 2009 Description: Hier ein paar Hilfen zum Schreiben von Umlauten: = = = = = = = Alt 132 Alt 142 Alt 148 Alt 153 Alt 129 Alt 154 Alt 225 ... Date Added: 2009-06-18 20:57:15 |
| info_office_hours.xls Path: Washington >> CHEM >> 152 Fall, 2008 Description: 152U Office Hours Dan Sluss Santiago Toledo Glen Wolfe Atanu Sengupta Dawn Cohen Charles Branhm Tuesday 12:30-2:30 CSC CSC CHL 18 Monday 1:30-2:30 Thursday 3:00-4:00 Monday 2:30-3:30 Thursday 2:30-3:30 Monday Friday Monday Tuesday 3:00-4:00 Benson 2... Date Added: 2009-06-18 20:57:29 |
| 8Universal.doc Path: Portland >> SBA >> 311 Fall, 2009 Description: Marketing Management 311 Hasson 8 Universal Marketing Functions Buying- Ensuring product offerings are available in sufficient quantities to meet customer demands. Selling-Using advertising, personal selling and sales promotion to match products t... Date Added: 2009-06-18 20:58:13 |
| 13-SplinesAndNURBS.pdf Path: Berkeley >> CS >> 184 Fall, 2008 Description: 1 2 Wednesday, October 29, 2008 3 4 Wednesday, October 29, 2008 5 5 Wednesday, October 29, 2008 6 7 Wednesday, October 29, 2008 8 8 Wednesday, October 29, 2008 9 10 Wednesday, October 29, 2008 11 12 Wednesday, October 29, 2008 13 14 We... Date Added: 2009-06-18 20:59:55 |
| ee527hw12.pdf Path: Kentucky >> EE >> 527 Fall, 2008 Description: EE 527 HW #12 DR. SMITH DUE: 10/30/08 1. 7.1.1, modified. Use a current of 4 50 A . 2. 7.1.2, modified. Work the problem for an angle of 50o . 3. 7.1.3, modified. Use the angle of 50o as in problem 2 above. 4. Derive the far fields for an x-directed ... Date Added: 2009-06-18 21:00:42 |
| HW 6.doc Path: Idaho >> ENGR >> 220 Fall, 2008 Description: ENGR 220 Dynamics HW 6 Textbook problems: Section 16.1-16.3 a) 16.2 b) 16.10 c) 16.18 Section 16.4 a) 16.33 b) 16.38 c) 16.45 Section 16.5 a) 16.55 b) 16.58 c) 16.65 d) 16.70 Tentative Due Date: March 27th Check course web site for due date chan... Date Added: 2009-06-18 21:01:16 |
| PCB_101A02.pdf Path: Missouri S&T >> ME >> 240 Fall, 2009 Description: Model 101A02 ICP Dynamic Pressure Sensor Installation and Operating Manual For assistance with the operation of this product , contact the Division of PCB Piezotronics, Inc. Division toll-free 888-684-0015 24-hour SensorLineSM 716-684-0001 Fax 716-6... Date Added: 2009-06-18 21:02:46 |
| 361_deCasteljau_john.pdf Path: Sveriges lantbruksuniversitet >> CS >> 361 Fall, 2009 Description: The de Casteljau Algorithm for Evaluating Bezier Curves From Rockwood \"Interactive Curves and Surfaces\" JDill deCasteljau.doc 29Oct00 Evaluating a Bzier curve at a given t gives P(t). As t varies from 0 to 1, P(t) traces out the curve segment. One w... Date Added: 2009-06-18 21:04:33 |
| EE 538 Syllabus.pdf Path: Kentucky >> EE >> 538 Fall, 2008 Description: EE 538 ELECTRIC POWER SYSTEMS II SPRING 2005 INSTRUCTOR MEETING TIMES TEXTBOOK REFERENCE GOALS PREREQUISITES Joseph Sottile, Office: 234A MMRB, Phone: 257 4616, e-mail: jsottile@ieee.org 8:00 9:15 a.m., TR 255 FPAT Office hours: MTWRF 10:00 10:5... Date Added: 2009-06-18 21:04:38 |
| 3004241.pdf Path: Iowa State >> LIB >> 3019 Fall, 2009 Description: Chemical and Biological Engineering Collection Development Policy Iowa State University Library I. General Purpose This policy provides a general and detailed description of the educational and research programs of the department of Chemical and Bio... Date Added: 2009-06-18 21:04:52 |
| YGR220C.t2k.w0.5-logo.pdf Path: UCSC >> YGR >> 220 Fall, 2009 Description: YGR220C.t2k w0.5 3 2 1 X X X XXXXXXXXXXXXXXXXXXXXXX E L E L L E L L S L K T L K L S S E K L E R L L L K XX L K K X X S X X X X X X X X X X XXXXX L E E L E L L K R L A N L E A X L S X XXXX P K L 1 10 20 30 40 ... Date Added: 2009-06-18 21:07:18 |
| YGR205W.t2k.CB_burial_14_7-logo.pdf Path: UCSC >> YGR >> 205 Fall, 2009 Description: YGR205W.t2k CB_BURIAL_14_7 3 2 1 A A BA D B C B C D D C X X X A XXCXXXC A A D D AA B B A ABA BA X D F A G D G C B D D D E B F E E F C C C G E E G E E E C E E G B G C D D D D C D C D D D D D B D D D E E D D D D B E D D X X X X X X X X X X X X X... Date Added: 2009-06-18 21:07:24 |
| cn7_gls.pdf Path: ASU >> ECN >> 725 Fall, 2009 Description: 7. GENERALIZED LEAST SQUARES (GLS) [1] ASSUMPTIONS: Assume SIC except that Cov() = E() = 2 where IT. Assume that E() = 0T1, and that X-1X and XX are all positive definite. Examples: Autocorrelation: The t are serially correlated. ( is not diagon... Date Added: 2009-06-18 21:09:21 |
| wage22.txt Path: ASU >> ECN >> 725 Fall, 2009 Description: 769.00000 40.000000 93.000000 35.000000 12.000000 11.000000 2.0000000 31.000000 1.0000000 0.00000000 0.00000000 1.0000000 1.0000000 2.0000000 8... Date Added: 2009-06-18 21:09:23 |
| GEOL101_2008S_LT01.pdf Path: UNLV >> GEOL >> 101 Fall, 2008 Description: GEOL101 Spring 2008, Section 003, Exam 1 - Important terms Introduction/Scientific Method/Overview of Plate Tectonics scientific method theory hypothesis law nebular hypothesis inner planets outer planets crust mantle inner core outer core gravitatio... Date Added: 2009-06-18 21:11:04 |
| 06101002.pdf Path: Wisconsin >> SH >> 061010 Fall, 2009 Description: ... Date Added: 2009-06-18 21:13:07 |
| YOR160W.t2k.w0.5-logo.pdf Path: UCSC >> YOR >> 160 Fall, 2009 Description: 4 3 2 1 L Q IF D Q I A K K S TQE LI IE SPDS I F N Q V I C M A XXXXXXXXXXXXXXXXXXXXXXXXXXXIXXXYXXVXXXXXGXXXXXXXVX X X X X D E D M Q K T I S D A G V L D E E E K D L N A S F I S N L T A L V QV AL V I LY S V A N FFSP L G I D R K I R L A G ... Date Added: 2009-06-18 21:14:48 |
| YOR123C.t2k.str2-logo.pdf Path: UCSC >> YOR >> 123 Fall, 2009 Description: YOR123C.t2k STR2 3 2 1 CC 1 TH HC X T C T SSSSTCTC C S P CC CSTSTTTTHHSSCHHCSSCCTZHM H S HHHHCC H H H H H S H G H H S H S G X XXXXXSGCXXXXXXXHXTS X X X X XXXXXXXXXXX X X X X X B H H H H T T CC S C TTC CC X X HH HHHH C CCCCC X T C C TT CCSS... Date Added: 2009-06-18 21:15:12 |
| YOR161W-B.t2k.w0.5-logo.pdf Path: UCSC >> YOR >> 161 Fall, 2009 Description: YOR161W-B.t2k w0.5 2 1 M L I V 10 20 30 40 H 2 1 H H ILH M L L LM L LVF VPVF P YIPEPVLL R RL EN V V XXXXXXXX XXXXXXXXXXXXX XXX X X X XXX T T K I V A X T T K S K V I A A Y I I I I V V L L S X Y I I V L T X X X X S F L I I I V V L ... Date Added: 2009-06-18 21:15:21 |
| hw2.ps Path: Toledo >> CSC >> 373 Fall, 2009 Description: %!PS-Adobe-2.0 %Creator: dvips(k) 5.86 Copyright 1999 Radical Eye Software %Title: hw2.dvi %Pages: 3 %PageOrder: Ascend %BoundingBox: 0 0 612 792 %EndComments %DVIPSWebPage: (www.radicaleye.com) %DVIPSCommandLine: dvips -t letter hw2.dvi -o hw2.ps %D... Date Added: 2009-06-18 21:16:08 |
| NotePages.doc Path: RIC >> M >> 177 Fall, 2009 Description: Math 177 QBA I Notes Day: M T W Th F Date: 2006 /_/_ Mon Day jas:/home/vdimitrov/8969/49f8d8183c5d1c7c4d4821d0523b491bb8e329e4.doc Page _ Journal: Questions, Answers, Comments, Updates Page _ jas:/home/vdimitrov/8969/49f8d8183c5d1c7c4d4821d0523... Date Added: 2009-06-18 21:17:21 |
| Solar pressure on Apophis.doc Path: Texas A&M >> AERO >> 489 Fall, 2008 Description: Effects of solar pressure on Apophis orbit h h = c h = Planck\'s constant Pphoton = = 6.626 10-34 W s 2 - c = Speed of light = Frequency = Wavelength x RA Specular reflection case We consider three cases: specular reflection, complete ab... Date Added: 2009-06-18 21:19:10 |
| lecture3.pdf Path: Duke >> CPS >> 001 Fall, 2009 Description: Today\'s topics Java Syntax and Grammars Sample Programs Upcoming More Java Reading Great Ideas, Chapter 2 Java! Java is a buzzword-enabled language From Sun (the developers of Java), \"Java is a simple, object-oriented, distributed, interpret... Date Added: 2009-06-18 21:19:54 |
| schedule.ps Path: Columbia >> G >> 6037 Fall, 2009 Description: %!PS-Adobe-2.0 %Creator: dvips(k) 5.86d Copyright 1999 Radical Eye Software %Title: schedule.DVI %Pages: 1 %PageOrder: Ascend %BoundingBox: 0 0 612 792 %DocumentFonts: CMR10 CMTI10 CMMI10 %EndComments %DVIPSWebPage: (www.radicaleye.com) %DVIPSCommand... Date Added: 2009-06-18 21:22:06 |
| Assign101a.doc Path: Idaho State >> EDUC >> 610 Fall, 2008 Description: Idaho State University Assignment #10.1 College of Education Each question below comprises a single step of an independent-groups T-test. 1) For each of the given data sets, calculate sum of squares. Set A 4 5 7 9 10 Set B 1 3 4 6 2) Find the poo... Date Added: 2009-06-18 21:23:18 |
| Chapter_5_examples.pdf Path: Dallas >> RMH >> 072000 Fall, 2009 Description: Tuesday, September 30, 2008 8:56 PM Transmission lines Page 1 Transmission lines Page 2 Transmission lines Page 3 ... Date Added: 2009-06-18 21:24:27 |
| figure-16.12.ps Path: Purdue >> IXP >> 1200 Fall, 2009 Description: %!PS-Adobe-1.0 %Creator: devps (Pipeline Associates, Inc.) %CreationDate: Sat Dec 14 15:20:26 2002 %Pages: (atend) %DocumentFonts: (atend) /X /exch load def /r /rmoveto load def /m /moveto load def /l /lineto load def /rl /rlineto load def /lc{yc X x... Date Added: 2009-06-18 21:25:18 |
| 321lmapc.pdf Path: CSU Northridge >> HCCHM >> 003 Fall, 2009 Description: Chemistry 321L Manual Page 47 Appendix C Determination of Ka1 and Ka2 of a Diprotic Acid by pH Titration with Strong Base The stepwise dissociation of a diprotic acid H2A is represented by: H2A + H2O H3O+ + HAHA- + H2O H3O+ + A2 Expressions for... Date Added: 2009-06-18 21:26:55 |
| TrigApproxError.doc Path: Toledo >> MATH >> 1850 Fall, 2000 Description: From a point on the ground that is 200 feet from the base of a building, the angle of elevation to the top of the building is measured to be 60 with a maximum error of 0.5 . Find (a) the approximate error and (b) the approximate relative error in t... Date Added: 2009-06-18 21:27:44 |
| w1-intro-4p.pdf Path: University of Iowa >> C >> 131 Fall, 2009 Description: ... Date Added: 2009-06-18 21:28:02 |
| Speech Two Self Evaluation.doc Path: NMT >> ENGLISH >> 389 Fall, 2009 Description: <?xml version=\"1.0\" encoding=\"UTF-8\"?> <Error><Code>NoSuchKey</Code><Message>The specified key does not exist.</Message><Key>49f6c901f7773488043ef4359de429b0a840254b.doc</Key><RequestId>8 9D3D7C29FB33A42</RequestId><HostId>QpZvldRT2MbmbFcTSLZwIC6jGex... Date Added: 2009-06-18 21:28:59 |
| ee518_hw07.ps Path: Washington >> EE >> 518 Fall, 2009 Description: %!PS-Adobe-2.0 %Creator: dvips(k) 5.86 Copyright 1999 Radical Eye Software %Title: ee518_hw07.dvi %Pages: 2 %PageOrder: Ascend %BoundingBox: 0 0 612 792 %EndComments %DVIPSWebPage: (www.radicaleye.com) %DVIPSCommandLine: dvips -o ee518_hw07.ps ee518_... Date Added: 2009-06-18 21:31:42 |
| 211 exam 1 review answers.pdf Path: Wisconsin >> MATH >> 211 Fall, 2008 Description: Like any answer key, there\'s no guarantee these answers are correct. Ideally, you should should know whether your method was correct long before you check this. Problem 1 $5, 000(1.005)24 , $5, 000e.12 Problem 2 -1 Problem 3 6, the slope of the line ... Date Added: 2009-06-18 21:31:49 |
| CS223_Markov_Prediction_2perpage.pdf Path: San Jose State >> CS >> 223 Fall, 2008 Description: CS 223 Bioinformatics CS223 Bioinformatics Sami Khuri Department of Computer Science San Jos State University San Jos, California, USA khuri@cs.sjsu.edu www.cs.sjsu.edu/faculty/khuri @2002-08 Sami Khuri Hidden Markov Models CpG Islands Profile HM... Date Added: 2009-06-18 21:31:56 |
| bj.ps Path: Carnegie Mellon >> WEEK >> 711 Fall, 2009 Description: %!PS-Adobe-2.0 %Creator: dvips(k) 5.86 Copyright 1999 Radical Eye Software %Title: machine-constants.dvi %Pages: 16 -1 %PageOrder: Descend %BoundingBox: 0 0 612 792 %DocumentFonts: Times-Bold Times-Roman Courier Times-Italic %EndComments %DVIPSWebPag... Date Added: 2009-06-18 21:34:05 |
| HZ-EHR-RH.pdf Path: Old Dominion >> HIST >> 600 Fall, 2008 Description: ... Date Added: 2009-06-18 21:34:35 |
| activity sheet.doc Path: N. Georgia >> MKROBE >> 9587 Fall, 2009 Description: Directions: On a sheet of paper draw a picture of one of the life cycles you learned about today. Be as neat as you can, and label what you learned for each cycle. Choose 1 of these life cycles. 1. The Butterfly Life Cycle 2. The Plant Life Cycle... Date Added: 2009-06-18 21:36:47 |
| Ingham_1992.pdf Path: UCSD >> LIGN >> 270 Fall, 2009 Description: ... Date Added: 2009-06-18 21:37:44 |
| ECN324 Phase 3 Review.ppt Path: UNC Wilmington >> ECN >> 324 Fall, 2009 Description: ECN 324 Phase 3 Exam Review Chapters 17 - 25 All Rights Reserved Dr. David P. Echevarria 1 Commercial Bank Operations [17] 1. Bank Sources of Funds? 2. Bank Uses of Funds? 3. How do demand deposit accounts differ from NOW accounts? 4. What is a R... Date Added: 2009-06-18 21:38:25 |
| comm-protocols.ppt Path: Rutgers >> CS >> 545 Fall, 2008 Description: CS 545: Distributed Systems Spring 2002 Communication Protocols Thu D. Nguyen http:/paul.rutgers.edu/cs545/S02/ Thu D. Nguyen CS 545: Distributed Systems 1 Introduction Today, we are covering 4 papers that sort of dot the landscape of communicati... Date Added: 2009-06-18 21:39:33 |
| lec1009.ppt Path: UCLA >> CS >> 211 Fall, 2009 Description: Architectural Considerations for a New Generation of Protocols Protocol function analysis Application Level Framing Integrated Layer Processing CS219/Fall 2001 10/04 Three design goals for new protocols Highspeed protocol operations Protoco... Date Added: 2009-06-18 21:40:46 |
| T0401.t04.stride-ebghtl-logo.pdf Path: UCSC >> T >> 0401 Fall, 2009 Description: T0401.t04 stride-ebghtl 3 2 1 1 10 20 30 40 H 3 2 1 H H E T 51 60 70 80 90 E 3 2 1 H G T E T E T E 101 110 120 130 T G T G H T H T T H T 140 VD L GDLDI TSIKYIAPSFDDFLGKAIY L NF N KL Q N VA N N N LT T 100 NY I YI... Date Added: 2009-06-18 21:41:24 |
| EE 203 Lecture 44 Spring 2006.pdf Path: Iowa State >> EE >> 203 Fall, 2009 Description: ... Date Added: 2009-06-18 21:43:05 |
| l_Orbital_angular_momentum.pdf Path: University of Illinois, Urbana Champaign >> PHYS >> 580 Fall, 2008 Description: Warning Concerning Copyright Restrictions The Copyright law of the United States (Title 17, United States Code) governs the making of photocopies or other reproductions of copyright material. Under certain conditions specified in the law, libraries a... Date Added: 2009-06-18 21:43:42 |
| 13-VirtualMemory.2p.ps Path: UCSC >> CMPE >> 110 Winter, 2008 Description: %!PS-Adobe-2.0 %DocumentFonts: Helvetica Helvetica-Bold Courier Courier-Bold %Title: stdin %Creator: psnup, Copyright (C) 1994 M. Herbert <rxkmh@minyos.xx.rmit.oz.au> %Revision: $Header: psnup.pro,v 2.2 94/06/14 14:39:29 rxkmh Locked 0%CreationDate: ... Date Added: 2009-06-18 21:44:13 |
| Lobster.pdf Path: UMass (Amherst) >> WFCON >> 571 Fall, 2009 Description: Northeast Consortium Annual Report Form The annual report may be provided in any file type (Word, WordPerfect, or text preferred). The report should include the following sections, using the section headings indicated. 1. Project Title Mapping Spawni... Date Added: 2009-06-18 21:46:15 |
| ch9ex.doc Path: Binghamton >> CS >> 373 Fall, 2009 Description: 4/9/03 Detects too many a\'s Detects too many b\'s => In resetting the head (last 4 rules), we should also replace all x\'s with 1\'s (and the 0 with a 0), in order to restore the string to its original state, for example: replace (... Date Added: 2009-06-18 21:47:08 |
| sept 11.pdf Path: Wisc Stevens Point >> KKOLO >> 569 Fall, 2009 Description: ... Date Added: 2009-06-18 21:48:16 |
| Conference_5 - D. Arumugam et al..pdf Path: UT Arlington >> DDA >> 3192 Fall, 2009 Description: Specific Absorption Rates in Muscle Tissues for UHF RFID Reader Systems Darmindra D. Arumugam1, Daniel W. Engels2 University of Texas at Arlington 416 Yates Street, Arlington, TX 76010 1 darumugam@uta.edu 2 dengels@uta.edu 1, 2 Abstract In this pape... Date Added: 2009-06-18 21:52:23 |
| Qch14.doc Path: Washington >> ACC >> 507 Fall, 2009 Description: Cost Accounting QUIZ Chapter 14 Name _ \"Any idiot can face a crisis: It is this day-to-day living that wears you out.\"-Anton Chekhov 1. An unfavorable sales-mix variance would most likely be caused by: A. a new competitor providing better service... Date Added: 2009-06-18 21:54:47 |
| 04101716.pdf Path: Wisconsin >> SH >> 041017 Fall, 2009 Description: ... Date Added: 2009-06-18 21:55:29 |
| RECOMMENDATIONS_UMG_Operations-july2006.pdf Path: Allan Hancock College >> PAGE >> 25455 Fall, 2009 Description: RECOMMENDATIONS OF THE WORKING PARTY FORMED TO REVIEW THE OPERATIONS AND EFFECTIVENESS OF THE UNIVERSITY MANAGERS\' GROUP (UMG). PURPOSE Recommendation 1 That the purpose of the UMG be changed to the following To provide a forum for exchanging, discu... Date Added: 2009-06-18 21:55:39 |
| assgn7.doc Path: Air Force Academy >> EE >> 480 Fall, 2009 Description: Assignment 7 Class note on \"Design by Root Loci\" -> EE480RLOC_2003.pdf describes how to apply the root locus method to a discrete time model of the satellite attitude control system. Root Locus template is provided here. MATLAB programs used in the c... Date Added: 2009-06-18 21:56:55 |
| meisel notes.doc Path: Middlebury >> S >> 0500 Fall, 2009 Description: J. Prentice Murphy\'s report, included in Meisel\'s book, ends on page 47 it likely includes the pictures of families on pages 38-39 or thereabouts excerpted in jpeg notes Tyson and Murphy reports, which precede transcript of a welfare conference, see... Date Added: 2009-06-18 21:58:04 |
| 0rcs31-91.pdf Path: Neumont >> CSC >> 1900 Fall, 2009 Description: Supreme Court of Canada Sunlife Assurance Co. v. Elliott, 31 S.C.R. 91 Date: 1900-12-07 The Sun Life Assurance Company of Canada, (Plaintiff) Appellant. and Ellen Elliott (Defendant) Respondent. 1900: October 23; 1900: December 7. Present: Taschereau... Date Added: 2009-06-18 21:58:26 |
| AMME4660_30_7.doc Path: Allan Hancock College >> AMME >> 4660 Fall, 2009 Description: AMME4660 Wednesday 30/7 Industrial Conflict: Employment relationship will breakdown at times. Difference in interests (primarily profits and wages) and other matters such as: safety, leisure time, unpaid overtime, pace of work, unfair treatment, diff... Date Added: 2009-06-18 22:01:00 |
| clustering4.pdf Path: Case Western >> CS >> 435 Fall, 2009 Description: Clustering IV Instructor: Wei Wang Fall 2004 The UNIVERSITY of NORTH CAROLINA at CHAPEL HILL Motivation E-Commerce: collaborative filtering Movie 1 Viewer 1 Viewer 2 Viewer 3 Viewer 4 Viewer 5 2 Movie 2 2 Movie 3 4 Movie 4 3 6 Movie 5 Movie... Date Added: 2009-06-18 22:04:28 |
| pidworksheet.xls Path: Pittsburgh >> CS >> 1567 Spring, 2008 Description: target 50 KP 0.5 Ki 0.05 KD 1 error Proportional pos vel-P 50 0 48.75 1.25 46.28 3.72 43.91 6.09 41.65 8.35 39.51 10.49 37.48 12.52 35.56 14.44 33.73 16.27 32 18 30.36 19.64 28.8 21.2 27.32 22.68 25.92 24.08 24.58 25.42 23.32 26.68 22.12 27.88 20.9... Date Added: 2009-06-18 22:05:24 |
| Project Proposal Outline.doc Path: Oregon Tech >> CST >> 412 Fall, 2009 Description: Senior Project Proposal Outline Title Page Company Name Logo Submitted to: Submitted by: Email Version Date Legal Notice Copyright Notice Revision History Signature Page Table of Contents Introduction Overview Purpose Scope Intended Audience Referenc... Date Added: 2009-06-18 22:06:13 |
| singer-1997.pdf Path: Wilfrid Laurier >> CPSC >> 601 Fall, 2009 Description: CASCON 97 An Examination of Software Engineering Work Practices1 Janice Singer, Timothy Lethbridge, Norman Vinson, Nicolas Anquetil Institute for Information Technology National Research Council, Ottawa, ON, K1A OR6 School of Information Technolo... Date Added: 2009-06-18 22:08:40 |
| 2571exam1.pdf Path: Pittsburgh >> MATH >> 2571 Fall, 2009 Description: Matrix Theory and Differential Equations Exam I Friday September 29th 2006 20 points per question. The best five questions will count. Question 1 Solve the differential equation: t dy 4 + 3y = 3 , y(1) = -4. dt t Discuss the behavior of the solutio... Date Added: 2009-06-18 22:09:58 |
| 2571homework3.pdf Path: Pittsburgh >> MATH >> 2571 Fall, 2009 Description: Matrix Theory and Differential Equations Homework 1, due 8/31/6 Question 1 A yoghurt culture grows exponentially in a laboratory. After one day there are 5 grams of yoghurt. After six days there are 100 grams of yoghurt. How much culture was there... Date Added: 2009-06-18 22:09:59 |
| 2571q2s.pdf Path: Pittsburgh >> MATH >> 2571 Fall, 2009 Description: Matrix Theory and Differential Equations Quiz 2 Solutions, 9/25/6 Question 1 A projectile is moving vertically and experiences the deceleration of gravity of size 32 feet per second per second and a deceleration due to air resistance of size v2 feet ... Date Added: 2009-06-18 22:10:06 |
| FRD_LCA_F07a_T16_V2.0.pdf Path: USC >> CSCI >> 577 Fall, 2009 Description: Feasibility Rationale Description (FRD) E-Mentoring Program Team 16 Team Members Chen Zhao Project Manager Zhu Fang Prototype Developer Philip Wong System Architect Tan Liu Requirement Analyst Dongjin Li Life Cycle Planner Nikhil Kashyap Conc... Date Added: 2009-06-18 22:10:59 |
| Leadership%20in%20globalization%20and%20diversity.doc Path: Clemson >> CLE >> 5101 Fall, 2009 Description: LEADERSHIP AND ENTREPRENEURSHIP Niche: Leadership in Globalization and Diversity VISION To better prepare our students, in particular our honor and scholarship students, as well as our international students, to become well-rounded leaders. EXPECTED... Date Added: 2009-06-18 22:11:53 |
| Lec10.pdf Path: Dallas >> EE >> 3301 Fall, 2008 Description: EE 3301 Lecture #10 Operational Laplace Transforms: ! Operational Laplace transforms are specific Laplace transforms of mathematical operations on some f(t). ! In general, the operational transform of some f(t) will be an equivalent F(s) just as is t... Date Added: 2009-06-18 22:11:56 |
| start.pdf Path: Clemson >> CPSC >> 212 Fall, 2009 Description: CpSc 212 - SummerI 2009 - Goddard Data Structures and Algorithms in C+ Wayne Goddard goddard@clemson.edu Office Hours. MondayFriday 11:15amNoon; or by appointment. Content. Tools. C+, programming methodology, recursion, mathematical preliminaries, ... Date Added: 2009-06-18 22:12:15 |
| HW72.pdf Path: WVU >> MATH >> 156 Fall, 2008 Description: ... Date Added: 2009-06-18 22:13:21 |
| futureofcj.ppt Path: CSU Bakersfield >> CJ >> 100 Fall, 2009 Description: Department of Criminal Justice California State University - Bakersfield CRJU 100 Introduction to Criminal Justice Dr. Abu-Lughod, Reem Ali Present and Emerging Trends: The Future of Criminal Justice WAR AND PEACE IN CJ: s Struggling between the e... Date Added: 2009-06-18 22:13:32 |
| inputtext.txt Path: Wesleyan >> COMP >> 212 Fall, 2009 Description: Now is the time for all good men to come to the aid of their country. ... Date Added: 2009-06-18 22:14:05 |
| PlayhousesPlayers.pdf Path: Toledo >> VIC >> 347 Fall, 2009 Description: ... Date Added: 2009-06-18 22:15:58 |
| tutorial6_2_.pdf Path: Allan Hancock College >> NETS >> 3303 Fall, 2009 Description: NETS3007/3907 Network Protocols Tutorial 8 (TCP - 2) 1. What is the maximum size of the TCP header? Minimum size? 2. One of the TCP options permits a receiver to specify the maximum segment size it is willing to accept. Why does TCP support an optio... Date Added: 2009-06-18 22:17:08 |
| oldchap3.pdf Path: Colorado State >> AT >> 712 Fall, 2009 Description: Cloud Microphysics Parameterization in Mesoscale and Cloudscale NWP models 8/28/2002 Part 3 1 8/28/2002 Part 3 2 8/28/2002 Part 3 3 8/28/2002 Part 3 4 Outline Review of \"classic\" Kessler parameterization scheme. Analytical solutions to... Date Added: 2009-06-18 22:19:53 |
| Scavenger.doc Path: Trinity U >> CS >> 1300 Fall, 2009 Description: 8:30 Computer Skills Belisle Name: Scavenger Hunt Look at your classmates blogs to find the answers to the scavenger hunt. Don\'t forget to comment on two students\' blogs and leave the URL. FYI: neither the TA or Ms. Belisle are in the scavenger hun... Date Added: 2009-06-18 22:20:44 |
| CandidateQuestions.pdf Path: Washington >> GS >> 630 Winter, 2009 Description: Questions for Search Committees By Bernice R. Sandler, Jean O\'Gorman Hughes, and Mary DeMouy It\'s All in What You Ask: Research shows that women in science often have lower aspirations than their male colleagues. Have you encountered this trend i... Date Added: 2009-06-18 22:22:16 |
| ho12-prac-mid3.ps Path: UCSC >> CMPS >> 201 Fall, 2008 Description: %!PS-Adobe-2.0 %Creator: dvips(k) 5.86 Copyright 1999 Radical Eye Software %Title: ho12-prac-mid3.dvi %Pages: 4 %PageOrder: Ascend %BoundingBox: 0 0 612 792 %DocumentFonts: Times-Roman Times-Bold Times-Italic Courier %EndComments %DVIPSWebPage: (www.... Date Added: 2009-06-18 22:22:28 |
| text&css.ppt Path: DePaul >> CTI >> 201 Fall, 2009 Description: HCI 201 Multimedia and the www Multimedia & The World Wide Web winny HCI 201 Multimedia and the www What is important in web design? Color give out the 1st impression Layout organize the content Content the flesh, the key! Text Important ... Date Added: 2009-06-18 22:22:57 |
| Lecture9a-DSS&EIS.pdf Path: Penn State >> MIS >> 531 Winter, 2009 Description: E.W. Stein Lecture Notes Penn State DSS and EIS Decision Support and Executive Information Systems Advanced Information Systems Expert Systems >Decision Support Systems >Executive Information Systems 2 4 DSS Definition Part Ia: DSS\'s \"D... Date Added: 2009-06-18 22:24:08 |
| hwV5.09.pdf Path: Washington >> M >> 442 Fall, 2009 Description: Math 443 Assignment 5, Due Friday, 6/5 May, 2009 1 Reading: Read 6.6, 6.7 through example 6.7.3, and 5.4. In 5.4, we will replace some of the lengthy calculations by more geometric arguments. Optional: rest of 6.7 (I recommend skipping to the par... Date Added: 2009-06-18 22:25:12 |
| SAP---Production Orders.doc Path: CSU Chico >> SAP >> 248 Fall, 2009 Description: Production Orders (1) Master Production Scheduling Long-Term Planning Material reqmts planning Demand Management Capacity Capacity Stock Stock Production control Sales and operations planning Settlement R Controlling Controlling SAP AG Nex... Date Added: 2009-06-18 22:25:48 |
| npr-1-handouts.ps Path: Wisconsin >> CS >> 838 Fall, 2000 Description: %!PS-Adobe-3.0 %Title: Microsoft PowerPoint - npr-1.ppt %Creator: PSCRIPT.DRV Version 4.0 %CreationDate: 10/11/00 11:18:29 %BoundingBox: 13 13 599 780 %Pages: (atend) %PageOrder: Special %Requirements: %DocumentNeededFonts: (atend) %DocumentSuppliedF... Date Added: 2009-06-18 22:26:38 |
| Chapter5.ppt Path: Texas A&M >> AGEC >> 641 Fall, 2008 Description: Measurement and Interpretation of Elasticities Chapter 5 Alternative Elasticity Concepts Own price elasticity = % Qbeef % Pbeef Income elasticity = % Qbeef % Income Cross price elasticity = % Qbeef % Pchicken Pages 101-106 Alternative Elasticit... Date Added: 2009-06-18 22:28:35 |
| PE8-F2004.doc Path: Texas A&M >> AGEC >> 105 Fall, 2008 Description: Name _ UIN_ AGEC 105 Progress exam 8 1. Modern macroeconomics follows the theory first developed by: a. Alfred Marshall b. Karl Marx c. John Maynard Keynes d. Allen Greenspan 2. In the equation x=C+I+G+(x-m), x is known as: a. Gross Private Domesti... Date Added: 2009-06-18 22:28:39 |
| hw2.pdf Path: Ill. Chicago >> IE >> 446 Fall, 2008 Description: UNIVERSITY OF ILLINOIS AT CHICAGO Mechanical Engineering Michael J. Scott Spring 2001 Reading: Montgomery, Ch. 3 Undergraduates may skip one problem. 1. Montgomery 3-2 2. Montgomery 3-10 3. Montgomery 3-14 4. Montgomery 3-22 5. Montgomery 3-30 6. Mon... Date Added: 2009-06-18 22:29:56 |
| exam01.pdf Path: East Los Angeles College >> ECON >> 320 Fall, 2009 Description: Vxemhfw 653 H{dp 5334 Dqvzhu wzr txhvwlrqv iurp hdfk Vhfwlrq ^irxu lq doo` Vhfwlrq D Plfurhfrqrphwulfv 41 d, Ohw + 5 E4c 4 dqg % lv d ? & pdwul{ ri h{rjhqrxv yduldeohv1 ~ \' E+ : f zkhuh E lv wkh lqglfdwru ixqfwlrq1 Li zh revhuyh gdwd rq i+c %j zkhq ... Date Added: 2009-06-18 22:32:21 |
| prel-00.pdf Path: East Los Angeles College >> ECON >> 0405 Fall, 2009 Description: Professor M. Hashem Pesaran F:\\LECTURES\\PREL-00.DOC Lent Term 2000 Paper 5, Prelim. Introduction to the Theory and Practice of Econometrics COURSE OBJECTIVES This course is a continuation of what has been already taught during the Michaelmas term. ... Date Added: 2009-06-18 22:32:30 |
| 9.1.ps Path: Texas A&M >> PHIL >> 240 Fall, 2008 Description: %!PS-Adobe-2.0 %Creator: dvips(k) 5.86f Copyright 2001 Radical Eye Software %Title: 9.1.dvi %Pages: 9 %PageOrder: Ascend %BoundingBox: 0 0 612 792 %DocumentFonts: Helvetica-Bold Helvetica Helvetica-Oblique %+ Palatino-Roman Helvetica-BoldOblique %End... Date Added: 2009-06-18 22:33:01 |
| Capstone Presentation.pdf Path: N. Arizona >> D >> 486 Fall, 2009 Description: Pellet Stove PV Power Supply System Team Helios Lamont Serbousek Steve Clark Heather McNeill Riley Garrett Sponsor Dr. John Tester Technical Advisor Dr. Phil Mlsna 5/2/2003 Pellet Stove PV Power Supply-Heather McNeill 1 Presentation Outline Descr... Date Added: 2009-06-18 22:33:04 |
| tute9.pdf Path: Allan Hancock College >> CSE >> 1205 Fall, 2009 Description: IMS1002/CSE1205 Tutorial 9 Interface Design Tutorial Objectives: to develop understanding of the need to utilise good design principles in the design of interfaces Tutorial Task: 1. Your tutor will hand you a form which is an input document (Applic... Date Added: 2009-06-18 22:33:15 |
| e2_03f.pdf Path: Alabama Huntsville >> MAE >> 466 Fall, 2009 Description: ME 466 - Machine Design Fall Semester, 2003 Exam 2, 100 Points, Open Book NAME _ 1. (10 Points) Determine the proper tightening torque to be used on an M10x1.5 SAE class 10.9 bolt. Tightening Torque = _ 2. (20 Points) A 1/4-28 SAE grade 8 bolt is u... Date Added: 2009-06-18 22:34:41 |
| Lecture1.pdf Path: UCSC >> CMPE >> 100 Winter, 2008 Description: ... Date Added: 2009-06-18 22:34:50 |
| Xstal Osc Error.pdf Path: Benjamin Franklin Institute of Technology >> EE >> 240 Fall, 2009 Description: AN1155 Run-Time Calibration of Watch Crystals Author: Kantesh Kudapali Microchip Technology Inc. The following are the most common factors leading to oscillator errors in crystal sources: Mechanical Vibration Load Capacitor Temperature Age INTRO... Date Added: 2009-06-18 22:35:33 |
| Section 21.doc Path: North Texas >> DLH >> 0081 Fall, 2009 Description: Section 21 y Remember: log a x = y x = a Evaluate: Ex: f ( x) = log 2 x where x = 32 Ex: f ( x) = log x where x = 1 3 Ex: f ( x) = log x where x = -2 Some Basic Properties of Logarithmic Functions: 1. log a 1 = 0 since a 0 = 1 2. log a a = 1 since... Date Added: 2009-06-18 22:36:28 |
| spec_pc_bg.txt Path: Berkeley >> ASTRO >> 00306323 Fall, 2009 Description: # tmin tmax 0.137776 3244.6657 [ksec] ;instrument XRT ;exposure 50303.844 ;xunit kev ;bintype counts 0.000000 0.010000 0.000000 0.000000 0.010000 0.020000 0.000000 0.000000 0.020000 0.030000 0.000000 0.000000 0.030000 0.040000 0.00000... Date Added: 2009-06-18 22:36:49 |
| Ex2Topics.doc Path: S.F. State >> RLEE >> 2298 Fall, 2009 Description: Topics on MKTG 469 Exam 2 A. The Meaning of Basic Data Terms, such as K, M, B B. Speed of the Different Delivery Options C. Amount of Time for a File or Page to Arrive at the User D. Standards, Protocols, and Meanings Built into a URL E. ... Date Added: 2009-06-18 22:36:52 |
| ee527_exam3.pdf Path: Penn State >> EE >> 580 Fall, 2009 Description: EE 527 - Linear Control Systems Final Exam Tuesday, December 18, 2:30P4:20P 203 E E West Department of Electrical Engineering Pennsylvania State University Fall 2007 2 1. Consider the system whose motion is described by x(t) = v(t) and v(t) = -0 x(t... Date Added: 2009-06-18 22:38:21 |
| 3_26.pdf Path: LSU >> ME >> 2833 Fall, 2009 Description: ... Date Added: 2009-06-18 22:43:28 |
| ATMS101_HW6.pdf Path: Washington >> HW >> 101 Fall, 2009 Description: NAME: _ Quiz Section: _ Atmospheric Sciences 101 Spring 2009 Homework #6 (Due Wednesday, 20 May 2009) 1. Surface winds A. Below is an air parcel in between two surface isobars. Carefully draw arrows indicating the direction and relative strength of t... Date Added: 2009-06-18 22:45:46 |
| swb_fit2.txt Path: Berkeley >> ASTRO >> 00148646 Fall, 2009 Description: Spectra Extracted from tstart=-3.875 tstop=41.425 (Trigger Time, GPS=807012495.000000, Redshift, z=1.71) Power-Law Model Fit Norm@15keV 3.3651e-02 (2.6763e-02 4.1395e-02) alpha -1.6255 (-1.8042 -1.4505) Energy Fluence (15-350 keV) 3.3064e-06 (2.981... Date Added: 2009-06-18 22:48:31 |
| class11 prob solve example.ppt Path: Colorado >> PHYS >> 1010 Fall, 2008 Description: Novice Pieces Formulas By Authority Beliefs about structure Beliefs about content Beliefs about learning Problem-Solving Behavior Expert Coherence Concepts Independent Problem-solving independent of concepts. Manipulates equations. Backward-looking... Date Added: 2009-06-18 22:49:05 |
| 21_12_primitives.pdf Path: Mississippi State >> ECE >> 8013 Fall, 2009 Description: Gate Primatives Version 1.1 2:1 Interface Circuit 2:1 Operational Features: 1. 2. 3. Outputs value changes only on second of two input changes plus input feedback change on x1 circuit. Output feedback from 2:1 circuit changes alternately with a) in... Date Added: 2009-06-18 22:49:18 |
| Tutorial_1_2008_questions.pdf Path: Allan Hancock College >> CHEM >> 3112 Fall, 2009 Description: Chemistry 3112. Problem Sheet 1. Tutorial Date Thursday May 1 Lecturer: Brendan J. Kennedy Q 1. i) In the Chemistry 3 laboratories students make LaNiO3 from La(NO3)3 and NiCl2. Given the formal oxidation state of the Ni in LaNiO3. ii) Describe the a... Date Added: 2009-06-18 22:49:29 |
| radial_harmonic.pdf Path: Stanford >> MATH >> 131 Fall, 2009 Description: ... Date Added: 2009-06-18 22:50:38 |
| Sum4W12.ppt Path: Alabama >> CS >> 325 Fall, 2008 Description: CS 325 Unix Programming Environment and Windows Programming with Microsoft Foundation Classes (MFC) Windows Lecture 12 Today Dialog Windows Communicating with the dialog DoDataExchange OnInitDialog Assignment 4 = Twenty (20) improvements o... Date Added: 2009-06-18 22:50:56 |
| lecture_notes_part2.pdf Path: WVU >> EE >> 513 Fall, 2008 Description: ... Date Added: 2009-06-18 22:52:21 |
| Midterm1Review.pdf Path: Washington >> ATMOS >> 211 Fall, 2009 Description: ATMS 211 Review sheet for Midterm 1 Midterm is in section on Friday 8 February. It will cover weeks 1-4, and will focus on ideas, concepts, and definitions much more than calculations. If you are asked to do any math, you will be given the equations ... Date Added: 2009-06-18 22:52:57 |
| Karato_2008_cover.pdf Path: Yale >> SK >> 388 Fall, 2009 Description: K A R AT O Much of the recent progress in the solid Earth sciences is based on interpretation of a range of geophysical and geological observations in terms of the properties and deformation of Earth materials. One of the greatest challenges facing ... Date Added: 2009-06-18 22:53:37 |
| A4.doc Path: SMU - Cox School of Business >> ENGR >> 8383 Fall, 2009 Description: CSE 8383 Assignment 4 Due Date: April 6 (Campus students) April 13 (DVD students) Spring 2006 Answer the following questions in your textbook. Questions 1, 3 (page 73) Questions 7, 8 (page 74) Questions 1 6 (page 100) Questions 7, 8 (page 101) Sh... Date Added: 2009-06-18 22:53:44 |
| Math112.rtf Path: Bridgeport >> MATH >> 112 Fall, 2009 Description: MATH 112- Calculus II (4 credit hours) fall 2002 2002-2004 Catalog Data: Derivatives and integrals involving exponential and logarithmic functions. Inverse trigonometric functions. Hyperbolic functions. Techniques of integration. Substitution. Trigon... Date Added: 2009-06-18 22:54:45 |
| patch3.txt Path: Berkeley >> SECURE >> 17855 Fall, 2009 Description: # Eclipse Workspace Patch 1.0 #P sakai Index: agnostic/shared/src/main/java/org/sakaiproject/kernel/component/core/Maven2ArtifactResolver.java = - agnostic/shared/src/main/java/org/sakaiproject/kernel/component/core/Maven2ArtifactResolver.java (revis... Date Added: 2009-06-18 22:55:04 |
| Quiz7_1101_Sec13.pdf Path: Macon State >> MATH >> 1101 Fall, 2009 Description: Spring 2009 1101-13 Quiz 7 Name: 1. Find either a linear or exponential function that models the data exactly. (i) x -2 y 3 -1 0 5.5 8 1 2 . 10.5 13 (a) y = 2.5(x + 2) + 3 (ii) (b) y = -2.5(x + 2) + 3 (c) y = 8( 21 )x 2 (d) y = 8(10.5)x . x y ... Date Added: 2009-06-18 22:56:16 |
| ConceptsToKnow-midterm1.pdf Path: BYU >> ECE >> 320 Fall, 2008 Description: Concepts to know, midterm 1: 1. Difference between concurrent and process statements. How to convert between the two 2. How to write concurrent statements to implement logic (i.e. convert from logic to VHDL and vice versa) 3. How to write process sta... Date Added: 2009-06-18 22:58:13 |
| Quiz13SolutionA.pdf Path: JMU >> A >> 241 Fall, 2009 Description: General Journal Solution for Quiz 13 DEBIT 1 Cash Contributed Capital Prepaid Rent Cash Plant Property and Equipment Cash Inventory Accounts Payable Accounts Receivable Sales Revenue (note that no entry is made for inventory since the company is on ... Date Added: 2009-06-18 22:58:28 |
| rgsfcc-brodziak.pdf Path: University of Alaska Fairbanks >> LIB >> 0801 Fall, 2009 Description: Resiliency of Gadid Stocks to Fishing and Climate Change Alaska Sea Grant College Program doi:10.4027/rgsfcc.2008.08 141 The Incredible Shrinking Georges Bank Haddock (Melanogrammus aeglefinus) Jon K.T. Brodziak1 and Jason S. Link Northeast Fisher... Date Added: 2009-06-18 22:59:12 |
| SummaryofSeriesTestsSpring2009.pdf Path: Georgia Tech >> MATH >> 1502 Fall, 2008 Description: ... Date Added: 2009-06-18 22:59:16 |
| Teaching Evaluations 1.pdf Path: Minnesota >> KIMX >> 0759 Fall, 2009 Description: Kim,Hunjoon Political Science Room 1414 SocSci 7175 267 19th Ave S Minneapolis, MN 55455 SRT REpORTING POL 3835 001 - Fall 2008 Office of Measurement Services January 23, 2009 UNIVERSITY OF MINNESOTA Phone: 612.626.0006 Fax: 612.624.1336 879 ... Date Added: 2009-06-18 22:59:40 |
| MECH 345 - Prelab for Exp_3 2008.pdf Path: Virgin Islands >> MECH >> 345 Fall, 2009 Description: Mech 345, Fluid Mechanics I Prelab for Exp. #3 1.) In the context of the experimental apparatus, define `flow separation\' and `cavitation\'. 2.) Does the EGL increase or decrease along the flow direction? Why? 3.) How is the EGL affected by a constric... Date Added: 2009-06-18 23:00:30 |
| finaltopics.txt Path: Washington >> M >> 126 Fall, 2009 Description: 1. Taylor Polynomial, Taylor\'s Inequality, error 2. Taylor series, substitution, addition, differentiation lines... Date Added: 2009-06-18 23:00:42 |
| sp09_lect12.pdf Path: University of Illinois, Urbana Champaign >> PHYS >> 199 Fall, 2008 Description: Creationism, Evolution and Intelligent Design 21-Apr-2009 Phys 199ESP Lecture 12 1 \"Those afraid of the universe as it really is, those who pretend to nonexistent knowledge and envision a Cosmos centered on human beings will prefer the fleeting c... Date Added: 2009-06-18 23:02:07 |
| Class16_notes.pdf Path: North Texas >> EENG >> 2610 Fall, 2008 Description: EENG 2610: Circuit Analysis Class 16: Instantaneous Power, Average Power, Maximum Power Transfer, RMS Power Dr. Xinrong Li Department of Electrical Engineering College of Engineering, University of North Texas Steady-State Power Analysis Here we st... Date Added: 2009-06-18 23:02:50 |
| Software Evaluation Assignment.doc Path: N. Georgia >> CSCI >> 5156 Fall, 2009 Description: Matt Muia 11/13/2008 Software Evaluation #1 Software title and version Grade Level Publisher Major features Bodyworks 6.0 Didn\'t say; could use for high school, has modesty controls for elementary and middle school students The Learning Company; Brod... Date Added: 2009-06-18 23:03:16 |
| Syllabus.pdf Path: UNL >> CSE >> 432 Fall, 2009 Description: High Performance Processor Architecture Fall 2007 Instructor: Dr. Hong Jiang University of Nebraska-Lincoln jiang@cse.unl.edu Cse.unl.edu/~jiang/cs432 CSCE432/832 Department of Computer Science Time: 1:30pm-... Date Added: 2009-06-18 23:06:35 |
| Chapter 10.ppt Path: NSCC >> ACCT >> 203 Fall, 2009 Description: Standard Costs and the Balanced Scorecard Chapter Ten McGraw-Hill/Irwin Copyright 2008, The McGraw-Hill Companies, Inc. 10-2 Standard Costs Standards are benchmarks or \"norms\" for measuring performance. Two types of standards are commonly used. ... Date Added: 2009-06-18 23:07:52 |
| syllabus.pdf Path: Penn State >> ECON >> 471 Fall, 2008 Description: Economics 471 Development Economics Spring 2008 The web site for this course is: http:/www.econ.psu.edu/~broberts/courses/Econ471/ Professor: Bee-Yan Roberts Office: 501 Kern Building Phone: 863-1996 Email: byr@psu.edu Office Hours: Tues. & Thurs. 2:... Date Added: 2009-06-18 23:11:16 |
| Quiz #1 Metr 200 Sp 03.doc Path: S.F. State >> M >> 201 Fall, 2009 Description: DEPARTMENT OF GEOSCIENCES San Francisco State University Spring 2003 Metr. 200/201 Metr 503 Homework: Synoptic Metr Quiz #1 100 pts. (Test will be collected at 9AM) 1. Definitions. Choose two of the terms below. Provide a one sentence definition (i... Date Added: 2009-06-18 23:11:50 |
| cw.pdf Path: UF >> MATH >> 3474 Fall, 2009 Description: Classwork Thirty-Six: Use Stokes\' Theorem to evaluate NAME: C (xy i + 2x j + 3y k) dr, where C is the curve of intersection of the plane x + z = 5 and the cylinder x2 + y 2 = 9. HINT: S is the part of the plane z = 5 - x which lies above the dis... Date Added: 2009-06-18 23:12:22 |
| server-cluster.pdf Path: Duke >> CPS >> 212 Fall, 2009 Description: Internet Server Clusters Using Clusters for Scalable Services Clusters are a common vehicle for improving scalability and availability at a single service site in the network. Are network services the \"Killer App\" for clusters? incremental scalabil... Date Added: 2009-06-18 23:13:29 |
| ENSO_Quick_Look.pdf Path: Columbia >> IRI >> 200209 Fall, 2009 Description: ENSO QUICK LOOK September 17, 2002 A monthly summary of the status of El Nio, La Nia and the Southern Oscillation , or \"ENSO\" The IRI\'s assessment is that there is a nearly 100% probability that El Nio conditions will continue for the remainder of 20... Date Added: 2009-06-18 23:14:26 |
| JSFpp110a125.doc Path: Puget Sound >> FREN >> 202 Fall, 2009 Description: Vocabulaire Les Jeux sont faits, pp. 110-125 FREN 202 Rodgers les alentours conseiller qqn. mfiant(e)(s) reprer qqn./qqch. prendre la parole lcher qqn./qqch. tirer (sur qqn., blanc) menacer qqn. de (faire) qqch. mprisant(e)(s) un abruti Tire-toi!... Date Added: 2009-06-18 23:14:41 |
| marksizm-revizyonizm.pdf Path: Virginia Tech >> FARSI >> 1908 Fall, 2009 Description: . . - - . . . ... Date Added: 2009-06-18 23:14:53 |
| hezb.pdf Path: Virginia Tech >> FARSI >> 1967 Fall, 2009 Description: . H H H H H . . * HH HH HH HH HH HH HH HH HH HH HH H H H H HH HH HH HH HH .HH HH HH HH HH HH .HH H H H HH H H H HH H H H :H HH HH HH HH .HH HH HH HH HH HH HH . ... Date Added: 2009-06-18 23:14:56 |
| EpreuveIB202A.doc Path: Puget Sound >> FREN >> 202 Fall, 2009 Description: Nom _ preuve IB FREN 202 Printemps 2009 - Rodgers I. Vocabulaire (26 pts. ; 2 pts. / expression) crivez la lettre de l\'explication dans la colonne de droite dans l\'espace ct de l\'expression de vocabulaire dans la colonne de gauche. _ 1. un plan _ ... Date Added: 2009-06-18 23:14:58 |
| c_hello_specs.txt Path: Columbia >> CS >> 1003 Fall, 2008 Description: -this part you write yourself, describing your program - Programmer: Jane Doe CS1003/4 C Lab Assignment 0a: Hello World Due: 6pm 9/5/03 [optional] Anticipated Programming Time: 20 minutes Files included in submission specs.txt hello.c Input:... Date Added: 2009-06-18 23:16:02 |
| 7d_IFT232_DesignPatterns_Command-exemple.ppt Path: Rush >> IFT >> 785 Fall, 2009 Description: vti_encoding:SR|utf8-nl vti_timelastmodified:TR|18 Mar 2008 19:06:03 -0000 vti_extenderversion:SR|6.0.2.5516 vti_author:SR|PORT-DOMUS-06\\sylvain vti_modifiedby:SR|PORT-DOMUS-06\\sylvain vti_timecreated:TR|18 Mar 2008 19:06:03 -0000 vti_cacheddtm:TX|18... Date Added: 2009-06-18 23:17:49 |
| GCOS Table 1stats.doc Path: University of Baltimore >> HOME >> 641 Fall, 2009 Description: vti_encoding:SR|utf8-nl vti_timelastmodified:TR|06 Nov 2006 22:08:08 -0000 vti_extenderversion:SR|6.0.2.6551 vti_author:SR|CIS\ tygmitc vti_modifiedby:SR|CIS\ tygmitc vti_timecreated:TR|06 Nov 2006 22:08:08 -0000 vti_cacheddtm:TX|06 Nov 2006 22:08:08... Date Added: 2009-06-18 23:18:01 |
| Chpt5&6.pdf Path: UCCS >> CS >> 551 Fall, 2009 Description: 5.5 A request-reply protocol is implemented over a communication service with omission failures to provide at-least-once RMI invocation semantics. In the first case the implementor assumes an asynchronous distributed system. In the second case the im... Date Added: 2009-06-18 23:19:08 |
| fsp20090401.pdf Path: NYU >> AS >> 4823 Fall, 2009 Description: Foundations of Spatial Preferences Jon X Eguia New York University April 1, 2009 Abstract I provide an axiomatic foundation for the assumption of specific utility functions in a multidimensional spatial model, endogenizing the spatial representation... Date Added: 2009-06-18 23:20:12 |
| math0900test2answersfall2008.pdf Path: UNC Charlotte >> MATH >> 0900 Fall, 2008 Description: ... Date Added: 2009-06-18 23:21:55 |
| Revenues.xls Path: N. Georgia >> ADHEAL >> 4672 Fall, 2009 Description: Total Web Sales Selections Sales Information 06/10/2009 Sales Summary by Source Division Tools Image Control Inter-Faces Peripherals Digital Net-Works Fields of Play Home Page Total Web Catalog Retail Total Selections $35,627.00 $33,233.00 $29,99... Date Added: 2009-06-18 23:23:26 |
| hw1_sol.pdf Path: UCSD >> PH >> 246 Fall, 2009 Description: ... Date Added: 2009-06-18 23:23:48 |
| pq4b.pdf Path: UCSD >> PH >> 246 Fall, 2009 Description: B APqQE I qa 9E } % x A A Q ( QT B }x yiy $ C g I } ( P }( P B B h (r q} C (f C ( g z g k z Q ... Date Added: 2009-06-18 23:24:06 |
| hmksol5.pdf Path: UCSD >> PH >> 246 Fall, 2009 Description: Physics 8 - Homework set #5 due Thursday 05-07-98 Please box your final answers, also write neatly and double check the units of your answer! Special Info: Problems 1) A water tank is 5 m deep, with a hole on the side of the tank near the bottom. a) ... Date Added: 2009-06-18 23:24:15 |
|
|
Get Started With Course Hero Today!
Get study guides, join study groups, and more!
Sign up in seconds with your Facebook account!
Course Hero is a Facebook Application Partner.
Click below to sign-up for FREE.
Our Social Learning Network was built to provide students and key learning partners like professors a platform to share, meet and collaborate while accelerating their comprehension of course-related theories and concepts. We are committed to providing you immediate access to a growing wealth of study materials and an unparalleled academic network of students, professors and other key partners. Why do you care? Because you want the best grade possible and at times need a 24/7 resource that’s responsive to your needs. |
|
What People Are Saying About Course Hero
|
|||
|
|||
|
Explore the benefits of joining Course Hero's social learning network.
|
|||
![]() |
Get millions of study materials now!Need lecture notes for a missed class or want insightful explanation of the theories and concepts you learn in class? Look no further, Course Hero’s Study Materials empowers you to find a broad and deep set of materials that can help you right now!
Click below to sign-up for FREE.
|
||
![]() |
Get over 200,000 textbook solutions now!Having difficulty with your homework and need documents that are relevant for your Textbook? Don't be frustrated. Course Hero's Textbook Help presents you study materials from many college courses.
Click below to sign-up for FREE.
|
||
![]() |
Meet over 300,000 students and your fellow classmates now!Want to meet your current classmates or those that took the class last year? Don’t worry or have anxiety. Course Hero’s Study Groups gives you the seamless opportunity to develop both anonymous or direct relationships with those classmates whom you want to meet and get help from right now!
Click below to sign-up for FREE.
|
||


