Course Solutions And Notes - 3b9afefd 52
| 3b9af8f2.pdf Path: Wisconsin >> WILL >> 0023 Fall, 2009 Description: ... Date Added: 2009-06-24 11:20:34 |
| 48774aed.pdf Path: Wisconsin >> WILL >> 0096 Fall, 2009 Description: ... Date Added: 2009-06-24 11:22:16 |
| 48770f28.pdf Path: Wisconsin >> WILL >> 0080 Fall, 2009 Description: ... Date Added: 2009-06-24 11:23:50 |
| 487710ab.pdf Path: Wisconsin >> WILL >> 0080 Fall, 2009 Description: ... Date Added: 2009-06-24 11:24:24 |
| 487710ed.pdf Path: Wisconsin >> WILL >> 0080 Fall, 2009 Description: ... Date Added: 2009-06-24 11:24:35 |
| 48772b25.pdf Path: Wisconsin >> WILL >> 0088 Fall, 2009 Description: ... Date Added: 2009-06-24 11:26:55 |
| 48772b32.pdf Path: Wisconsin >> WILL >> 0088 Fall, 2009 Description: ... Date Added: 2009-06-24 11:26:56 |
| 48772ba6.pdf Path: Wisconsin >> WILL >> 0088 Fall, 2009 Description: ... Date Added: 2009-06-24 11:27:12 |
| 48772c18.pdf Path: Wisconsin >> WILL >> 0088 Fall, 2009 Description: ... Date Added: 2009-06-24 11:27:46 |
| 3b9b4cc6.pdf Path: Wisconsin >> WILL >> 0043 Fall, 2009 Description: ... Date Added: 2009-06-24 11:31:13 |
| 2be1.pdf Path: Wisconsin >> WILL >> 0063 Fall, 2009 Description: ... Date Added: 2009-06-24 11:32:51 |
| 2c5c.pdf Path: Wisconsin >> WILL >> 0063 Fall, 2009 Description: ... Date Added: 2009-06-24 11:33:04 |
| 487755f0.pdf Path: Wisconsin >> WILL >> 0100 Fall, 2009 Description: ... Date Added: 2009-06-24 11:33:25 |
| 487757d1.pdf Path: Wisconsin >> WILL >> 0100 Fall, 2009 Description: ... Date Added: 2009-06-24 11:33:53 |
| 3b9b1dad.pdf Path: Wisconsin >> WILL >> 0030 Fall, 2009 Description: ... Date Added: 2009-06-24 11:34:16 |
| 3b9b1f37.pdf Path: Wisconsin >> WILL >> 0030 Fall, 2009 Description: ... Date Added: 2009-06-24 11:35:06 |
| 3b9b1f68.pdf Path: Wisconsin >> WILL >> 0030 Fall, 2009 Description: ... Date Added: 2009-06-24 11:35:12 |
| 48774beb.pdf Path: Wisconsin >> WILL >> 0097 Fall, 2009 Description: ... Date Added: 2009-06-24 11:36:09 |
| 48776fb1.pdf Path: Wisconsin >> WILL >> 0108 Fall, 2009 Description: ... Date Added: 2009-06-24 11:37:17 |
| 3b9b06f6.pdf Path: Wisconsin >> WILL >> 0013 Fall, 2009 Description: ... Date Added: 2009-06-24 11:38:39 |
| 3b9b0641.pdf Path: Wisconsin >> WILL >> 0013 Fall, 2009 Description: ... Date Added: 2009-06-24 11:38:45 |
| 3b9b0796.pdf Path: Wisconsin >> WILL >> 0013 Fall, 2009 Description: ... Date Added: 2009-06-24 11:39:07 |
| 3b9b09b4.pdf Path: Wisconsin >> WILL >> 0013 Fall, 2009 Description: ... Date Added: 2009-06-24 11:39:26 |
| 3b9b3bf3.pdf Path: Wisconsin >> WILL >> 0038 Fall, 2009 Description: ... Date Added: 2009-06-24 11:40:39 |
| 48772a67.pdf Path: Wisconsin >> WILL >> 0087 Fall, 2009 Description: ... Date Added: 2009-06-24 11:41:37 |
| 3b9ad1c1.pdf Path: Wisconsin >> WILL >> 0003 Fall, 2009 Description: ... Date Added: 2009-06-24 11:44:57 |
| 3b9ad1fd.pdf Path: Wisconsin >> WILL >> 0003 Fall, 2009 Description: ... Date Added: 2009-06-24 11:45:14 |
| 959.pdf Path: Wisconsin >> WILL >> 0054 Fall, 2009 Description: ... Date Added: 2009-06-24 11:48:36 |
| a32.pdf Path: Wisconsin >> WILL >> 0054 Fall, 2009 Description: ... Date Added: 2009-06-24 11:48:55 |
| 3b9b4a17.pdf Path: Wisconsin >> WILL >> 0042 Fall, 2009 Description: ... Date Added: 2009-06-24 11:49:41 |
| 3b9b4a29.pdf Path: Wisconsin >> WILL >> 0042 Fall, 2009 Description: ... Date Added: 2009-06-24 11:49:43 |
| finalEquations.pdf Path: SUNY Stony Brook >> PHY >> 122 Spring, 2008 Description: c gT g g u !n i h @ u D n dc kfT l g @ Xhh l g F cSFgT a z al d m | c S T p m al m c S T c @ T c S T c @w T crq T cSl T c @g T c @ T cS T cSVT c SVT c @T c SVT c @wT crqT cSVlT c@gT cT 4... Date Added: 2009-06-24 11:50:59 |
| Simulation_Protocol.pdf Path: Columbia >> JAK >> 2190 Fall, 2009 Description: APPENDIX: SIMULATION PROTOCOL SET PARAMETER VALUES: CM = 0.5 CS = 0.15 ER = 0.04 AR = 0.4 N = 25 a = 0.05 b = 0.075 = 0.01 = 0.02 maxt = 300 Selectivity (mean culture for founders recruits Random turnov... Date Added: 2009-06-24 11:51:18 |
| test02.pdf Path: Pima CC >> PHY >> 121 Fall, 2008 Description: PHY 121 Introductory Physics I Test 2 March 27, 2003 Write all work neatly on a separate sheet of paper. Include units and enclose answers in boxes. 1. A net force of 16 N is applied in a constant direction to a basketball of mass 0.625 kg over a tim... Date Added: 2009-06-24 11:51:28 |
| YHL003C.t2k.w0.5-logo.pdf Path: UC Santa Cruz >> YHL >> 003 Fall, 2009 Description: YHL003C.t2k w0.5 6 5 4 3 2 1 L X 1 10 20 30 40 E 6 5 4 3 2 1 S E H T T T H XXXXXXXX K R K V K K I 51 60 70 80 90 T H 6 5 4 3 2 1 F L G T S E H XXX L T A XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX L A V I I L V G L L Q V I Y ... Date Added: 2009-06-24 11:52:32 |
| YMR199W.t06.stride-ebghtl-logo.pdf Path: UC Santa Cruz >> YMR >> 199 Fall, 2009 Description: YMR199W.t06 stride-ebghtl 2 1 CC 1 X HHT C T CE T T T E TH T TTGCTCCCTXEHEEXXETTTTEEHTTTCTTCTGGGGGXXXX E E G T T C E T T E T H C H C C X X X XXXHH XXXX X X X X X X X X X X X X C X X X C 10 20 30 40 T 2 1 T E H GH TH 51 60 70 80 90 G... Date Added: 2009-06-24 11:57:52 |
| 09.txt Path: Grinnell >> CS >> 302 Spring, 2006 Description: CSC302 2005S, Class 9: Scheme Semantics (1) Admin: * Homework due NOW! * New homework (due next Friday): Write a Scheme program that uses continuations in an interesting way * Nontrivial * Does something useful * Could serve as *positive* exem... Date Added: 2009-06-24 11:58:40 |
| semantics-1.txt Path: Grinnell >> CS >> 302 Spring, 2006 Description: CSC302 2005S, Class 9: Scheme Semantics (1) Admin: * Homework due NOW! * New homework (due next Friday): Write a Scheme program that uses continuations in an interesting way * Nontrivial * Does something useful * Could serve as *positive* exem... Date Added: 2009-06-24 11:59:04 |
| YMR146C.t2k.dssp-ehl2-logo.pdf Path: UC Santa Cruz >> YMR >> 146 Fall, 2009 Description: YMR146C.t2k DSSP-EHL2 2 1 1 10 20 30 40 E 2 1 T E T S E T S E T S E C CCCECCCCCCC E E E X X X X X X X X X X X 51 60 70 80 90 T S E 2 1 T S E T S E T E E E C X X T 2 1 S E T G T S E T E E E CCCCCCCCCCCC E E E X... Date Added: 2009-06-24 11:59:37 |
| irsim_sp99.ps Path: USC >> EE >> 577 Fall, 2009 Description: %!PS-Adobe-3.0 %BoundingBox: (atend) %Pages: (atend) %PageOrder: (atend) %DocumentFonts: (atend) %DocumentNeedsFonts: (atend) %DocumentSuppliedFonts: (atend) %Creator: Frame 5.5 %DocumentData: Clean7Bit %EndComments %BeginProlog % % Frame ps_prolog 5... Date Added: 2009-06-24 12:06:15 |
| p1-tests.txt Path: Lehigh >> CSC >> 017 Spring, 2009 Description: Test Cases (Inputs) for Program 1 P1 were graded by running the following tests cases by the graders. Afterwards, I went through the source code and made annotations on the style and commenting. good input #1 (5 points) - F, C, 0, 212, 10 #2 (... Date Added: 2009-06-24 12:06:52 |
| asc143.pdf Path: Kentucky >> ASC >> 143 Fall, 2009 Description: C O O P E R AT I V E E X T E N S I O N S E R V I C E U N I V E R S I T Y OF K E N T U C K Y C O L L E G E O F A G R I C U L T U R E ASC-143 Equine Feeding Management: The How & When of Feeding Horses Laurie Lawrence Department of Animal Sciences N... Date Added: 2009-06-24 12:13:49 |
| technology_maintenance.pdf Path: CSU San Marcos >> IT >> 709 Fall, 2009 Description: Technology Maintenance Page 1 of 7 Technology Maintenance Introduction The computer maintenance and repair department is the backbone of both the administrative functioning and technological instruction of the district. If the teachers and students... Date Added: 2009-06-24 12:16:16 |
| 7440_intro.pdf Path: Colorado >> PHYS >> 7440 Fall, 2008 Description: ... Date Added: 2009-06-24 12:23:02 |
| project7.pdf Path: Montana >> STAT >> 401 Fall, 2008 Description: Project 7 - Hypothesis Testing Statistics 401: Spring 2007 Due Monday, April 2 Turn in your solutions to this project in a typed report. When a problem requires calculations, do these calculations \"by hand\" and include this work in your report. Choos... Date Added: 2009-06-24 12:34:09 |
| WebdescFinal.pdf Path: Temple >> C >> 4339 Fall, 2009 Description: Webdesc Final Presentation Friday, 9 May 2008 YAY! Flowers! Why the long face, pal? My computer: Isn\'t accessible. Makes it hard to share and collaborate Requires too much housekeeping Costs too much Doesn\'t keep my data safe Cheer up. We hav... Date Added: 2009-06-24 12:42:08 |
| mid2ansm06.pdf Path: Miami >> ECO >> 212 Spring, 2008 Description: Second challenge: Solutions Eco 212: Spring 2006 Question 1 (15 points). a. Negative. b. The AIDS epidemic has reduced life expectancy. The result is that workers have less incentive to invest in education and job training, since workers will not be... Date Added: 2009-06-24 12:42:29 |
| ishs-1984spring72 .pdf Path: N. Illinois >> ISHS >> 1984 Fall, 2009 Description: ... Date Added: 2009-06-24 12:44:26 |
| hw3 Path: Middle East Technical University >> CE >> xxx Spring, 2009 Description: CE 384 STRUCTURAL ANALYSIS 2003-2004 Spring Semester Homework #3 Due Date: May 18th , 2004 Using the basic definition of nodal stiffness (general stiffness method), form the structural stiffness matrix [K] and the load vector [Q] of the following str... Date Added: 2009-06-24 13:00:57 |
| Copy of TX_intro=leg.doc Path: Texas >> I >> 382 Fall, 2009 Description: 1 INF382M GovernmentInformation Fall2004 Doty TEXASSTATEGOVERNMENT: INTRODUCTIONANDLEGISLATIVEINFORMATION AswedidwithU.S.governmentinformation,wewillusethetripartitestructureofgovernmenttohelpus considersourcesofinformationbyandaboutTexasstategover... Date Added: 2009-06-24 13:05:44 |
| Copy (2) of TX_intro=leg.doc Path: Texas >> I >> 382 Fall, 2009 Description: 1 INF382M GovernmentInformation Fall2004 Doty TEXASSTATEGOVERNMENT: INTRODUCTIONANDLEGISLATIVEINFORMATION AswedidwithU.S.governmentinformation,wewillusethetripartitestructureofgovernmenttohelpus considersourcesofinformationbyandaboutTexasstategover... Date Added: 2009-06-24 13:05:45 |
| YJR158W.t2k.w0.5-logo.pdf Path: UC Santa Cruz >> YJR >> 158 Fall, 2009 Description: YJR158W.t2k w0.5 4 3 2 1 D E E X 1 10 20 30 40 H 4 3 2 1 L R H XXX L S 51 60 70 80 90 H 4 3 2 1 L Y T N T H L LL L LL SAF IG AL PIF IAERIS KY I F TLY V IFAA V L VA S V A F G XXXXXXXXXXXXXXXXVXXXXXXXXXXXXXXXXXXXX X N I V D H G I V ... Date Added: 2009-06-24 13:08:32 |
| L21.ppt Path: SMU - Cox School of Business >> CSE >> 3360 Fall, 2009 Description: Kramers (a.k.a Cramers) Rule Component j of x = A-1b is aij det B j x j = det , B j = A a n1 a a 12 ba 1 n2 b n ann 1n Form Bj by replacing column j of A with b. Total Unimodularity A square, integer matrix B is unimodular (UM... Date Added: 2009-06-24 13:12:34 |
| YLR248W.t2k.CB_burial_14_7-logo.pdf Path: UC Santa Cruz >> YLR >> 248 Fall, 2009 Description: YLR248W.t2k CB_BURIAL_14_7 3 2 1 AAAAAA C CC C X A BBBBBBBBBBBBBBBBB BBBBBBB BBBB BBBBBBB B B BCBBBBAAAAAACBBAAAABBAAAAAAAAAAAAAAAAAAAAAAAAAAAAA C C C CCCC D D D D AAA D D D D D D D D D D D D D D D D D D D D D D D D D D D D D D D D D D D D X X X ... Date Added: 2009-06-24 13:14:24 |
| YNL026W.t2k.w0.5-logo.pdf Path: UC Santa Cruz >> YNL >> 026 Fall, 2009 Description: YNL026W.t2k w0.5 4 3 2 1 F Y L M V T I A XXXXXXXXXXX N V P P I E L V D E N I D H E N K A T K L X XXXXXXXXXXXXXXXXX V T L V I T I D V L L L F V I A D A K V S N A S R R P V N F G E K V VV I XX X Y I AND L L E R X XX R S D T IE ... Date Added: 2009-06-24 13:16:07 |
| math239quiz1soln.pdf Path: Drexel >> MATH >> 239 Fall, 2009 Description: ... Date Added: 2009-06-24 13:17:06 |
| sgf00z.txt Path: University of Illinois, Urbana Champaign >> ATMOS >> 20081211 Fall, 2009 Description: UPPER AIR CALCULATIONS AND PLOTTING (Ver 5.48.1-LINUX-X11) Current filename: /mnt/noaaport/nwstg/convert/08121112_upa.wxp Date: 1200Z 11 DEC 08 Searching for KSGF. Searching the city database file for: KSGF . Date:1200Z 11 DEC 08 Station: KSGF... Date Added: 2009-06-24 13:18:35 |
| exam1.pdf Path: UNL >> STAT >> 883 Fall, 2008 Description: February, 14, 2006 STAT 883 EXAM1 Name: Solution 1. (10 pt) Let X Binomial(n, p). One observation on X is available, and it is known that n is either 2 or 3 and p = 1/2 or 1/3. Based on the following table of distribution, derive the maximum like... Date Added: 2009-06-24 13:18:50 |
| hwsol8.pdf Path: UNL >> STAT >> 883 Fall, 2008 Description: STAT883: HW8-Solution 9.34. Spring, 2006 a. A 1 - confidence interval for is { - 1.96/ n x + 1.96/ n}. We need 2(1.96)/ n x /4. Thus we need n 245.9. So n = 246 suffices. b. The length of a 95% confidence interval is 2tn-1,1-0.025 S/ n.... Date Added: 2009-06-24 13:18:54 |
| beta.pdf Path: Iowa State >> STAT >> 401 Fall, 2008 Description: 86 Student\'s I-Distribution NUMBER O F OBSERVATIONS FOR 1-TEST O F MEAN Singleeided test Doubleeided test a a - 0.005 00 .1 a a - Level of f-test 00 .1 0.02 a a - 005 .2 0.05 a a - 0.05 01 . 0.80 0.85 Value of ow 0% 1.00 1.1 1... Date Added: 2009-06-24 13:19:56 |
| YKL096W-A.t2k.stride-ebghtl-logo.pdf Path: UC Santa Cruz >> YKL >> 096 Fall, 2009 Description: YKL096W-A.t2k EBGHTL 3 2 1 CC TH T C C C H C H H H X X X X X X X H HH H XXXXXXXXXXX 10 20 30 40 H 3 2 1 E E X T E T E T TTE CCT C X X 51 60 70 80 E T E H H 90 E CC TTCC EH HHHH TCCCTTTCCTEE C SSTVETVSPSSTETISQQTENGAAKAAVGMG... Date Added: 2009-06-24 13:26:03 |
| YKL047W.t2k.CB_burial_14_7-logo.pdf Path: UC Santa Cruz >> YKL >> 047 Fall, 2009 Description: YKL047W.t2k CB_BURIAL_14_7 2 1 AAAAAAA X A B BBB B BCBBCBCAC X X X X X X X X BB AB FDE B E C BA BBBDDEFG A D A B B F A E F E B C E F B A F E D E D CDCCDCDCDCCCCXXBFXCXDCCCCCCXBDDEXEEDCDBECCXXEGDEDC EDDGEXXDDD B D D D D D D D D G D D D D D D D D X ... Date Added: 2009-06-24 13:26:53 |
| Facade Pattern Presentation.ppt Path: UMKC >> CS >> 590 Fall, 2009 Description: Faade Pattern Jeff Schott CS590L Spring 2004 What is a faade? 1) The principal face or front of a building 2) A false, superficial, or artificial appearance What is the intent? s s Provide a unified interface to a set of interfaces in a subsystem... Date Added: 2009-06-24 13:27:22 |
| uwaexam.pdf Path: Allan Hancock College >> MATHS >> 2030 Fall, 2009 Description: The uwaexam class Greg Gamble Version 1.00, 2007/04/23 Contents 1 2 Introduction . . . . . . . . . . . . . . . . . . . . . . . . . . . . Implementation . . . . . . . . . . . . . . . . . . . . . . . . . . 2.1 Options . . . . . . . . . . . . . . . . . ... Date Added: 2009-06-24 13:32:15 |
| zProblems08.pdf Path: Allan Hancock College >> MATHS >> 2030 Fall, 2009 Description: Family Name (Block letters) Given Name Middle Name Student Number Math-2030, Calculus and Matrix Method, 2007 Assignment 8, Total 18 marks, Deadline : 2pm Thursday 10 May (a) Use this page as your cover sheet. Staple all your pages together at th... Date Added: 2009-06-24 13:32:25 |
| ReadMeFirst.Exp7.Part2.doc Path: Uni. Worcester >> PH >> 1120 Fall, 2008 Description: Worcester Polytechnic Institute PH 1120, Term B, 2007 Experiment #7: The Magnetic Field ReadMeFirst, Experiment #7, The Magnetic Field (experimental), Part 2: You are now going to use the Vernier equipment to measure the magnetic field created by a 0... Date Added: 2009-06-24 13:33:34 |
| PSY130chap1.pdf Path: North Central State College >> PSY >> 130 Fall, 2009 Description: Human Development Tenth Edition The Study of Human Development Chapter 1 Diane E. Papalia Sally Wendkos Olds Ruth Duskin Feldman Early Approaches: Baby Biographies Biographers Observed Own Children 19th Century Trends Medicine & Science Discovery... Date Added: 2009-06-24 13:37:37 |
| 37-Python-Basics.pdf Path: Stanford >> CS >> 106 Fall, 2009 Description: CS106X Spring 2009 Handout 37 Python Basics June 1, 2009 The Crash Course If you choose, you can hold a conversation with the Python interpreter, where you speak in expressions and it replies with evaluations. The first block of code here illustr... Date Added: 2009-06-24 13:39:40 |
| AJHG-WangQ.pdf Path: Case Western >> JXL >> 175 Fall, 2009 Description: ARTICLE An LRP8 Variant Is Associated with Familial and Premature Coronary Artery Disease and Myocardial Infarction Gong-Qing Shen, Lin Li, Domenico Girelli, Sara B. Seidelmann, Shaoqi Rao, Chun Fan, Jeong Euy Park, Quansheng Xi, Jing Li, Ying Hu, Ol... Date Added: 2009-06-24 13:41:14 |
| AP- bio.pdf Path: CSU Northridge >> AP >> 7481 Fall, 2009 Description: AP Biology 2006 Free-Response Questions The College Board: Connecting Students to College Success The College Board is a not-for-profit membership association whose mission is to connect students to college success and opportunity. Founded in 1900, ... Date Added: 2009-06-24 13:44:10 |
| README.txt Path: Penn State >> TRAC >> 2541 Fall, 2009 Description: <!DOCTYPE html PUBLIC \"-/W3C/DTD XHTML 1.0 Strict/EN\" \"http:/www.w3.org/TR/xhtml1/DTD/xhtml1-strict.dtd\"> <html xmlns=\"http:/www.w3.org/1999/xhtml\"> <head> <title> Changeset 2541 for weblion/releases/README.txt WebL... Date Added: 2009-06-24 13:46:35 |
| Chapter03.pdf Path: Glendale Community College >> CHM >> 130 Fall, 2008 Description: CHAPTER 3: THE METRIC SYSTEM Problems: 1-4, 5(a,c), 6(b,c), 7(a,c), 8(b,d), 9(a,b), 10(b,d), 11(a,c,d), 12c, 13(b,c), 14(a,d), 15(a-c), 16c, 17b, 18b, 20-33, 34a, 37-38, 41-57, 67-73, 75-78, 83-84 3.1 Basic Units and Symbols metric system: A unifi... Date Added: 2009-06-24 13:46:40 |
| 11liq.pdf Path: Glendale Community College >> CHM >> 151 Fall, 2008 Description: Chapter 11. Liquids have strong intermolecular forces low compressibility & have definite volume, but no definite shape relatively high densities Particles have random motion in all 3 dire... Date Added: 2009-06-24 13:47:15 |
| exam2f02.pdf Path: Lake County >> ECE >> 390 Fall, 2009 Description: ECE 291 M. C. Loui 1. (24 pts) _ 2. (30 pts) _ 3. (30 pts) _ 4. (38 pts) _ 5. (28 pts) _ EXAMINATION #2 Tuesday, 12 November 2002 10:30 to 11:50 a.m. Name: _ This examination has five problems, each with approximate points indicated. The maximum p... Date Added: 2009-06-24 13:48:39 |
| ECE450_HW10_SOLN.pdf Path: Lake County >> ECE >> 450 Fall, 2009 Description: ECE 450: Spring 2009 ECE 450 HW # 10 Solution Problem 1 Homework Set 10 Due on Friday, Apr 17, 2009 Consider a Hertzian dipole of length 0.005 operating in air at the frequency of 1.0 GHz with input current I0 = 10.0 A. A measurement is conducted a... Date Added: 2009-06-24 13:49:25 |
| hw-5-ece561.pdf Path: Lake County >> ECE >> 561 Fall, 2009 Description: ECE 561: Detection and Estimation Theory Spring 2009 Issued: April 27, 2009 April 27, 2009 1) Find the variance of the MVUE for and 2 and the following Gaussian problem: Y = S + N, where S is a known vector, and N is a Gaussian vector with zero m... Date Added: 2009-06-24 13:49:41 |
| project14_design_review.pdf Path: Lake County >> ECE >> 445 Fall, 2009 Description: 1of11 IntelliCRUISE IntelligentGPSbased CruiseControlSystem DesignReview February21,2007 LawrenceHan SundeepKartan RogerSerwy 2of11 Introduction Title:IntelliCRUISEIntelligentGPSbasedCruiseControlSystem Thisprojectoffersanewdriverexperiencebybring... Date Added: 2009-06-24 13:49:58 |
| hw9_spr2003.pdf Path: Lake County >> ECE >> 403 Fall, 2009 Description: ... Date Added: 2009-06-24 13:51:04 |
| 137a_hw3_sol.pdf Path: UCSB >> ECE >> 137 Fall, 2009 Description: *. Note that Rleq < Rce so Rin,emitter ~= re + Rb/beta ... Date Added: 2009-06-24 14:01:04 |
| D7SDCA.pdf Path: UCSB >> ECE >> 152 Fall, 2009 Description: Distributed by: www.Jameco.com 1-800-831-4242 The content and copyrights of the attached material are the property of its owner. Jameco Part Number 24715 Jameco Part number 24715 ... Date Added: 2009-06-24 14:04:03 |
| art223_224_materials_list.pdf Path: Kellogg CC >> ART >> 224 Fall, 2009 Description: Materials List Supplies, film processing, or digital printing fees may be required. This supply list will be distributed during the first class. The following list of supplies will get you started. Some supplies will need to be repurchased as needed ... Date Added: 2009-06-24 14:06:13 |
| TimB_BnWnite.pdf Path: Harford CC >> PHOTO >> 230 Fall, 2009 Description: Black and White Night Tim Browning path leading to darkness barb-wired fence protected structure boatyard get in the car slow night where to go stop and think closing time its over Good Night ... Date Added: 2009-06-24 14:07:58 |
| final_port_art120_f08.pdf Path: Harford CC >> ART >> 120 Fall, 2009 Description: ART 120 DUE: | D I G I TA L F O U N D AT I O N S O N E | Fa l l 2 0 0 8 | P r o f. J O N E S MORNING CLASS 10 AM / AFTERNOON CLASS 12 NOON MONDAY, DECEMBER 15th PORTFOLIOS WILL BE SHARED WITH THE REST OF THE CLASS. NO PORTFOLIOS ACCEPTED A... Date Added: 2009-06-24 14:08:50 |
| H193 W08 D02 LECT - Ind Competition 04.ppt Path: Ohio State >> EG >> 193 Fall, 2009 Description: Engineering H193 - Team Project Individual Competition Week 8 Day 2 Spring Quarter Gateway Engineering Education Coalition P. 1 Engineering H193 - Team Project Procedure Each Robot will get three runs each run will be scored according to the... Date Added: 2009-06-24 14:10:10 |
| ww73.doc Path: Clemson >> ECE >> 496 Fall, 2009 Description: Group B Abstract: This week was competition day and we spent most of our time implementing different balance controls. Summary: This week we implemented probably a dozen variations of balance control. The addition of a laser pointer and wood box cove... Date Added: 2009-06-24 14:14:09 |
| T0331.t06.o_notor2-logo.pdf Path: UC Santa Cruz >> T >> 0331 Fall, 2009 Description: T0331.t06 o_notor2 4 3 2 1 N X 1 10 20 30 40 NH 4 3 2 1 N B NG N B N H HH M NXNNGHN N X X X M X M M G G S 51 60 70 80 90 GN 4 3 2 1 B AB NGN B ABANB NAN MH GN GH H NN GH XG X N X N X N XNGNN N X NNPNPA N A NA H H... Date Added: 2009-06-24 14:14:44 |
| 121_proj2.pdf Path: Glendale CC >> PHOTO >> 121 Fall, 2009 Description: Photo 121 Project 2: Layout with Typography This project is our first exercise in using Photoshop for commercial art purposes. You are going to design a piece of gr aphic ar t w ith the understanding that you are go ing to receive direction, and hav ... Date Added: 2009-06-24 14:15:36 |
| notes_mth414_020509.pdf Path: Oakland University >> MTH >> 414 Winter, 2008 Description: ... Date Added: 2009-06-24 14:26:27 |
| ws2002e1.pdf Path: Maryville MO >> STAT >> 150 Fall, 2009 Description: Statistics 150: Introduction to Statistics I Exam 1 - Ch. 1, 2, 3, 4 Winter 2002 (Sec. 1) Name: Directions: This exam contains seven problems worth a total of 100 points. For each computational problem, you must rst write the formula to be used and... Date Added: 2009-06-24 14:30:42 |
| hw0.ps Path: University of Illinois, Urbana Champaign >> CS >> 473 Fall, 2008 Description: %!PS-Adobe-2.0 %Creator: dvips(k) 5.92b Copyright 2002 Radical Eye Software %Title: hw0.dvi %Pages: 2 %PageOrder: Ascend %BoundingBox: 0 0 612 792 %DocumentFonts: CMBX10 CMBX12 CMR12 CMR17 CMSY10 CMR10 CMBXTI10 CMTI10 %+ CMMI10 CMR7 CMSY7 CMR5 CMMI5 ... Date Added: 2009-06-24 14:31:51 |
| quiz7f08.pdf Path: Oakland University >> MTH >> 154 Fall, 2008 Description: Name: Student #: MTH 154 - Quiz # 7 FALL 2008 This quiz is due at the beginning of class on Friday, November 7, 2008. Clearly show all work in each problem. Correct answers with insucient work will receive NO credit. Please attach extra paper if nece... Date Added: 2009-06-24 14:35:11 |
| INT_position_announcement_2.pdf Path: Berkeley >> ATT >> 0207 Fall, 2009 Description: EASTERN ILLINOIS UNIVERSITY SCHOOL OF TECHNOLOGY POSITION ANNOUNCEMENT Position: Industrial Technology Digital Printing & Imaging Tenure-track Assistant Professor Teach courses in the areas of Graphics Communication, Digital Media, Print Production,... Date Added: 2009-06-24 14:37:37 |
| Quiz5wAns.pdf Path: Oakland University >> MTH >> 154 Fall, 2008 Description: M TH 15 4 Qu i z # 5 N am e T h i s q u i z i s d u e a t t h e b e g i n n i n g o f c la s s o n M o n d a y , J u ly 3 1 , 2 0 0 6 . N o t e : S h o w a ll o f y o u r w o r k . U n s u p p o r t e d w o r k w i ll r e c e i v e n o c r e d i t ... Date Added: 2009-06-24 14:38:20 |
| 2005112_f01c_Paskowitz.pdf Path: Stanford >> MOTV >> 1035 Fall, 2009 Description: UNITED STATES DISTRICT COURT WESTERN DISTRICT OF TEXA S Austin Divisio n LAURENCE PASKOWITZ, on Behalf of Himself ) and All Others Similarly Situated, ) Case No . Plaintiff, v. ) ) ) MOTIVE, INC ., SCOTT L . HARMON, ) PAUL M . BAKER, ) Defendants .... Date Added: 2009-06-24 14:39:54 |
| 1131 Syllabus.pdf Path: UConn >> MATH >> 1131 Fall, 2009 Description: Math 1131Q Instructor: Gabriel Feinberg e-mail: Feinberg@math.uconn.edu Office: MSB 119 Office hours: Wednesday, 12:30 2:30 Q-center hours, TBA plus by appointment Calculus 1 Spring 2009 Text: Calculus, Early Transcendentals, Volume 1 by James St... Date Added: 2009-06-24 14:39:54 |
| GIS Remote Sensing Analyst.doc Path: JMU >> ARCHIVE >> 0408 Fall, 2009 Description: Employment Opportunity for Any Qualified Applicant Information Technology Specialist II - Remote Sensing/GIS Analyst Position #00331 Charlottesville, Virginia Hiring Range: $35,695 - $40,000 (Pay Band 4) Duties: The Department of Forestry is seekin... Date Added: 2009-06-24 14:42:37 |
| Tribal Historic Preservation Office.doc Path: JMU >> ARCHIVE >> 0408 Fall, 2009 Description: Tribal Historic Preservation Office GIS SPECIALIST Seminole Tribe of Florida Ah-Tah-Thi-Ki Museum, Big Cypress Seminole Reservation, Florida The position has changed drastically since the Tribal Historic Preservation Office advertised for a \"GIS Spe... Date Added: 2009-06-24 14:42:51 |
| Kawano.pdf Path: Stanford >> ERE >> 1989 Fall, 2009 Description: PROCEEDINGS,Fourteenth Workshop on Geothemal Reservoir Engineering Stanford university, Stanford, CaUornia, January 24-26,1989 S GP-TR-m NEDOS PROJECT ON GEOTHERMAL RESERVOIR ENGINEERING: A RESERVOIR ENGINEERING STUDY OF THE S UMIKAWA GEOTHERMAL FIE... Date Added: 2009-06-24 14:43:12 |
| mid04.pdf Path: Uni. Worcester >> CS >> 4731 Fall, 2008 Description: CS 4731 A 04 Midterm Exam Name: Instructions: Read questions carefully before answering. Do not hesitate to ask for clarifications. Show all work. Partial credits are given, so do not leave anything blank! Use the back of the pages for extra paper ... Date Added: 2009-06-24 14:47:29 |
| term_test_01_2009_solutions.pdf Path: University of Toronto >> ECE >> 334 Fall, 2009 Description: ... Date Added: 2009-06-24 14:48:53 |
| Syllabus2006_summer.doc Path: USC >> BIO >> 478 Fall, 2009 Description: BISC 478 : Computational Genome Analysis, Summer 2006 Time: 9:30 10:50 am and 2:00-3:20, TTh, Room: MCB301 Instructors Professor Michael Waterman Phone: (213)740-2408 Email: msw@usc.edu Professor Fengzhu Sun Phone: (213)740-2413 Email: fsun@usc.edu ... Date Added: 2009-06-24 14:51:39 |
| culturaltourisminpotosibolivia.pdf Path: University of Hawaii - Hilo >> GEOG >> 494 Fall, 2008 Description: Tourism and indigenous discourse in South America Case study of mining tourism in Potos, Bolivia Tourism a vehicle for an indigenous Quechua discourse: o An act of resistance helping to invert the prevailing social order o Restoration of Quechua c... Date Added: 2009-06-24 14:52:26 |
| abortion3.pdf Path: Sterling KS >> NRSG >> 835 Fall, 2009 Description: ... Date Added: 2009-06-24 14:57:08 |
| T0494.t06.CB_burial_14_7-logo.pdf Path: UC Santa Cruz >> T >> 0494 Fall, 2009 Description: T0494.t06 CB_burial_14_7 3 2 1 MHHHHHHSSGVDLGTENLYFQSMSSHKKERKVYNDGYDDDNYDYIVKNGEKWMDRYEIDSLIGKGSFGQVVKAYDRVEQEWVAIKIIKNKKAFLNQAQIE 1 10 20 30 40 50 60 70 80 90 A 3 2 1 DA A BD A D ABDBDBA E BD FD FEDEDBA BDF EBA ABE DF VRLLELMNKHDTEMKYYIVHL... Date Added: 2009-06-24 14:57:16 |
| hw2new2.pdf Path: Lake County >> ECE >> 398 Fall, 2009 Description: ECE398SB, Fall 2005 Issued: October 20th, Thursday Problem Set #2 Due: November 1rst 1 Scattering from Homogenous Scatterers (15 points) As light travels along a ray path it Figure 1: tissue attenuation is attenuated by absorption and scattering.... Date Added: 2009-06-24 14:58:33 |
| qseven.pdf Path: Wisconsin Milwaukee >> IE >> 360 Fall, 2009 Description: Ind Eng 360 Quiz # 7 Name: _ Problem # 1 A machine to make parts is purchased by a company. First cost is $80,000 and this machine will be used for six years. After that it will be sold for $5,000. MACRS method for depreciation with a recovery per... Date Added: 2009-06-24 15:01:55 |
| Syllabus - Winter 2005.pdf Path: Cal Poly Pomona >> ENGLISH >> 105 Fall, 2009 Description: English 105 Freshman Composition II MWF 2:15 3:20; Bldg. 5, Room 126 Winter 2005 Introduction English 105 is intended to continue the development of critical thinking skills through reading and writing that was begun in English 104. The notable dif... Date Added: 2009-06-24 15:02:18 |
| hwk3.pdf Path: Colorado State >> ECE >> 412 Fall, 2008 Description: EE412 - Digital Control and Digital Filters Homework #3 Reading: Sections 4.1-4.6, 4.8-4.12, and Chapters 5, 6. Questions: Do the following questions from the text: 4.13, 5.13, 6.1, 6.7, 6.8, 6.15 Note the MATLAB commands: tf, ss, zpk, tfdata, ssda... Date Added: 2009-06-24 15:02:45 |
| sp1997he2.pdf Path: Lake County >> ECE >> 431 Fall, 2009 Description: ... Date Added: 2009-06-24 15:06:48 |
| hw11.pdf Path: Lake County >> ECE >> 441 Fall, 2009 Description: ECE 441 (Spring 2009) HW #11 Due: Friday, April 24th, 2009 1. Muller Kamins 8.11. 3. See next page. 1 2 ... Date Added: 2009-06-24 15:12:00 |
| lect24small.pdf Path: Maryland >> CMSC >> 212 Fall, 2005 Description: Computer Systems G Computers have many different devices I/O Devices Memory volatile storage Processor(s) Processor Memory Mem. Controller Memory Bus I/O Bus Controller I/O Bus SCSI Adapter SCSI Bus Network Display Adapter Network Adapter Syste... Date Added: 2009-06-24 15:14:25 |
| Exam_I.pdf Path: Lake County >> ECE >> 461 Fall, 2009 Description: University of Illinois First Mid-Semester Exam Page 1 of 3 ECE 361 Fall 1998 Thursday, October 15, 1998 1:30 p.m. 2:50 p.m. 260 Everitt Laboratory Instructions: This exam has three pages including this cover page. There are four problems on the n... Date Added: 2009-06-24 15:17:19 |
| hw3_sol.pdf Path: Lake County >> ECE >> 483 Fall, 2009 Description: ... Date Added: 2009-06-24 15:22:35 |
| lab2.pdf Path: NSCC >> CHE >> 101 Fall, 2009 Description: Chemistry 101 Lab 2: Types of Reactions Objectives: 1. Observe changes in chemical and physical properties during a variety of chemical reactions 2. Write balanced chemical equations for all reactions carried out 3. Identify type of reaction carried ... Date Added: 2009-06-24 15:26:09 |
| ex6.pdf Path: NSCC >> ASTR >> 100 Fall, 2009 Description: Astronomy 100 Name(s): Exercise 6: Spectroscopy How do astronomers know anything about parts of the solar system and universe that we (humans or the probes we send) have never physically touched? The answer lies in the light that is emitted or refl... Date Added: 2009-06-24 15:26:15 |
| Changing_index.pdf Path: SUNY Stony Brook >> MAT >> 127 Summer, 2008 Description: 1 Show that f (x) = n=0 (1)n x2n (2n)! is a solution of f + f = 0. Solution. Write f (x) = n=0 2n(1)n x2n1 (2n)! f (x) = n=0 2n(2n 1)(1)n x2n2 = (2n)! n=0 2n(2n 1)(1)n x2(n1) (2n)! Notice that we can begin the above sum by n = 1 since... Date Added: 2009-06-24 15:30:53 |
| rev1.ps Path: Colorado >> AMATH >> 4120 Fall, 2009 Description: %!PS-Adobe-2.0 %Creator: dvips(k) 5.78 Copyright 1998 Radical Eye Software (www.radicaleye.com) %Title: rev1.dvi %Pages: 2 %PageOrder: Ascend %BoundingBox: 0 0 612 792 %EndComments %DVIPSCommandLine: dvips rev1.dvi %DVIPSParameters: dpi=600, compress... Date Added: 2009-06-24 15:32:24 |
| Cooke.pdf Path: SUNY Stony Brook >> AST >> 389 Fall, 2008 Description: Cooke 1 Anthony Cooke AST/EGL 389 Prof. Caputo Prof. Walter 2 May 2008 Vitality Tonight, on the History Channel The story of Lucy, the first upright hominid, and the clash, over four h undred billion years later, between the Neaderthals and modern Ho... Date Added: 2009-06-24 15:39:13 |
| explosions.pdf Path: SUNY Stony Brook >> AST >> 389 Fall, 2008 Description: When Stars Blow Up What Stars Explode? Cataclysmic variables Novae Supernovae Cataclysmic Variables Binary star systems incorporating a white dwarf Outbursts due to disk instabilities G K P er = N ova P er 1 901 N ovae Thermonuclear detonations ... Date Added: 2009-06-24 15:39:17 |
| quiz6.pdf Path: University of Toronto >> MAT >> 187 Fall, 2009 Description: g % B \' 0 )Yyy tRt3I )Hy y tRt3Q g % B \' 0 PI~b S 4 SU E#rU wzovY9fqozHv )zEfEt EY)kyRysVYtq }f { | C... Date Added: 2009-06-24 15:40:36 |
| presentation.ppt Path: Berkeley >> CS >> 160 Fall, 1931 Description: NotePals ][ Interactive Prototype #1 Chris Hostetter Davina Armstrong Harry Hsu Mike Migurski Tyler Daniel 10/5/98 NotePals ][ - Interactive Prototype # 1 1 Overview What is NotePals ][? Problem statement Tasks/Demo User Interface design 10/5/9... Date Added: 2009-06-24 15:41:55 |
| rev3_05.pdf Path: CUNY Baruch >> MAT >> 231 Fall, 2009 Description: Math 231 Final Review Sheet, 12/11/2005 Here is a list of the topics that may be on the nal exam. Make sure you know enough about each item. Solving systems of linear equations by Gaussian elimination; reducing a matrix to row-echelon form. Additio... Date Added: 2009-06-24 15:42:27 |
| MAT151-DL-Schedule-086.pdf Path: Glendale Community College >> MAT >> 151 Fall, 2008 Description: MAT 151 College Algebra (Online) Fall 2008 Tentative Course Schedule Date Week 1 8/25 8/31 Week 2 9/1 9/7 Week 3 9/8 9/14 Week 4 9/15 9/21 Week 5 9/22 9/28 Week 6 9/29 10/5 Week 7 10/6 10/12 Week 8 10/13 10/19 Week 9 10/20 10/26 Sections O... Date Added: 2009-06-24 15:45:08 |
| proj_summary_final.pdf Path: Georgia Tech >> ECE >> 4007 Fall, 2008 Description: ECE4007 Project Summary Project Title Team Members (names and majors) Fall Detection Nicholas Chan (EE) Abhishek Chandrasekhar (EE) Hahnming Lee (EE) Akshay Patel (CMPE) Advisor / Section Semester Project Abstract (250-300 words) Professor Koblasz ... Date Added: 2009-06-24 15:45:16 |
| YJL077W-B.t2k.w0.5-logo.pdf Path: UC Santa Cruz >> YJL >> 077 Fall, 2009 Description: YJL077W-B.t2k w0.5 2 1 M L V I I IC PLLVL LP L L YRL FREFFDRVE V V X XXX XX XXXXXXXXX XXXXXXXXXXXXX F Y V I A W X X L I V I I V Q X F L V V K K K K K T S I I X A V L L Y I V L L Y Y E I I V V L I T 1 10 20 E T T H E H 30 MP... Date Added: 2009-06-24 16:04:36 |
| word family instruction.doc Path: Western Michigan >> SPED >> 534 Fall, 2009 Description: Strategy: Appropriate Grade Level: Procedures/Steps: Comments and/or tips: Source: Wanzek, J. & Haager, D. (2003). Teaching word recognition with blending and analogizing: Two strategies are better than one. Teaching Exceptional Children, 36, 32-8.... Date Added: 2009-06-24 16:05:14 |
| ps7sol.pdf Path: SUNY Stony Brook >> MAT >> 530 Fall, 2008 Description: MAT 530: Topology&Geometry, I Fall 2005 Problem Set 7 Solution to Problem p271, #10 Uniqueness-of-Completion Theorem: Let (X, d) be metric space. Suppose (Y, D) and (Y , D ) are complete metric space such that X Y, Y , ClY X = Y, ClY X = Y , D|X X =... Date Added: 2009-06-24 16:06:48 |
| midterm.pdf Path: SUNY Stony Brook >> MAT >> 530 Fall, 2008 Description: Topology MAT 530 Midterm Part 1: Theoretical questions. (Provide complete proofs) 1. Prove that the unit segment [0, 1] R is compact. 2. Prove that any compact Hausdor space is regular. Part 2: Quiz. (Give answers without proofs) 1. Is every metric ... Date Added: 2009-06-24 16:06:53 |
| T0405.t2k.near-backbone-11-logo.pdf Path: UC Santa Cruz >> T >> 0405 Fall, 2009 Description: T0405.t2k near-backbone-11 3 2 1 1 10 20 30 40 A 3 2 1 G DG GJ G AD GAD GA BAD D G G GJG GJG GID 51 60 70 80 90 GAIBA 3 2 1 GDADGDGIGDIG G DGAG DIGI GABA GADG D 101 110 120 130 140 IDAG 3 2 1 DA G DGI DGI G... Date Added: 2009-06-24 16:09:36 |
| Zhang.ppt Path: UF >> EIN >> 6918 Fall, 2008 Description: Approximation Algorithms for Facility Location Problems Jiawei Zhang Stanford University Based on Joint Work with Advisor: Yinyu Ye (Stanford Univ.) Facility Location: Mohammad Mahdian (MIT) Semidefinite Programming: Kasturi Varadarajan (Univ. of Io... Date Added: 2009-06-24 16:11:00 |
| ES110_S07_energy_debate.doc Path: Allegheny >> ES >> 110 Fall, 2008 Description: Environmental Science 110 Energy Debate: Introduction to Environmental Science Spring 2007 Recently, PA Gov. Ed Rendell released a new energy plan for Pennsylvania. Some see this as a giant stride forward, some see it as far too little, and some v... Date Added: 2009-06-24 16:12:09 |
| 6 - More_Ideas.pdf Path: East Los Angeles College >> CE >> 730 Fall, 2009 Description: Spatial Audio Coding: Using the Insights for Other Applications Christof Faller, christof.faller@ep.ch May 22, 2006 Beyond Spatial Audio Coding Contents: - Spatial Hearing Assumptions - Joint Source Coding - B-Format and Ambisonics - Conclusions S... Date Added: 2009-06-24 16:12:15 |
| java3.pdf Path: Harvey Mudd College >> CS >> 131 Fall, 2000 Description: The JavaTM Language Specification Third Edition The JavaTM Series The JavaTM Programming Language Ken Arnold, James Gosling and David Holmes ISBN 0-201-70433-1 The JavaTM Language Specification Third Edition James Gosling, Bill Joy, Guy Steele and G... Date Added: 2009-06-24 16:13:12 |
| polynomial fitting.doc Path: Albion >> CHEM >> 327 Spring, 2009 Description: Using Excel to fit polynomial functions (with error!) 1. Create a spreadsheet and place your y-data in one column. 2. In adjacent columns create as many columns as the order of the polynomial. These will be your x columns. 3. Fill the first x column ... Date Added: 2009-06-24 16:14:36 |
| T0411.dssp-ehl2-logo.pdf Path: UC Santa Cruz >> T >> 0411 Fall, 2009 Description: T0411 dssp-ehl2 2 1 1 10 20 30 40 H 2 1 E H E H E 2 1 H H E 101 110 120 H E H 130 GKRGGEAQKVASSHGYSNTSLYPGSMNDWVSHGGDKLDL 100 51 60 70 80 90 EYSIVHIPASINVPYRSHPDAFALDPLEFEKQIGIPKPDSAKELIFYCAS 50 MWKAVMNAWNGTESQSKNVSNIQS... Date Added: 2009-06-24 16:16:03 |
| T0411.t04.o_sep-logo.pdf Path: UC Santa Cruz >> T >> 0411 Fall, 2009 Description: T0411.t04 o_sep 4 3 2 1 10 20 30 40 D 4 3 2 1 H D GDA D BD GD 4 3 2 1 H BD GD A GD 101 110 120 H B HIGD AD H BHBGD 130 GKRGGEAQKVASSHGYSNTSLYPGSMNDWVSHGGDKLDL 100 51 60 70 80 90 EYSIVHIPASINVPYRSHPDAFALDPLEFEKQIGIPKP... Date Added: 2009-06-24 16:16:41 |
| TR92gas01.us.ps Path: Virginia Tech >> CS >> 5604 Fall, 1995 Description: %!PS (but not EPSF because of memory limits) %Creator: dvips by Radical Eye Software %Title: strings.us.dvi %Pages: 143 1 %BoundingBox: 0 0 612 842 %EndComments %BeginDocument: texc.pro /TeXDict 200 dict def TeXDict begin /bdf{bind def}def /@rigin{72... Date Added: 2009-06-24 16:16:57 |
| production.doc Path: Rutgers >> EDEN >> 558 Fall, 2009 Description: A 235 West 44th Street Organization Theatre Gerald Schoenfeld, Chairman mco \\mu ICST THEATRE Philip J. Smith, President Robert E. Wankel, Executive Vice President THE SHUBERT ORGANIZATION A Shubert ELIZABETH I. McCANN ROGER BERLIND JOHN GORE HIRS... Date Added: 2009-06-24 16:21:37 |
| 17-WirelessLANs.ppt Path: Texas San Antonio >> CS >> 3413 Fall, 2008 Description: William Stallings Data and Computer Communications 7th Edition Chapter 17 Wireless LANs Overview AwirelessLANuseswirelesstransmission medium Usedtohavehighprices,lowdatarates, occupationalsafetyconcerns,andlicensing requirements Problemshavebeena... Date Added: 2009-06-24 16:22:03 |
| cryopreservation.pdf Path: Cornell >> BEE >> 4530 Fall, 2009 Description: Cryopreservation of Umbilical Cord Tissue for Stem Cell Harvesting By Steven Buchwald, Nicole Chiu, Melvin Chu, Hesed Kim, Calvin Yeang BEE 453 5/2/03 Executive Summary Stem cell transplantation has become an important process used to treat patients ... Date Added: 2009-06-24 16:23:51 |
| EDLinCrack.txt Path: University of Illinois, Urbana Champaign >> ED >> 2143 Fall, 2009 Description: <!DOCTYPE html PUBLIC \"-/W3C/DTD XHTML 1.0 Strict/EN\" \"http:/www.w3.org/TR/xhtml1/DTD/xhtml1-strict.dtd\"> <html xmlns=\"http:/www.w3.org/1999/xhtml\" lang=\"en\" xml:lang=\"en\"> <head> <title>Changeset 2143 for meshing/trunk/physics/config/ED/EDL... Date Added: 2009-06-24 16:25:53 |
| hw1-cs667-f06.ps Path: NJIT >> CS >> 667 Fall, 2009 Description: %!PS-Adobe-2.0 %Creator: dvips(k) 5.86 Copyright 1999 Radical Eye Software %Title: hw1-cs667-f06.dvi %Pages: 3 %PageOrder: Ascend %BoundingBox: 0 0 612 792 %DocumentFonts: CMCSC10 CMR10 CMBX10 CMMI10 CMR7 CMMI7 CMSY10 CMSY7 %+ CMTT10 %EndComments %DV... Date Added: 2009-06-24 16:25:54 |
| chapter 6 class notes.pdf Path: Pima CC >> MAT >> 151 Fall, 2008 Description: Copyright 2004 Pearson Education, Inc. Chapter 6 Analytic Geometry Copyright 2004 Pearson Education, Inc. 6.1 Parabolas Copyright 2004 Pearson Education, Inc. Conic Sections Parabolas, circles, ellipses, and hyperbolas form a group of curves ... Date Added: 2009-06-24 16:31:48 |
| ae252hw5.pdf Path: University of Illinois, Urbana Champaign >> AE >> 252 Spring, 2008 Description: AE 252 AEROSPACE DYNAMICS I SPRING 2008 Homework #5 Due: Friday, February 22nd Instructions: Show detailed and legible work; partial credit will be given. If applicable, leave your final answer in its expanded form (i.e., dont factor equations). A... Date Added: 2009-06-24 16:35:28 |
| soln09.ps Path: Oakland University >> AME >> 437 Spring, 2009 Description: %!PS-Adobe-2.0 %Creator: dvipsk 5.58f Copyright 1986, 1994 Radical Eye Software %Title: soln09.dvi %Pages: 17 %PageOrder: Ascend %BoundingBox: 0 0 612 792 %DocumentPaperSizes: Letter %EndComments %DVIPSCommandLine: dvips -o soln09.ps soln09.dvi %DVIP... Date Added: 2009-06-24 16:39:07 |
| 621hw3.pdf Path: SUNY Albany >> AECO >> 621 Fall, 2009 Description: ECO621 Spring 2008 HOMEWORK SET #3 DUE February 21 1. K1, 19.1. 2. K1, 19.2. 3. K1, 19.7. 4. K1, 19.8. 5. Suppose the 2 1 vector ~ x N (0 ). Determine the distribution of ~1 + ~2. ; x x 1 ... Date Added: 2009-06-24 17:02:53 |
| NR 370 - Assignment 3.pdf Path: Wisc Stevens Point >> KOCON >> 370 Fall, 2009 Description: Rob King Kelli OConnor Jason Schiltz Section 1 Assignment 3 Thematic Unit I. Introduction to Thematic Unit and Lesson Plans Theme and Rationale: The environmental theme of our lesson plans is the seasonal changes associated with winter in Wisconsi... Date Added: 2009-06-24 17:03:43 |
| zhuang220.pdf Path: Georgia Tech >> CS >> 7001 Fall, 2008 Description: A Framework for Parallelizing Load/Stores on Embedded Processors Xiaotong Zhuang Georgia Institute of Technology College of Computing 801 Atlantic Drive Atlanta, GA, 30332-0280 xt2000@cc.gatech.edu Santosh Pande Georgia Institute of Technology Colleg... Date Added: 2009-06-24 17:06:14 |
| bauers_asgn1_result.rtf Path: UNC >> INLS >> 161 Fall, 2009 Description: ... Date Added: 2009-06-24 17:11:11 |
| exam2sol.pdf Path: Kent State >> MATH >> 61052 Fall, 2008 Description: MATH 6/71052 EXAM II Solutions 1. Let F L K be elds with [L : F ] nite. An element of K is algebraic over L if and only if is algebraic over F . Proof. If is algebraic over L, then has a minimal polynomial m,L (x) over L, and [L() : L] = deg m... Date Added: 2009-06-24 17:11:56 |
| page105.pdf Path: Kent State >> MATH >> 61052 Fall, 2008 Description: ... Date Added: 2009-06-24 17:12:22 |
| 07070718.pdf Path: Wisconsin >> TC >> 070707 Fall, 2009 Description: ... Date Added: 2009-06-24 17:22:43 |
| sh070707_engMaskCheck01.ps Path: Wisconsin >> TC >> 070707 Fall, 2009 Description: %!PS-Adobe-3.0 %Creator: MATLAB, The Mathworks, Inc. %Title: sh070707_engMaskCheck01.ps %CreationDate: 12/19/2007 16:41:12 %DocumentNeededFonts: Helvetica %DocumentProcessColors: Cyan Magenta Yellow Black %LanguageLevel: 2 %Pages: (atend) %BoundingBo... Date Added: 2009-06-24 17:22:47 |
| scan7036.pdf Path: San Diego State >> ART >> 344 Fall, 2008 Description: ... Date Added: 2009-06-24 17:23:18 |
| 3083.txt Path: UNC >> DOCS >> 3083 Fall, 2009 Description: The Project Gutenberg EBook of Original Short Stories of Maupassant, Volume 7, by Guy de Maupassant This eBook is for the use of anyone anywhere at no cost and with almost no restrictions whatsoever. You may copy it, give it away or re-use it under... Date Added: 2009-06-24 17:27:59 |
| 23693.txt Path: UNC >> DOCS >> 23693 Fall, 2009 Description: Project Gutenberg\'s The Blue Birds\' Winter Nest, by Lillian Elizabeth Roy This eBook is for the use of anyone anywhere at no cost and with almost no restrictions whatsoever. You may copy it, give it away or re-use it under the terms of the Project ... Date Added: 2009-06-24 17:29:15 |
| YAL019W-A.t2k.CB_burial_14_7-logo.pdf Path: UC Santa Cruz >> YAL >> 019 Fall, 2009 Description: YAL019W-A.t2k CB_BURIAL_14_7 2 1 A X 1 10 20 30 40 A 2 1 E C C E C EDEFDEDA DBDA DA DBD A D EB E X A A A AB A A A A A B B B B B B A B A B B A B B B A B C C C C D D D D D D D D D X XXXXXCXXXCXCXXXXXXXXXXXXXXCXCXXXCXX X X X X X X B E ... Date Added: 2009-06-24 17:32:39 |
| hw4.ps Path: Maryland >> CMSC >> 451 Fall, 2005 Description: %!PS-Adobe-2.0 %Creator: dvips(k) 5.86 Copyright 1999 Radical Eye Software %Title: hw4.dvi %Pages: 1 %PageOrder: Ascend %BoundingBox: 0 0 612 792 %EndComments %DVIPSWebPage: (www.radicaleye.com) %DVIPSCommandLine: dvips hw4.dvi %DVIPSParameters: dpi=... Date Added: 2009-06-24 17:36:22 |
| assign03.pdf Path: UNL >> MATH >> 826 Fall, 2009 Description: Math 826 Due: Wednesday, February 13th Assignment # 3 30 Jan 08 1. Given a function f : [a, b] R, of bounded variation, define, for x [a, b], and a sequence X = (x0 , . . . , x2n ) with a = x0 x1 x2n = x, n n f+ (x, X) = j=1 f (x2j ) - f... Date Added: 2009-06-24 17:36:56 |
| diagn34p.pdf Path: Iowa State >> STAT >> 557 Fall, 2008 Description: \\Average leverage\" Plots: # of parameters = 1 = :03 sample size 247 A \\large\" leverage value would be of parameters ! 2 # sample size = 2(:03) = :06? High leverage: hi > :5 in uence(i) vs. ^i in uence(i) vs. case number These plots indicate whether... Date Added: 2009-06-24 17:37:57 |
| mixed.xls Path: Emory >> PSYCH >> 560 Fall, 2008 Description: Example Wait-List Control a1 Half Post b2 b3 14 11 19 12 14.00 b1 b2 b3 b4 20 14 21 15 17.50 10.25 17.00 22.83 21.42 Outcome Pre b1 s1 s2 s3 s4 13 10 13 4 10.00 Pre Half Post FU FU b4 17 15 18 14 16.00 s5 s6 s7 s8 14.38 Attention-Placebo Control a... Date Added: 2009-06-24 17:38:20 |
| color_1e.pdf Path: San Diego State >> ART >> 496 Fall, 2008 Description: type as image sketching template For some, For some, ... Date Added: 2009-06-24 17:46:25 |
| Stanley_AI_No._39_Gayley_Rd_partial_lane_closure_6.12_thru_6.23.06.xls Path: Berkeley >> ATT >> 0281 Fall, 2009 Description: NOTIFICATION OF TEMPORARY ACCESS INTERRUPTION FACILITIES SERVICES - CAPITAL PROJECTS MUST BE SUBMITTED 11 DAYS IN ADVANCE A A II Date: June 7, 2006 To: Assistant Vice Chancellor CP - Project Management Access Int #: 39 Project Acct #: 12040A Phon... Date Added: 2009-06-24 17:46:28 |
| mid1f04_sol.pdf Path: Mich Tech >> GE >> 3850 Fall, 2008 Description: G E3850 M idterm1 October,2004frName 4 l. ( 15 p oints)T wo m easurementsf h eadh aveb eenm adei n a c onfineda quifera s o shown i n t he d rawing b elow. T he a quifer w idth i s 1 00 m ( into t he p age).T he volumetric f low r ate i s 1 0-\' m \'... Date Added: 2009-06-24 17:51:58 |
| f51mb_ref_2112_tab.txt Path: N.C. State >> CPLEX >> 090 Fall, 2009 Description: @file f51mb_ref_2112_tab.txt @date 2007-02-28-21-32-43 (Wed Feb 28 21:32:43 GMT 2007) @BeginTabular InstanceDir InstanceFile ProvedOptimal ObjectiveBest NumOnes RunTime Nodes Iterations CliqueCuts CoverCuts Timeout RunTimeIsInBound SolutionCoordina... Date Added: 2009-06-24 17:52:13 |
| 2009-lecture1.pdf Path: Minnesota >> BIOSCI >> 4521 Fall, 2009 Description: Review of basic concepts: work on these when you are seated Calculate the concentration in moles per liter of 10 milligrams of lactose (360 Da) in 0.5 milliliters. Answers Calculate the concentration of 10 milligrams of lactose (360 Da) in 0.5 milli... Date Added: 2009-06-24 18:11:39 |
| EUROPPHY.pdf Path: DePaul >> GEO >> 100 Fall, 2009 Description: 10W GREENLAND (Denmark) Jan Mayen (Norway) 0 10E 20E Hammerfest Tromso Narvik Bodo Lulea Kiruna NORTH CAPE 30E Vardo 40E Isafjordhur Akureyri Arct ICELAND Seydhisfjordhur ic Circle Reykjavik Ivalo EUROPE Physical Map 60 N Keflavik Rovan... Date Added: 2009-06-24 18:13:36 |
| OUTLINE exame 1 Port. 209[1] Path: Cornell >> PORT >> 2090 Fall, 2008 Description: OUTLINE -Portugus 209 - Seo 1 Exame 1 Ateno : Responder somente o nmero exato solicitado em cada seco. Se voc responder todas perguntas , todas vo ser corrigidas e voc pode e VAI PERDER mais pontos I . 10 pontos - PLURAL 1. o menino alto - Ateno... Date Added: 2009-06-25 15:15:16 |
| ch25.ppt Path: Winthrop >> ACCT >> 606 Spring, 2008 Description: Employee Benefits: IAS 19 Wiecek and Young IFRS Primer Chapter 25 Employee Benefits Related IAS standards 19 Current GAAP comparisons Looking ahead End-of-chapter practice 2 Related Standards HB 3461 Employee future benefits IFRS 2 S... Date Added: 2009-06-25 18:18:15 |
| Practical 2 (2003) - Equivocation & personality.ppt Path: East Los Angeles College >> JC >> 129 Fall, 2009 Description: Social Psychology Practical 02 Analysis of Equivocation (assessed) Jane Clarbour Christian von Wagner (2003) 1 Overview Overview The experiment is 2 scenarios Equivocation Additional The Situational theory of Communicative Conflict variab... Date Added: 2009-06-25 18:18:35 |
| equine.proximal.limb.05.pdf Path: Minnesota >> CVM >> 6101 Fall, 2008 Description: Equine Proximal Limb Normal Radiographic Normal Radiographic Anatomy Anatomy Oblique Views Explained Kari L. Anderson, DVM, DACVR Kari L. Anderson, DVM, DACVR College of Veterinary Medicine College of Veterinary Medicine University of Minnesota Uni... Date Added: 2009-06-25 18:18:39 |
| T0412.t04.dssp-ehl2-logo.pdf Path: UC Santa Cruz >> T >> 0412 Fall, 2009 Description: T0412.t04 dssp-ehl2 2 1 1 10 20 30 40 H 2 1 E E E E 2 1 H H H 101 110 120 130 140 E 2 1 E E H 151 160 H 170 KQNYDRYLELLLNGVQQLKKSDSFHQPI 150 MARIRQVREQGYASAEHIPFVGGGTICVLLPMTIQGQPVTMGLGGALDRI 100 51 60 70 80 90 VDE... Date Added: 2009-06-25 18:20:19 |
| Jannotti, Sam - Title and Contents.pdf Path: Penn State >> SMJ >> 167 Fall, 2009 Description: Sam Jannotti Structural Option The Pennsylvania StateUniversity M Kevin Parfitt Sam Jannotti American Eagle Outfitters Quantum III Pittsburgh, Pennsylvania Acknowledgements Completing this senior thesis could not have happened if it werent f... Date Added: 2009-06-25 18:24:53 |
| YIL071C.t2k.dssp-ebghstl-logo.pdf Path: UC Santa Cruz >> YIL >> 071 Fall, 2009 Description: YIL071C.t2k EBGHSTL 3 2 1 C C TSS S E B T STTHHHHH H E T X CCCCC S T H H X X H E H E C X X X X X X X X X X X XXXH H E C H E EE C C C H C E H H E H S C S X X X X X X X C T T X H HHXXXXXXTTX X X X X C C C H HHHHHHH H H H X X X E... Date Added: 2009-06-25 18:28:53 |
| YIL011W.t2k.w0.5-logo.pdf Path: UC Santa Cruz >> YIL >> 011 Fall, 2009 Description: YIL011W.t2k w0.5 5 4 3 2 1 M A L Y V L A I G T 1 10 20 30 40 H 5 4 3 2 1 N A H XX D 51 60 70 80 90 T 5 4 3 2 1 S H T E H T T H I TK LP L T S I G S S V S A XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX E Q A A F RL P I V M K... Date Added: 2009-06-25 18:29:36 |
| YIL061C.t2k.dssp-ebghstl-logo.pdf Path: UC Santa Cruz >> YIL >> 061 Fall, 2009 Description: YIL061C.t2k EBGHSTL 3 2 1 C EEE X X X X X E C E ECS SC C CCCTTESGSBSGGG GX E S X X S CC C HHH S T G B C X X X X 1 10 20 30 40 S T H T E T E S 3 2 1 SHHHHHHHHH C E X XXX G X X X X C E EC T S S C C S T H H H HHHHHHCCCCCCTT E S H... Date Added: 2009-06-25 18:29:52 |
| 05060602.pdf Path: Wisconsin >> SH >> 050606 Fall, 2009 Description: ... Date Added: 2009-06-25 18:33:07 |
| 2958.txt Path: UNC >> DOCS >> 2958 Fall, 2009 Description: The Project Gutenberg EBook of To Paris And Prison: Convent Affairs by Jacques Casanova de Seingalt This eBook is for the use of anyone anywhere at no cost and with almost no restrictions whatsoever. You may copy it, give it away or re-use it under... Date Added: 2009-06-25 18:35:14 |
| rum-icom4029-lec02.ppt Path: UPR Mayagüez >> ICOM >> 4029 Fall, 2009 Description: Overview of COOL ICOM4029 Lecture2 ICOM 4029 Fall 2008 Adapted from Prof. Necula UCB CS 164 1 Lecture Outline Cool TheCourseProject ProgrammingAssignment1 ICOM 4029 Fall 2008 Adapted from Prof. Necula UCB CS 164 2 Cool Overview ClassroomO... Date Added: 2009-06-25 18:35:43 |
| jcfln11.txt Path: UNC >> DOCS >> 2959 Fall, 2009 Description: The Project Gutenberg Etext of The False Nun, by Casanova #9 in our series by Jacques Casanova de Seingalt Copyright laws are changing all over the world. Be sure to check the copyright laws for your country before distributing this or any other Pro... Date Added: 2009-06-25 18:35:53 |
| MarchCastaliaFlyer-0001.pdf Path: Washington >> MAILMAN >> 20080304 Fall, 2009 Description: ... Date Added: 2009-06-25 18:43:59 |
| wave.ppt Path: St. Michael >> PY >> 103 Fall, 2009 Description: Wave Wave Longitudinal Wave Transverse Wave Difference between transverse and longitudinal wave: Transverse:The motion is perpendicular to the waves direction of travel Longitudinal: The motion is parallel to the waves direction of travel Period, ... Date Added: 2009-06-25 18:47:42 |
| asn3a.pdf Path: Minnesota >> STAT >> 5021 Fall, 2008 Description: Assignment 3 4.22 a. = xp(x) = 10(.05) + 20(.2) + 30(.3) + 40(.25) + 50(.1) + 60(.1) = .5 + 4 + 9 + 10 + 5 + 6 = 34.5 2 = (x ) 2 p (x ) = (10 34.5)2 (.05) + (20 34.5)2 (.2) + (30 34.5)2 (.3) + (40 34.5)2 (.25) + (50 34.5)2 (.1 = 30.0125 + 42... Date Added: 2009-06-25 18:51:20 |
| Lecture 08 - Standards.ppt Path: Citadel >> YUILLS >> 42101 Fall, 2009 Description: Lecture 8: Standards Adapted from a presentation by Dr. Thomas Jerse in Spring 2003 ELEC 422-41 Summer 2004 Read the Fine Print DECLARATION OF CONFORMITY Manufacturers Name: Manufacturers Address: Agilent Technologies, Inc. 1400 Fountaingrove Parkw... Date Added: 2009-06-25 18:54:57 |
| CH11EX3SOL.doc Path: W. Kentucky >> STA >> 205 Fall, 2009 Description: CHAPTER 11 EXERCISE 3 (CLASSES MISSED) SOLUTION Section 11.1 A. As students miss more classes, their final average in the course tends to decrease linearly. B. r = - 0.9009. This indicates a pretty strong negative linear relationship between final a... Date Added: 2009-06-25 18:55:42 |
| wk9.pdf Path: UF >> STAT >> 6934 Fall, 2009 Description: i | m m p { xq u3f wqu Vyq {3r rx t w r~ t { vx zyvuu wv ur yQhD 3SEh eh i5Q k h(t!7 BBeXX Y vuv ux k yQh 3SD q }v f3s Su }q qu Vt 9u uq sr t Vq D o (pn h ge i%vR Be F @hQe T FD AB Culh(e k ey @ Q U xA Stje 6 RD uEh X Q T R8 c Q f D e X F ... Date Added: 2009-06-25 18:59:21 |
| flashcards.doc Path: U. Houston >> CUIN >> 3111 Fall, 2008 Description: 3X+6=12 X=2 X=21 4(X+3)=96 11X-21=100 X=11 2X+3=3X+5 X= -2 X/0+2=10 UNDEFINED 2(4X+3)=70 X=8 ... Date Added: 2009-06-25 19:05:26 |
| 003107_1.pdf Path: Pittsburgh >> AEI >> 5708 Fall, 2009 Description: ... Date Added: 2009-06-25 19:06:54 |
| 000404_1.pdf Path: Pittsburgh >> AEI >> 3293 Fall, 2009 Description: COUNCIL OF THE EUROPEAN COMMUNITIES PRESS RELEASES PRESIDENCY: PORTUGAL JANUARY-JUNE 1992 Meetings and press releases January-February 1992 Meeting number Special meeting 1552nd 1553rd 1554th 1555th 1556th 1557th Subject General Affairs No record o... Date Added: 2009-06-25 19:09:34 |
| 000681_1.pdf Path: Pittsburgh >> AEI >> 3532 Fall, 2009 Description: ... Date Added: 2009-06-25 19:11:32 |
| Online_ThirdPlace_Questionnaire_CH.doc Path: University of Hawaii - Hilo >> COB >> 205 Fall, 2009 Description: Class (e.g., COB101 DC2, MARK304 D1/D2): _ I. Instant Messaging (IM) Information G : w jE o 6 D j : o m F : l (IM)I I (IM)I 1) QQ _ I I 2) MSN /I (IM)l 3) Skype 4) Yahoo Messenger G_F G_F (IM)I II. Social Support from Your Most Often Us... Date Added: 2009-06-25 19:13:21 |
| chem_510_solution_kinetics_II_winter_2006.pdf Path: Portland >> CHEM >> 510 Winter, 2009 Description: PORTLAND STATE UNIVERSITY DEPARTMENT OF CHEMISTRY WINTER 2006 CHEMISTRY 410/510: ADVANCED TOPICS IN PHYSICAL CHEMISTRY Course Title: Advanced Solution Chemical Kinetics Part II [Physical Chemistry Graduate Course: offered under the official PSU tit... Date Added: 2009-06-25 19:16:40 |
| revision.doc Path: Washington >> ENGLISH >> 105 Fall, 2009 Description: Pinker Revision Draft 1 English 105A 15 April 2004 Essay Author: _ Revised by: _ Note: You will be graded on your responses to the revision workshop. Each question should have a 2-3 sentence response. 1. Does the opening of this essay grab your atten... Date Added: 2009-06-25 19:23:24 |
| PS_1.pdf Path: Youngstown >> ECON >> 3790 Fall, 2008 Description: Problem Set #1 Econ 3790: Business and Economics Statistics, Summer 2009 Yogesh Uppal Due Date: May 21, 2009 1) ASW, p. 19, #5, (10 ed.) 2) ASW, p. 21, #11, (10 ed.) 3) ASW, p. 41, #15, (10 ed.) 4) ASW, p. 55, # 31, (10 ed.) 5) Consider a sample with... Date Added: 2009-06-25 19:25:48 |
| f04241e2outline.pdf Path: Clarkson >> CM >> 241 Fall, 2009 Description: CM 241 Organic Chemistry I Fall 2004 Date: 10/20/04 Time: 8:30pm Place: SC360 The points for each question are given in italics (total = 100; 10 questions). No calculators are allowed. Question 1. (4+4) Carbocation stability predict stability(ies) o... Date Added: 2009-06-25 19:26:01 |
| Article_Towards Spain Promised Land for Romanians.doc Path: Syracuse >> PSC >> 651 Spring, 2008 Description: http:/www.jurnalul.ro/articol_18836/catre_spania_pamantul_fagaduintei_romanilor.ht ml Article: Catre Spania, Pamantul Fagaduintei Romanilor (Towards Spain, Promised Land for Romanians) Summary: Monica is 35, married and has a 4 year old boy. She bega... Date Added: 2009-06-25 19:26:38 |
| Dorland (1996).pdf Path: Sveriges lantbruksuniversitet >> CMNS >> 428 Fall, 2009 Description: ... Date Added: 2009-06-25 19:38:58 |
| Targeted audience for workshop.doc Path: Sveriges lantbruksuniversitet >> CMNS >> 428 Fall, 2009 Description: Shawn Tan, Kieran Coffey and Kevin Koh Cmns 428 Final Project Targeted Audience Instr; Stuart Ponytz Targeted audience for workshop The media workshop will target children between the ages of 10 to 12. This article will discuss why it is felt that t... Date Added: 2009-06-25 19:39:58 |
| 03.04-CorticalSubplate.pdf Path: UCSD >> COGSCI >> 201 Fall, 2009 Description: 1990 Nature Publishing Group 1990 Nature Publishing Group 1990 Nature Publishing Group ... Date Added: 2009-06-25 19:40:17 |
| Outline16.doc Path: CSU San Marcos >> PSYC >> 391 Fall, 2009 Description: PSYC 391: Lab in Physiological Psychology Learning III Synaptic Plasticity 0. Hebbs Postulate (1949) if a synapse is active at the same time the postsynaptic neuron is active, that synapse will be strengthened o Long-term potentiation (LTP) 1. long-... Date Added: 2009-06-25 19:41:28 |
| lec13 ch08 stmts 080906.pdf Path: Western Michigan >> CS >> 4850 Fall, 2008 Description: Chapter 8 Statement-Level Control Structures Introduction Selection Statements Multi-way selection stmts Iterative Statements Unconditional Branching Guarded Commands Conclusions Copyright 2006 Pearson Addison-Wesley. All rights reserved. 6... Date Added: 2009-06-25 19:41:44 |
| final.pdf Path: Caltech >> MATH >> 120 Fall, 2009 Description: MATH 120C, FINAL DUE WEDNESDAY, JUNE 3, AT 5 PM. You may refer freely to your class notes, old homeworks, or Langs Algebra, but do not consult other references (including other humans.) Let A be an ID, K its quotient eld, L a nite Galois extension ... Date Added: 2009-06-25 19:45:17 |
| par_30_script21.txt Path: Stanford >> EDUC >> 39108 Fall, 2009 Description: ... Date Added: 2009-06-25 19:46:07 |
| Section1.3_9_22.pdf Path: Purdue >> EE >> 438 Fall, 2000 Description: 32 CHAPTER 1. ANALYSIS OF DISCRETE-TIME LINEAR TIME-INVARIANT SYSTEMS y 4 4 4 R4 4 4 4 4 z x Figure 1.18. A complex number z can be represented in Cartesian coordinates (x, y ) or polar coordinates (R, ). 1.3 Frequency Analysis 1.3.1 A Review... Date Added: 2009-06-25 19:49:02 |
| 26145-pdf.pdf Path: UNC >> DOCS >> 26145 Fall, 2009 Description: The Project Gutenberg EBook of The Tell El Amarna Period by Carl Niebuhr This eBook is for the use of anyone anywhere at no cost and with almost no restrictions whatsoever. You may copy it, give it away or re-use it under the terms of the Project Gut... Date Added: 2009-06-25 19:49:10 |
| 26109.txt Path: UNC >> DOCS >> 26109 Fall, 2009 Description: The Project Gutenberg EBook of Hail to the Chief, by Gordon Randall Garrett This eBook is for the use of anyone anywhere at no cost and with almost no restrictions whatsoever. You may copy it, give it away or re-use it under the terms of the Projec... Date Added: 2009-06-25 19:49:11 |
| 26137.txt Path: UNC >> DOCS >> 26137 Fall, 2009 Description: The Project Gutenberg EBook of Starlight Ranch, by Charles King This eBook is for the use of anyone anywhere at no cost and with almost no restrictions whatsoever. You may copy it, give it away or re-use it under the terms of the Project Gutenberg ... Date Added: 2009-06-25 19:49:12 |
| 26178.txt Path: UNC >> DOCS >> 26178 Fall, 2009 Description: Project Gutenberg\'s The Mirror of Taste, and Dramatic Censor, by Various This eBook is for the use of anyone anywhere at no cost and with almost no restrictions whatsoever. You may copy it, give it away or re-use it under the terms of the Project G... Date Added: 2009-06-25 19:49:14 |
| page8.pdf Path: Sveriges lantbruksuniversitet >> ACA >> 320 Fall, 2009 Description: Technical screenshots ... Date Added: 2009-06-25 19:53:43 |
| page002.pdf Path: Sveriges lantbruksuniversitet >> ACA >> 320 Fall, 2009 Description: concept To creat a poetic representation of Vancouver and how humans have to ability to change the environment they live in for better or worse Consists of 4 main environments: rural, ocean, urban and forest Each environment is intrinsically connecte... Date Added: 2009-06-25 19:53:45 |
| Chap_14.pdf Path: St. Olaf >> PHYS >> 244 Fall, 2009 Description: ... Date Added: 2009-06-25 20:02:42 |
| hw_ass_11.pdf Path: Kentucky >> MA >> 077 Fall, 2009 Description: [MA 352 001 Homework Assignment # 11, Date Due: February 8, 2008] 1 Use elementary operations to prove that the surface represented by the following picture (labeling scheme ab1 a1 cbc) is P 2 #P 2 #P 2 : c b a c b a 2 What surface will be rep... Date Added: 2009-06-25 20:05:51 |
| info.ps Path: ECCD >> MATHSTAT >> 260 Fall, 2009 Description: %!PS-Adobe-2.0 %Creator: dvipsk 5.58f Copyright 1986, 1994 Radical Eye Software %Title: info.dvi %Pages: 3 %PageOrder: Ascend %BoundingBox: 0 0 612 792 %EndComments %DVIPSCommandLine: dvips info %DVIPSParameters: dpi=300, comments removed %DVIPSSourc... Date Added: 2009-06-25 20:07:47 |
| FlatsTemplate2.pdf Path: Academy of Art >> FSH >> 600 Fall, 2009 Description: ... Date Added: 2009-06-25 20:07:57 |
| MODULE 9 =13= glossary.doc Path: Academy of Art >> GR >> 605 Fall, 2009 Description: MODULE13 <Back1page CommandProcessor:Thepartoftheoperatingsystemthatreceivesandexecutes operatingsystemcommands.Everyoperatingsystemhasacommandprocessor.Whenthe commandpromptisdisplayed,thecommandprocessoriswaitingforacommand.Afteryou enteracommand,t... Date Added: 2009-06-25 20:09:09 |
| 2043out.txt Path: Allan Hancock College >> ARTH >> 2043 Fall, 2009 Description: Gauguin: Paul 1848 1903,In the Garden at Aries,1888,Oil/canvas,02,/000790.JPG,20430201, Gauguin: Paul 1848 1903,Self portrait,1889,oil/panel,02,/000791.JPG,20430202, Denis: Maurice 1870 1943,April,1892,Oil/canvas,11,/000792.JPG,20430203, Denis: Ma... Date Added: 2009-06-25 20:09:44 |
| sol8.pdf Path: UMass (Amherst) >> MATH >> 411 Spring, 2008 Description: Math 411.1 solutions to homework #8 3.1.3 D4 has two elements of order 4, while Z2 Z4 has four: (0, 1), (1, 1), (0, 3), and (1, 3). Therefore D4 and Z2 Z4 are not isomorphic. An even easier answer: Z2 Z3 is Abelian, but D4 is not. 3.1.4 A4 has th... Date Added: 2009-06-25 20:12:50 |
| 080605-Week4-C-datatypes-4up.pdf Path: Toledo >> CSC >> 209 Fall, 2009 Description: History of PLs C Programming (1) Overview and Basic Types Lecture 4 1 GL machine language (early 1950s) 2 GL assembly (late 1950s) 3 GL fortran (1954), lisp, cobol, algol pascal, Basic, C (1971), prolog, simula, smalltalk, ada C+ (1983), Ja... Date Added: 2009-06-25 20:12:51 |
| T03_Group 3 Proposal.pdf Path: Rutgers >> MAE >> 388 Fall, 2009 Description: Project Proposal Team 3 Jeff Weekes Brian McCarthy Meghan Suchorsky Jason Scala 3/24/2005 The earliest incarnations of simple fishing reels first came into use in China during the 12th century. Today, fishing reels have evolved from these simple cra... Date Added: 2009-06-25 20:16:44 |
| 496498 Summer 2008 poster assignments 13 may 13.doc Path: UNLV >> FACULTY >> 496498 Fall, 2009 Description: 1 Psy 496/498 Summer 2008 Term Posters Roles on Poster Poster Team: Select poster topic, write poster, primary authors on professional presentation. Poster Supervisor (Brian Brehman): Provide feedback on assignments, help poster team create the best ... Date Added: 2009-06-25 20:17:58 |
| proposalrequirement.pdf Path: Midwestern State University >> ECONS >> 512 Fall, 2009 Description: Paper proposal requirements Yoder Econometrics II, 2003 The only hard and fast requirements for the research paper are that it must contain an econometric analysis, and it must focus on an economic issue (dened broadly). Even the latter requirement m... Date Added: 2009-06-25 20:18:34 |
| NH3.doc Path: WVU >> EE >> 480 Fall, 2008 Description: Ammonia Sensors 1) Rae Systems Price: $395 Accuracy: unspecified 2) Safety Systems Technology (NV), Inc. Price: $510 Accuracy: unspecified 3) Triple Plus Price:$420 Accuracy: unspecified 4) Industrial Scientific Corporation Price:$659 Accuracy: unspe... Date Added: 2009-06-25 20:18:34 |
| Week_7.pdf Path: WVU >> EE >> 480 Fall, 2008 Description: WEST VIRGINIA UNIVERSITY COLLEGE OF ENGINEERING AND MINERAL RESOURCES Lane Department of Computer Science and Electrical Engineering DESIGN PROJECT TEAM WEEKLY REPORT TEAM NO/TITLE: Team 21: NSA/Identix Biometrics Demo Member Brendan Forst Jeffrey ... Date Added: 2009-06-25 20:19:32 |
| c083_g02_by_g02_ssprec.txt Path: Berkeley >> G >> 083 Fall, 2009 Description: Race Vote Totals Candidate/Description TOTREG 194,672 DEMREG 77,967 REPREG 72,982 AIPREG 3,854 GRNREG 3,785 LIBREG 1,281 NLPREG 271 REFREG 922 DCLREG 31,138 MSCREG ... Date Added: 2009-06-25 20:22:40 |
| ECON103D01.TXT Path: Sveriges lantbruksuniversitet >> ECON >> 20021 Fall, 2009 Description: Sheet1 PROFILE OF STUDENTS IN SFU COURSES COURSE: ECON 103-3 D01 TITLE: MICROECONOMICS SEMESTER: 2002-1 LOCATION: SFU SECTION TYPE: LEC ENROL: 495 = PROGRAM OF STUDENT (Top 5 programs reported in each category Programs with < 3 students not shown se... Date Added: 2009-06-25 20:22:52 |
| midterm.ps Path: Georgia Tech >> CS >> 4431 Fall, 2009 Description: %!PS-Adobe-2.0 %Creator: dvipsk 5.526a Copyright 1986, 1993 Radical Eye Software %Title: midterm.dvi %Pages: 2 %PageOrder: Ascend %BoundingBox: 0 0 612 792 %EndComments %DVIPSCommandLine: dvips midterm -o %DVIPSParameters: dpi=300, comments removed %... Date Added: 2009-06-25 20:30:39 |
| lab7b.doc Path: Acton School of Business >> STAT >> 280 Fall, 2008 Description: Stat 280 Lab 6: Probability and Bayes Rule Objectives: This lab is designed to introduce Bayesian probability. Directions: Follow the instructions below, answering all questions. Your answers should be in the form of a brief report (MS Word), to be h... Date Added: 2009-06-25 20:34:23 |
| color_1e.pdf Path: San Diego State >> ART >> 344 Fall, 2008 Description: type as image sketching template For some, For some, ... Date Added: 2009-06-25 20:37:06 |
| PHY4635_burglar.pdf Path: Appalachian State >> PHY >> 4635 Fall, 2009 Description: PHY4635-5635 Burglar Alarm Lab pre-lab discussion SPRING 2009 Write a program that controls a burglar alarm that sets off an alarm if a door is opened while the system is armed. The user should be presented a menu of options from which he/she can ... Date Added: 2009-06-25 20:44:20 |
| 31735055280774_1.pdf Path: Pittsburgh >> AEI >> 9257 Fall, 2009 Description: ... Date Added: 2009-06-25 20:45:44 |
| n017.pdf Path: Rutgers >> FO >> 1957 Fall, 2009 Description: h hy w t u 5 k i d { 2Yd $hh s k ~v h f5 w e p h R 0 t \"d h y k w q | { y x v s d t 0 Q } 2D0 z wu tj r f } h s j fSp k o d g b h s e l j i u ... Date Added: 2009-06-25 20:46:35 |
| Is the death penalty an acceptable punishment for terrorists.doc Path: Penn State >> MLD >> 258 Fall, 2009 Description: 1 Is the death penalty an acceptable punishment for terrorists? This is a question asked often and by many people. I cannot say that I completely agree with one side of this argument more than the other. There any many factors that play into each si... Date Added: 2009-06-25 20:53:44 |
| idealog-w2009.doc Path: Stanford >> CS >> 247 Fall, 2009 Description: CS247:HumanComputerInteractionDesignStudio Winograd|VerplankWinter2009 IdeaLog Idealogsareasequentialvisualrecordofyourdesigninsightstofreeupyourshorttermmemoryandtoincreasethe utilityofyourinsightsviaongoingpersonalreflection.Owingtothepersonalnat... Date Added: 2009-06-25 20:54:35 |
| chap03.ppt Path: IUPUI >> CPT >> 388 Fall, 2009 Description: Chapter 3 VB .NET Programming Fundamentals Object-Oriented Application Development Using VB .NET 1 Objectives In this chapter, you will: Learn about the VB .NET programming language Write a VB .NET module definition Use VB .NET variables and d... Date Added: 2009-06-25 20:57:08 |
| my passions.doc Path: Uni. Westminster >> RSD >> 0503 Fall, 2009 Description: Robby Davis Learning Community Dr. Smith and Professor Robbins April 20, 2006 My Passions I am a very passionate person in all that I do in life. I love many things in this world and there are many different reasons for my care. There are few things ... Date Added: 2009-06-25 20:58:54 |
| Autism Presentation.ppt Path: Pima CC >> DMITCHELL >> 1925 Fall, 2009 Description: Autism Effective Behavioral Treatment: Applied Behavior Analysis First of all what is autism? A complex developmental disability which is the result of a neurological disorder. Autis m a ffe c ts no rm a lfunc tio ning o fth e b ra in, s o c ia li... Date Added: 2009-06-25 20:59:25 |
| GradingItems_ScoreEach.pdf Path: IUPUI >> ECE >> 492 Fall, 2008 Description: ECE 492: Grading Allocation of Points Journals Project Plan Oral Reports \"Milestone\" Charts Final Report Poster Attendance Technical Quality (3 @ 10) 1 @ 25 (3 @ 10) (1 @ 20 (3 @ 10) (1@50) (1@25) (15@1) (1@150) Total Possible 30 25 50 30 50 25 15... Date Added: 2009-06-25 20:59:46 |
| CaseStudy1.doc Path: SMU - Cox School of Business >> ENGR >> 8395 Fall, 2009 Description: CSE 8395 Case Study #1 Due: Fourth Class Meeting Name: _ You are to research and write a report on a border or transportation security initiative of your choosing. Your report should be the equivalent of 3-5 double spaced typed pages in length. Your... Date Added: 2009-06-25 20:59:59 |
| Lecture15.pdf Path: Wisconsin >> CS >> 536 Fall, 2008 Description: Reading Assignment Read Chapter 4 of Crafting a Compiler featuring Java. Read Programming Assignment #3 (CSX Parser). CS 536 Spring 2005 217 Context Free Grammars A context-free grammar (CFG) is defined as: A finite terminal set Vt; these a... Date Added: 2009-06-25 21:00:03 |
| Objectives and Questions-Stress.doc Path: Maple Springs >> PSYC >> 6253 Fall, 2009 Description: Describe 1. the 3 structures in the HPA axis, 2. a hormone released by each of them, and 3. how they interact. Contrast fast and slow timecourses of a stress response. How does the autonomic nervous system react during a stress response? How does an ... Date Added: 2009-06-25 21:00:39 |
| wendell_odsim_20081016.pdf Path: Duke >> RAW >> 20081016 Fall, 2009 Description: SKIVSKDETSIM:ODStatus RogerWendell 20081016 SKIVskdetsim:SoftwareTrigger NumberofSoftwareTriggers 500Topbottomthroughgoing muons ShouldbeSubEvents Histhas589entries Probablyneedtogivethe simmuonsmoreenergy Previouslyonly50%ofsimulatedthroughg... Date Added: 2009-06-25 21:02:22 |
| J_Rubric_andPaper.pdf Path: Wisc Stevens Point >> JSUTE >> 129 Fall, 2009 Description: ... Date Added: 2009-06-25 21:07:17 |
| EDUC402ALL.TXT Path: Sveriges lantbruksuniversitet >> EDUC >> 20033 Fall, 2009 Description: Sheet1 PROFILE OF STUDENTS IN SFU COURSES COURSE: EDUC 402-7 ALL SECTIONS LOCATION: SFU OTH TITLE: THEORY 3 studen... Date Added: 2009-06-25 21:08:46 |
| graph.txt Path: Georgia Tech >> CS >> 1321 Fall, 2008 Description: A - B \\ / \\ / \\ / \\ / \\ / C - D - H ... Date Added: 2009-06-25 21:11:47 |
| Set8.pdf Path: Fayetteville State University >> PHZ >> 5491 Fall, 2009 Description: PHZ5491 Homework Set 8: Superconductivity due Tuesday December 5 1. a) Discuss two different experimental methods for determining the critical temperature (Tc) of a superconductor; b) Discuss two different experimental methods for determining the ene... Date Added: 2009-06-25 21:13:37 |
| LectureZero.ppt Path: UMass (Amherst) >> CS >> 491 Fall, 2009 Description: CS491:CSMPG LectureZero CS 491J Computer Science of Multi-Player Games Welcome ThisisnotVictorianLiterature ThisisComputerScience491G Sowhatareweheretolearn? CS 491J Computer Science of Multi-Player Games CourseStructure:Classes FirstHalfofth... Date Added: 2009-06-25 21:16:50 |
| Week 1 How a Spreadsheet Works 08.pdf Path: Kentucky >> BAE >> 103 Fall, 2008 Description: BAE 103: Energy in Biological Systems Introduction to Excel Spreadsheets How a Spreadsheet Works A computer spreadsheet is based on the paper version of the same name used by accountants for many years. The spreadsheet is divided into rows and column... Date Added: 2009-06-25 21:19:10 |
| the.pdf Path: Arizona >> CS >> 480 Fall, 2009 Description: CSc 480 Questions About Dijkstras \"THE\" Paper Edsger W. Dijkstra is one of the most famousand controversialcharacters in Computer Science. Early in his career he made several lasting contributions: shortest path algorithm, contributor to ALGOL, sema... Date Added: 2009-06-25 21:26:36 |
| DrillDepthbyPressureVs.Time-ThreeDays-current.pdf Path: Wisconsin >> MEDIA >> 1215 Fall, 2009 Description: Drill Depth by Pressure Vs. Time From 12/12/2007 6:54:59 to 12/15/2007 6:54:59 0 Drill Depth By Pressure 500 Depth from Pressure 1000 1500 2000 2500 346.5 347 347.5 DOY IceCube ehwd plot, Sat Dec 15 07:26 2007 348 348.5 349 ... Date Added: 2009-06-25 21:27:48 |
| translatingintofol2.doc Path: East Los Angeles College >> PH >> 126 Fall, 2009 Description: Translating into FOL Dictionary 1. 2. a, b, c, d, e, f are names of objects x, y, z are variables and therefore always go together with quantifiers: V, Quantifiers: o xF(x): There is at least one thing, x, that has the property F o VxF(x): All thi... Date Added: 2009-06-25 21:28:43 |
| chapter2_2.pdf Path: UMass Lowell >> CS >> 413 Fall, 2009 Description: FTP: the file transfer protocol FTP FTP user client interface local file system file transfer FTP server remote file system user at host transfer file to/from remote host client/server model client: side that initiates transfer (either to/from ... Date Added: 2009-06-25 21:29:25 |
| chapter4_2.pdf Path: UMass Lowell >> CS >> 413 Fall, 2009 Description: The Internet Network layer Host, router network layer functions: Transport layer: TCP, UDP Routing protocols path selection RIP, OSPF, BGP IP protocol addressing conventions datagram format packet handling conventions Network layer forwarding table... Date Added: 2009-06-25 21:29:27 |
| page41.pdf Path: Kent State >> MATH >> 61051 Fall, 2008 Description: ... Date Added: 2009-06-25 21:31:43 |
| page72.pdf Path: Kent State >> MATH >> 61051 Fall, 2008 Description: ... Date Added: 2009-06-25 21:31:52 |
| page85.pdf Path: Kent State >> MATH >> 61051 Fall, 2008 Description: ... Date Added: 2009-06-25 21:31:55 |
| page117.pdf Path: Kent State >> MATH >> 61051 Fall, 2008 Description: ... Date Added: 2009-06-25 21:32:07 |
| s02In_Class.pdf Path: Ill. Chicago >> MCS >> 591 Fall, 2008 Description: MCS 591 Spring 02 What was done in class April 23, 2002 1/7/02 Distribute syllabus. Chapter 8: De Bruijn sequences. Dene Gn to have the 2n1 vertices x1 . . . xn1 where each xi is 0 or 1, and the 2n arcs labelled x1 . . . xn running from x1 . . . xn... Date Added: 2009-06-25 21:33:57 |
| Hw2.pdf Path: Princeton >> FRS >> 156 Fall, 2009 Description: Home Work #2 Due: March 24, 1998 (1) In the water tank example, point 1 is at the top of the water tank where the pressure is 0 atmosphere when you read the gauge (which means one atmosphere absolute), the velocity is zero, and the elevation is 40 fe... Date Added: 2009-06-25 21:36:22 |
| casy.pdf Path: Georgetown >> ECON >> 566 Fall, 2009 Description: Revised January 2006 GEORGETOWN UNIVERSITY Department of Economics Syllabus ECON 566/331 Applied country analysis: tools and applications Spring semester 2006 Prof. William Hemphill 703-237-9528 wlh@georgetown.edu Office hours: ICC, Room 562B, 3:00... Date Added: 2009-06-25 21:36:39 |
| spell.txt Path: Citadel >> CH >> 202 Fall, 2009 Description: teh message contians the url for the web-page and a misspeled url for the email adress... Date Added: 2009-06-25 21:41:25 |
| NOTES_CH_5.pdf Path: Cincinnati >> ENFD >> 382 Fall, 2008 Description: Chapter 5 Mass and Energy Analysis of Control Volumes Study Guide in PowerPoint to accompany Thermodynamics: An Engineering Approach, 5th edition by Yunus A. engel and Michael A. Boles Conservation of Energy for Control volumes The conservation of ... Date Added: 2009-06-25 21:43:37 |
| assgn3.doc Path: CSU San Marcos >> PS >> 399 Fall, 2009 Description: PSCI 399 Dr. Nichols Spring, 1996 ASSIGNMENT #3 Please read Does Attack Advertising Demobilize the Electorate? (American Political Science Review 88: 829-38) and answer the following questions. This assignment is worth 10 points, and is due in class ... Date Added: 2009-06-25 21:48:35 |
| assign1.doc Path: CSU San Marcos >> PS >> 399 Fall, 2009 Description: Political Science 399 Fall 1995 ASSIGNMENT #1 Propose three generalizations about political phenomena. For each, identify the concepts and describe how you would operationalize those concepts. Additionally, identify the independent and dependent vari... Date Added: 2009-06-25 21:48:44 |
| Amna outline.doc Path: UNLV >> HCA >> 701 Fall, 2008 Description: Amna Khawaja HCA 701 Paper Outline Revised Topic Euthanasia and Physician-Assisted Suicide, an Ethical dilemma in the Healthcare Industry Introduction o What is Euthanasia? o What is Physician-Assisted Suicide? What causes a patient to request Euth... Date Added: 2009-06-25 21:53:55 |
| 11_3.pdf Path: Texas A&M >> MATH >> 251 Fall, 2008 Description: ... Date Added: 2009-06-25 22:03:55 |
| notebooks.pdf Path: UF >> MIL >> 5666 Fall, 2009 Description: University of Florida Department of ECE 1/3/07 EEL 5666: Intelligent Machines Design Laboratory A. Antonio Arroyo, PhD Eric M. Schwartz, PhD LABORATORY NOTEBOOKS Each student must maintain a separate laboratory notebook, even if the student is par... Date Added: 2009-06-25 22:05:33 |
| lab11checkoff.doc Path: UNI >> CS >> 051 Fall, 2009 Description: 810:051 CS I - Lab 11 Activity Report Name: _ Activity A : Doing some testing [SIG1] When you feel you have letterGrade() working, show this to a TA. Activity B : Introduction to Strings [Q1] What happens when you invoke each of these commands: (be... Date Added: 2009-06-25 22:08:21 |
| hw9.pdf Path: Utah >> MATH >> 3900 Fall, 2008 Description: MATH 3900, Spring 2009 Homework 9 Due 04/03/09 1. A box has 4 balls: 2 blue and 2 white. You pick two at random. What is the probability that both will be blue? Solve this in two ways: a) Compute probability analytically, similar to what we did in cl... Date Added: 2009-06-25 22:10:09 |
| YDL017W.t2k.stride-ebghtl-logo.pdf Path: UC Santa Cruz >> YDL >> 017 Fall, 2009 Description: YDL017W.t2k EBGHTL 3 2 1 CC 1 CCCCCTTCCH TTTTTTTCCTHCHHHXXX H H H H H H H H H T T X X C C H T X X X X X X X X X X X X X E C C T H T H H T T T C H H C C T C C T H H H T X X X X X X X X X X X X X X X X C H C H E C X E C C X X X X EEEEE C T C ... Date Added: 2009-06-25 22:11:49 |
| YDL033C.t2k.dssp-ehl2-logo.pdf Path: UC Santa Cruz >> YDL >> 033 Fall, 2009 Description: YDL033C.t2k DSSP-EHL2 2 1 CC H X 1 10 20 30 40 H 2 1 T S E S H T CCE E X X X 51 60 70 80 90 E 2 1 S T T H T E H T 2 1 G T H T S E EEE CC X X X X S 2 1 X X E T S E T S E T H G H HCCCCC H C H H X X X X X H 2... Date Added: 2009-06-25 22:12:33 |
| YDL061C.t04.o_sep-logo.pdf Path: UC Santa Cruz >> YDL >> 061 Fall, 2009 Description: YDL061C.t04 o_sep 3 2 1 1 10 20 30 40 D 3 2 1 ADAD ADAD AH BD 51 GFHKYR 50 MAHENVWFSHPRRFGKGSRQCRVCSSHTGLVRKYDLNICRQCFREKANDI ... Date Added: 2009-06-25 22:13:01 |
| L07SoftwareDevelopmentMethod.ppt Path: UMBC >> PUB >> 104 Fall, 2009 Description: Software Development Method Topics q Software Development Life Cycle Reading q Section 1.4 1.5 L07SoftwareDevelopmentMethod.ppt Problem Solving Problem solving is the process of transforming the description of a problem into the solution of th... Date Added: 2009-06-25 22:14:28 |
| L07IntroToC.ppt Path: UMBC >> PUB >> 104 Fall, 2009 Description: Introduction to C Topics Compilation Using the gcc Compiler The Anatomy of a C Program 104 C Programming Standards and Indentation Styles Reading Sections 1.7 - 1.13, 2.1 - 2.2 1 Writing C Programs A programmer uses a text editor (not the ... Date Added: 2009-06-25 22:15:12 |
| hw1.doc Path: U. Houston >> CBA >> 6335 Fall, 2009 Description: FINA6335 - Managerial Finance Dr. Heung-Joo Cha Homework 1 (Harvard Business Case Study) Investment Analysis and Lockheed Tri Star Required Material Course packet # 123 @ Copy Center The case consists of five exercises in the mechanics of capital... Date Added: 2009-06-25 22:16:51 |
| Lecture912.ppt Path: Missouri S&T >> CS >> 307 Fall, 2009 Description: CS307 CS307 Software Testing And Software Quality Assurance Quality Frank Liu Lesson Title: Independent Path Lesson Testing and Condition Testing Relationship of Cyclomatic Number with Decision Counts Number V(G) = No._of_Simple_Conditions+1 V(G) ... Date Added: 2009-06-25 22:19:02 |
| E4.xlsx Path: Uni. Westminster >> IRM >> 0805 Fall, 2009 Description: Input area Date Expense Type 6/1/06 Meals 6/5/06 Travel 6/6/06 Meals 6/6/06 Entertainment 6/7/06 Travel 6/7/06 Meals 6/8/06 Travel 6/8/06 Meals 6/15/06 Meals 6/15/06 Entertainment 7/2/06 Meals 7/5/06 Entertainment 7/7/06 Entertainment 8/1/06 Meals 8/... Date Added: 2009-06-25 22:24:02 |
| postedcoursegrades_060409.pdf Path: UCSB >> PSYC >> 147 Spring, 2009 Description: student_id midterm (x/61) final (x/63) 7702608 49 55 7651094 46.5 45 8977683 37.5 48 8601544 39 37 8021586 46 48 8348757 32 37 7935422 46.5 53 7987068 52 51 8657421 46.5 52 8657520 47 49 7469950 50.5 51 7825664 33.5 52 8105512 43.5 55 7674039 38.5 47... Date Added: 2009-06-25 22:25:55 |
| Peter_Sarabosing.ppt Path: W. Alabama >> ME >> 100 Fall, 2009 Description: HEAT PUMPS By: Peter Francis Sarabosing WHAT IS A HEAT PUMP? Pumps heat from one place to another, either heating or cooling ones home Winter moves heat from outside to inside your home Summer moves heat from inside to outside your home Revers... Date Added: 2009-06-25 22:25:59 |
| m1.pdf Path: Sveriges lantbruksuniversitet >> MACM >> 316 Fall, 2009 Description: ... Date Added: 2009-06-25 22:27:54 |
| T0395.pdb_blast.txt Path: UC Santa Cruz >> T >> 0395 Fall, 2009 Description: # BLASTP 2.2.17 [Aug-26-2007] # Query: T0395 # Database: /projects/compbio/data/pdb/dunbrack-pdbaa # Fields: Query id, Subject id, % identity, alignment length, mismatches, gap openings, q. start, q. end, s. start, s. end, e-value, bit score T0395 2... Date Added: 2009-06-25 22:28:20 |
| stolte.pdf Path: East Los Angeles College >> FARADAY >> 113 Fall, 2009 Description: Inelastic Collisions of Oriented NO Molecules with Ar M. de Lange1, M. Drabbels2, P. Griffiths1, J.Bulthuis1, J. Snijders3 and S.Stolte1 1) Laser Centre and Department of Physical Chemistry, Vrije Universiteit De Boelelaan 1083, 1081 HV Amsterdam, Th... Date Added: 2009-06-25 22:29:21 |
| chap1.xls Path: VCU >> MGMT >> 171 Fall, 2008 Description: Prerequisite Material in Chapter 0 of Harshbarger & Reynolds (Students are expected to know this material and it will not be covered in class) Section Prerequisite Topic(s) 0.2 The Real Numbers Absolute Value 0.3 0.4 0.5 0.6 0.7 Integral Exponents ... Date Added: 2009-06-25 22:31:17 |
| script- fnl1.doc Path: San Jose State >> CMPE >> 296 Fall, 2009 Description: Online Payment System CmpE296U Professor Fayad Team: Script Martina Lai HanSeong Hay Ma Chi Fung Wu Hui Phillip Ma Oct 31, 2002 Table of Contents Abstract ..3 Introduction 3 Use Cases Use Case Diagram 4 Use Cases Description 5 CRC Cards 19 Class Di... Date Added: 2009-06-25 22:34:30 |
| E6820 Final Project.ppt Path: Columbia >> YL >> 2401 Fall, 2009 Description: Mandarin Accent Recognizer Yi-Chun Lin ELEN 6820 - Speech and Audio Processing and Recognition 08/08/08 1 Overview ProjectGoal Preparation Ideas Method Result Conclusion Futurework 2 Goal BuildanMandarinAccentRecognizer Inputastream... Date Added: 2009-06-25 22:35:29 |
| MLA_example.doc Path: Minnesota >> TC >> 1013 Fall, 2009 Description: Jane Student English 3006W Section 001 Instructors Name 1 October 2004 The Surrounding Sea: Nature Without Metaphor Stephen Cranes The Open Boat presents a stark examination of humans in relation to their world, and deconstructs the veil of idealism... Date Added: 2009-06-25 22:35:54 |
| class42.pdf Path: UNL >> PHYS >> 261 Fall, 2008 Description: CLASS 42. THE QUANTUM ATOM: THE PERIODIC TABLE RE-VISITED 42.1. INTRODUCTION The Bohr atom provided a straightforward way of thinking about the atom and further promoted the idea that some aspects of nature were quantized. The problem with modeling p... Date Added: 2009-06-25 22:36:46 |
| Syllabus_09.pdf Path: Texas A&M >> FSTC >> 606 Fall, 2008 Description: FSTC 606 Microbiology of Foods Spring, 2009 Instructor: Dr. Alejandro Castillo, Associate Professor, Dept. of Animal Science, 314A Kleberg Center, 845-3565, a-castillo@tamu.edu Class schedule: MWF 11:30-12:20, Kleberg Center Room 121 Course Website: ... Date Added: 2009-06-25 22:46:35 |
| Exceptions.pdf Path: Portland >> CS >> 201 Fall, 2008 Description: CS 201 CS Exceptions and Processes Gerson Robboy Portland State University Control Flow Computers Do One Thing From startup to shutdown, a CPU reads and executes (interprets) a sequence of instructions, one at a time. Physical control flow Time <st... Date Added: 2009-06-25 22:46:56 |
| kids websites.doc Path: E. Kentucky >> STUDENTWEB >> 445 Fall, 2009 Description: FunWebsitesforKids http:/www.yahooligans.com/ http:/www.orangekids.com/ http:/www.makingfriends.com/ http:/www.trisystemsinc.com/Kids/ http:/www.4kids.org/ http:/www.wildkids.org.uk/ http:/www.wonka.com/ HTTP:/ FUNBRAIN.COM http:/www.... Date Added: 2009-06-25 22:47:16 |
| music06.pdf Path: UNC >> MUSIC >> 25140 Fall, 2009 Description: THE OMAHA TRIBAL PRAYER. Harmonized by PROF. J.C. FILLMORE. P U w bc b w w Wa - kon - da U U w w U w dhe - dhu U Wa- pa - dhin U ton - he. U w... Date Added: 2009-06-25 22:49:55 |
| Chapter 5 Notes.doc Path: CSU Sacramento >> MGMT >> 120 Fall, 2009 Description: Outline of Chapter 5 FINAL CONSUMERS AND THEIR BUYING BEHAVIOR CONSUMER BEHAVIOR-WHY THEY BUY WHAT THEY BUY SPENDING PATTERNS ARE MOSTLY RELATED TO INCOME DISCRETIONARY INCOME-what is left of income after paying taxes and paying for necessities. BEH... Date Added: 2009-06-25 22:53:12 |
| T0456.t04.bys-logo.pdf Path: UC Santa Cruz >> T >> 0456 Fall, 2009 Description: T0456.t04 bys 5 4 3 2 1 1 10 20 30 40 P 5 4 3 2 1 E PEPHPTP H EPTH E HEHGTGSHGYEPE PH TP E 51 60 70 80 90 PEPH 5 4 3 2 1 PH GPGDHGE HPE PHGE 101 110 120 130 140 HEGTSH 5 4 3 2 1 G GEPH G E HGP H 151 160 170 18... Date Added: 2009-06-25 22:53:29 |
| subject outline_04.pdf Path: Allan Hancock College >> EE >> 2300 Fall, 2009 Description: Faculty of Science Engineering and IT School of Engineering SUBJECT OUTLINE EE2300 Electronics I (Semester 2, 2004) Campus (Townsville) and Mode of Offering: On Campus HANDBOOK DESCRIPTION: 39 hours lectures, 21 hours tutorials, 4 practicals. Semest... Date Added: 2009-06-25 22:53:58 |
| NagelEthnicRenewal.pdf Path: JMU >> FALCON >> 336 Fall, 2009 Description: ... Date Added: 2009-06-25 22:57:51 |
| finalrubric.pdf Path: UNL >> ECSE >> 960 Fall, 2009 Description: SpEd 960 Grading Rubric 2003 Final Letter Grade A Home Page Pre-/Post-test of knowledge/ skill Both completed Weekly Journal (n=12) 36+ pts. Reading Reactions 50+ pts. Family Interview Optional Project Weekly Discussions (n=14 weeks) 40+ pts. Final E... Date Added: 2009-06-25 23:01:12 |
| irwinj.pdf Path: MSOE >> CS >> 384 Fall, 2009 Description: !\" ! ! \' % # $% 2 537 8 734 439 : 8 ! . 3.\"! % ; . 3. <# 6 .3. 8 .-3.5 , % ; .-3.5 ! ! \' + ; 2= = ... Date Added: 2009-06-25 23:01:37 |
| HPLP Schedule F05.doc Path: Colorado >> MCEN >> 4278 Fall, 2008 Description: Fall2005SchedulefortheHewlettPackardLabPlaza(1B10) MONDAY 8AM 9AM MCEN4278/5268(L011) TUESDAY CHEN3010(001) (30LS)(1A15B) WEDNESDAY MCEN4278/5268(L011) THURSDAY CHEN3010(001) (30LS)(1A15B) FRIDAY MCEN4278/5268(L011) 89:15Ramirez 89:15Ramirez 9... Date Added: 2009-06-25 23:03:28 |
| slides_lecture3_handout.ps Path: Uni. Worcester >> CS >> 534 Fall, 2008 Description: %!PS-Adobe-2.0 %DocumentFonts: Helvetica Helvetica-Bold Courier Courier-Bold %Title: slides_lecture3_new.ps %Creator: psnup, Copyright (C) 1994 M. Herbert <rxkmh@minyos.xx.rmit.oz.au> %Revision: $Header: psnup.pro,v 2.2 94/06/14 14:39:29 rxkmh Locked... Date Added: 2009-06-25 23:07:29 |
| 460project1solns.pdf Path: Illinois State >> CHE >> 460 Fall, 2009 Description: C hemistry 4 60 Spring 2 005 Dr. Jean M. Standard Project 1 Solutions PART A ( 25 P OINTS) - H alf-Infinite P otential W ell P roblem This part of the project deals with a potential of width L and depth V0 for the case where E > V0 . The parameters ... Date Added: 2009-06-25 23:07:56 |
| Lecture1IntroGovtPrograms.pdf Path: Midwestern State University >> ECONS >> 451 Fall, 2009 Description: Price Support Loans or Purchases Econs 451: Lecture #20 Consumer expenditure and government costs from government purchases to maintain price above equilibrium. Price per unit D S Government Intervention Constituents of Government Intervention P... Date Added: 2009-06-25 23:08:56 |
| slod006b.pdf Path: UCSD >> MSP >> 430 Fall, 2009 Description: Op Amps For Everyone Ron Mancini, Editor in Chief Design Reference August 2002 Advanced Analog Products SLOD006B IMPORTANT NOTICE Texas Instruments Incorporated and its subsidiaries (TI) reserve the right to make corrections, modifications, enhan... Date Added: 2009-06-25 23:11:56 |
| Macpherson.pdf Path: UMKC >> ECON >> 506 Fall, 2008 Description: ... Date Added: 2009-06-25 23:16:05 |
| 5397_HW_2_KEY.pdf Path: U. Houston >> MATH >> 5397 Fall, 2008 Description: ... Date Added: 2009-06-25 23:16:21 |
| Farley2.pdf Path: Allan Hancock College >> ARTS >> 157406 Fall, 2009 Description: Limina, Volume 14, 2008 Pauline Farley The Wild West in Twentieth-Century English Childrens Annuals: Home on the Range? Pauline Farley University of Western Australia English childrens annuals developed as a genre during the late nineteenth centur... Date Added: 2009-06-25 23:26:13 |
| chapt16.ppt Path: Macon State >> CHEM >> 1211 Fall, 2009 Description: vti_encoding:SR|utf8-nl vti_timelastmodified:TR|02 Sep 2004 19:46:28 -0000 vti_extenderversion:SR|6.0.2.6551 vti_backlinkinfo:VX|chem1211_2.htm ... Date Added: 2009-06-25 23:27:43 |
| L18_Class_3.ppt Path: North-West Uni. >> ECE >> 230 Fall, 2009 Description: ECE230LecturesSeries ConstructorsandDestructors YingWu ElectricalEngineering&ComputerScience NorthwesternUniversity yingwu@ece.northwestern.edu 1 AClassisablueprint Classistheblueprintofaclassofpackages access Data Class Data Functions Functio... Date Added: 2009-06-25 23:37:26 |
| Article12.pdf Path: Toledo >> UTCWALOCAL >> 4530 Fall, 2009 Description: ... Date Added: 2009-06-25 23:38:14 |
| Article22.pdf Path: Toledo >> UTCWALOCAL >> 4530 Fall, 2009 Description: ... Date Added: 2009-06-25 23:38:14 |
| triangle.pdf Path: Michigan State University >> PHY >> 231 Fall, 2008 Description: b C a g B A ... Date Added: 2009-06-25 23:38:45 |
| IraqIsVietnam.doc Path: South Carolina Aiken >> APLS >> 110 Fall, 2009 Description: BushsblackiswhiteviewofIraq ByMAUREENDOWD NewYorkTimes InthethickofthewarwithIraq,PresidentBushusedtopopoutofmeetingstocatchthe Iraqiinformationministerslipcoveringgrimrealitywithwillful,idioticoptimism. Hesmyman,BushlaughinglytoldTomBrokawaboutthee... Date Added: 2009-06-25 23:41:01 |
| hw3.pdf Path: Maryland >> MATH >> 402 Fall, 2008 Description: MATH 402: Homework 3 Key Points: Denition of a subgroup. One-step subgroup test. Classic subgroups. Due Thursday, 21 February 2008 1. Let D4 be the dihedral group of order 8 shown here. You may want to write a Cayley table for this before procee... Date Added: 2009-06-25 23:47:22 |
| Practice1.pdf Path: SEMO >> MA >> 118 Fall, 2009 Description: ... Date Added: 2009-06-25 23:48:57 |
| Lab10.pdf Path: UMass Dartmouth >> CIS >> 115 Fall, 2009 Description: CIS 115 Lab #10 Array lab #1 Write a program to store an input list of ten integers in an array; then display a table similar to the following, showing each data value and what percentage each value is of the total of all ten values. n 8 12 18 25 24 ... Date Added: 2009-06-25 23:49:29 |
| is247t2.pdf Path: UMBC >> IS >> 247 Spring, 2008 Description: IS 247 Test Two Martens 10 April 2008 Closed Book, Closed Notes, No Electronics 1. (3 points): Suppose wed like to be able to use Gorp objects directly in a foreach loop, like this: for (Integer g: aGorp) . To do so, what interface would Gorp have to... Date Added: 2009-06-25 23:51:46 |
| hw.1.6.pdf Path: Miami >> MTH >> 309 Fall, 2008 Description: Additional homework 1. Use mathematical induction to prove the following (a) Postage of 24 cents or more can be achieved by using only 5 and 7 cent stamps. (b) Every positive integer can be written as a power of 2 times an odd integer. 2. Use proof b... Date Added: 2009-06-25 23:55:00 |
| notes.pdf Path: Iowa State >> CS >> 531 Fall, 2009 Description: z P` U P`H aG P Hh GR PfR p `G RaH x PHG C 9IsIV|cQx iSHQTcXBITgTI9y{QcFE~0 uP`U C c02gQgQHfH QIFGc... Date Added: 2009-06-26 00:02:17 |
| unplugged.pdf Path: San Diego State >> ART >> 344 Fall, 2008 Description: ... Date Added: 2009-06-26 00:03:14 |
| 3510Homework9.pdf Path: Georgia >> MATH >> 3510 Fall, 2008 Description: Spring, 2009 MATH 3510(H) PROBLEM SET #9 T. Shifrin DUE Wednesday, March 25, 2009. Problems to work but not hand in : 8.3: #10c,d, 12, 14. Problems to turn in : 8.3: #3c,d (4), 5 (2), 7 (3), 8 (3), 10b,e (6), 15 (3), 16 (3), 17 (3), 18 (3), 23 (... Date Added: 2009-06-26 00:03:38 |
| Lect2-ch16__2.pdf Path: Fayetteville State University >> PHY >> 2054 Fall, 2009 Description: L2Ch16 PHY 2054C College Physics B Summer 2006 Electricity, Magnetism, Light, Optics and Modern Physics Todays Lecture: purpose & goals Dr. David M. Lind, 1. 2. 3. 4. Special extra: Problem Solving Coulomb Force Addition of Vectors Electric Fie... Date Added: 2009-06-26 00:04:27 |
| struct_task list1.pdf Path: University of Illinois, Urbana Champaign >> AE >> 441 Fall, 2008 Description: AE 441 Spring 2009 Aerospace Vehicle Design Aircraft Design Section Task List #1 Structures 1. Identify structural requirements mentioned or implied in the RFP. 2. Read Raymer Chapter 8 (section 3) and Chapter 14. 3. Determine what information is nee... Date Added: 2009-06-26 00:14:32 |
| I Am From Poem WS.pdf Path: UC Davis >> SS >> 0708 Fall, 2009 Description: Name:_ Date:_ I Am From Poem Worksheet Directions: Make a list of the following items. Use adjectives (descriptive words) to describe your items. 1. Items found around your home: 2. Items found in your room: 3. Items found in your neighborhood: 4... Date Added: 2009-06-26 00:16:06 |
| midterm1sl.pdf Path: Duke >> PHY >> 182 Fall, 2009 Description: ... Date Added: 2009-06-26 00:16:18 |
| Test2PS.pdf Path: University of Montana >> MATH >> 241 Fall, 2008 Description: Here is your practice test. Study this practice test, the quizzes, the SPSS problem sets, the lecture notes and the book. Ill try to keep the same format for the real test. Weight will probably be shifted between Sets 3 and 4. Do these problems on se... Date Added: 2009-06-26 00:18:53 |
| a3.pdf Path: University of Toronto >> STA >> 248 Fall, 2009 Description: e Q I q i i q V p S q c U q I v q q p q U F i H i H y q F i vt Q I q p H v q F i sRss07%1XxsT%1sX1`nP`PuToxmds`$PTXy q y Q i U F i q i y S q vt U i p y q I q Q ct i Qt i U i Q V I U H Q S v U q p U i r vt y y hub`T9X91PxXT`XTsisxTx... Date Added: 2009-06-26 00:22:29 |
| a1.pdf Path: University of Toronto >> STA >> 248 Fall, 2009 Description: f g i Ps H i { V H i f } T E | xurrmY7rbDI R i R w i H T i T f T R i E f as P i G T 71I7SbYSbYISduh1IvW q as P Ps f T E f i f w Ps as i R w i G T q as P Ps i E C y w P a G w i E IvSSuDbSWF$YmuduImFIvWiIvSSuIhY 2WW$t YWvt... Date Added: 2009-06-26 00:22:30 |
| lecture8.pdf Path: Colorado >> PHYS >> 7840 Fall, 2009 Description: Eighth lectureSeptember 28, 2006 Web Page: http:/www.colorado.edu/physics/phys7840 NOTE: Next lectures Tuesday, Oct. 3; noon Thursday, Oct. 5; noon Todays topics: normal Fermi coordinates Schwarzschild solution; spherical gravitational collapse ... Date Added: 2009-06-26 00:23:12 |
| Ch3.pdf Path: University of Toronto >> STA >> 414 Fall, 2009 Description: Linear Models in Regression Prof. Rafal Kustra Public Health Sciences January 25, 2008 Prof. Rafal Kustra (Public Health Sciences) Useful Distributions January 25, 2008 1/9 Outline 1 Least Squares Prof. Rafal Kustra (Public Health Sciences) ... Date Added: 2009-06-26 00:24:27 |
| 156.pdf Path: Georgia >> PUBS >> 07012004 Fall, 2009 Description: flT Landscape Ecology 13: 271-283, 1998. 1998 Kluwer Academic Publishers. Printed in the Netherlands. 271 Predicting Southern Appalachian overstory vegetation with digital terrain data Paul V. Bolstad1, Wayne Swank2 & James Vose2 ^University of M... Date Added: 2009-06-26 00:29:39 |
| b11_output.txt Path: Michigan >> E >> 2100 Fall, 2009 Description: Scenario,Site_Name,Date,Ave_Temp(oC),Max_Temp(oC),Min_Temp(oC),Total_Flow(cms),Cond(S/cm),Nload(g/d),Ncon(ppm),TPload(g/d),TPcon(ppm),SRPcon(ppm),DA(km2) E2100b_MX4 , b11 , 1/1/1985 , 0.00 ... Date Added: 2009-06-26 00:32:03 |
| 2n3904.pdf Path: UCSB >> ECE >> 145 Fall, 2009 Description: 2N3904 / MMBT3904 / MMPQ3904 / PZT3904 N 2N3904 C C B Discrete Power & Signal Technologies MMBT3904 E TO-92 E SOT-23 Mark: 1A B MMPQ3904 B E B E B E B PZT3904 C C E SOIC-16 C C C C C C C E C B SOT-223 NPN General Purpose Amplifie... Date Added: 2009-06-26 00:33:26 |
| exp22.pdf Path: LSU >> EE >> 2231 Spring, 2008 Description: Electrical and Computer Engineering EE2231 Experiment 2 Name _ Introduction This lab will introduce the student to potentiometers and resistive voltage devision. Assignment Complete Experiment 2: Resistive Voltage Division in the manual. Answer all... Date Added: 2009-06-26 00:34:21 |
| salesvadv.xls Path: Laurentian >> ECON >> 2900 Fall, 2009 Description: Observation # Advertising Sales (in $000s) (in $000s) 1 30 184.4 2 40 279.1 3 40 244 4 50 314.2 5 60 382.2 6 70 450.2 7 70 423.6 8 70 410.2 9 80 500.4 10 90 505.3 sum 600 3693.6 600 500 400 300 Column C 200 100 0 20 30 40 50 60 70 80 90 100 ... Date Added: 2009-06-26 00:39:03 |
| projects.ppt Path: UNI >> CNS >> 051 Fall, 2009 Description: vti_encoding:SR|utf8-nl vti_timelastmodified:TR|04 Nov 2008 18:57:52 -0000 vti_extenderversion:SR|5.0.2.6790 vti_author:SR|BEN-SCHAFER\\schafer vti_modifiedby:SR|BEN-SCHAFER\\schafer vti_timecreated:TR|10 Mar 2008 14:51:55 -0000 vti_title:SR|Slide 1 vt... Date Added: 2009-06-26 00:49:59 |
| dfegs.ps Path: Duke >> STA >> 294 Fall, 2008 Description: ... Date Added: 2009-06-26 00:53:52 |
| Chapter 26 Client Server Interaction.ppt Path: CSU LA >> CS >> 245 Fall, 2009 Description: Chapter 26 Client Server Interaction Communication across a computer network requires a pair of application programs to cooperate. One application on one computer initiates communication and the other computer accepts the contact request. Client-... Date Added: 2009-06-26 01:06:48 |
| Chapter4_4th_ed_November_2007.ppt Path: CSU LA >> CS >> 245 Fall, 2009 Description: C hapte 4 r Ne twork Laye r A note on the use of these ppt slides: Were making these slides freely available to all (faculty, students, readers). Theyre in PowerPoint form so you can add, modify, and delete slides (including this one) and slide cont... Date Added: 2009-06-26 01:06:49 |
| Lecture_13.ppt Path: Arizona >> PAVLOV >> 214 Fall, 2009 Description: Lecture 13 Radiometric dating. Earliest Evidence for life on Earth. Student Presentations Matthew Trice and Samantha . Life on Europa October 23 Connie Kwong et al. Permian Triassic extinction October 28 Kelsey Palmer and Lyndsey Mullens Asteroid... Date Added: 2009-06-26 01:08:06 |
| scan7036.pdf Path: San Diego State >> ART >> 448 Spring, 2008 Description: ... Date Added: 2009-06-26 01:33:11 |
| 27.pdf Path: Laurentian >> BIOL >> 3800 Fall, 2009 Description: Ecological efciency \"n = Pn Pn ! 1 Ecological efficiency of zooplankton is usually around 10% of NPP in lakes Fecal pellets Zooplankton such as Daphnia filter-feed using currents generated by their thoracic appendages. Fecal pellets sediment rapi... Date Added: 2009-06-26 01:37:14 |
| 428.lect18.pdf Path: University of Toronto >> OLD >> 428 Fall, 2009 Description: DEPARTMENT OF COMPUTER SCIENCE UNIVERSITY OF TORONTO CSC 428F/2514F HUMAN-COMPUTER INTERACTION Lecture 18 EXAMPLES OF HCI RESEARCH AND EVALUATION IN INTERACTIVE SYSTEM DEVELOPMENT 18.1 HCI research and evaluation in the real world.2 18.2 Hypertext, ... Date Added: 2009-06-26 01:39:49 |
| f90.ps Path: Virginia Tech >> CS >> 4414 Spring, 2008 Description: %!PS-Adobe-2.0 %Creator: dvips 5.519 Copyright 1986, 1993 Radical Eye Software %Title: pl.dvi %CreationDate: Fri Mar 3 13:21:06 1995 %Pages: 49 %PageOrder: Ascend %BoundingBox: 0 0 612 792 %EndComments %DVIPSCommandLine: dvips -o /usr/local/etc/ebook... Date Added: 2009-06-26 01:41:28 |
| carrotarticle - Social Marketing.pdf Path: Laurentian >> MGT >> 200703 Fall, 2009 Description: Michael L. Rothschild Carrots, Sticks, and Promises: A Conceptual Framework for the Management of Public Health and Social Issue Behaviors The author presents a framework that considers public health and social issue behaviors and is based on self-i... Date Added: 2009-06-26 02:13:45 |
| EVMReferenceGuide.pdf Path: Georgia Tech >> ECE >> 4025 Fall, 2009 Description: TMS320C6201/6701 Evaluation Module Technical Reference Literature Number: SPRU305 December 1998 Printed on Recycled Paper IMPORTANT NOTICE Texas Instruments (TI) reserves the right to make changes to its products or to discontinue any semiconducto... Date Added: 2009-06-26 02:55:37 |
| Astro890L7.pdf Path: National Taiwan University >> ASTRO >> 890 Fall, 2009 Description: Astronomical Seeing and Adaptive Optics As a plane wavefront passes through the Earth\'s atmosphere it gets distorted by inhomogeneities in the index of refraction of air due to variations in temperature, pressure, and humidity (precipitable water con... Date Added: 2009-06-26 03:08:59 |
| Day 1 - chp 2 - murdoch.doc Path: Clarkson >> COMM >> 310 Fall, 2009 Description: COMM 310 5/18/09 people.clarkson.edu/~sdf/COMM310/ Today: Review syllabus and schedule Notes from Chp 1 as intro (timeline) Chp 2 pp. 44-47, 55-57, 67 Video: Rupert Murdoch Next class: Net neutrality Video: Murdoch Possibly start advertising ... Date Added: 2009-06-26 03:13:03 |
| cmsc666_mc.ppt Path: UMBC >> PUB >> 666 Fall, 2009 Description: Mobile Commerce CMSC 466/666 UMBC Outline MCommerce Overview Infrastructure MCommerce Applications Mobile Payment Limitations Security in MCommerce Mobile Commerce: Overview Mobile commerce (mcommerce, mbusiness)-any ecommerce done in a ... Date Added: 2009-06-26 03:20:33 |
| Fuesane Cheng - Grid Computing System.ppt Path: UMBC >> PUB >> 621 Fall, 2009 Description: Grid Computing Systems UMBC CMSC 621 Fall 07 Report Fuesane Cheng What is Grid Computing System Coordinated resource sharing and problem solving in dynamic, multi-institutional virtual organizations (VOs). Virtualization of distributed computing ... Date Added: 2009-06-26 03:21:06 |
| scenarios.pdf Path: Maryland >> CMSC >> 412 Fall, 2001 Description: Get_Next_Runnable() Q0 Q1 Q2 P1 P4 . . P2 P5 . . . Idle P3 \"Demote\" P2 P1 runs P4 . . Get_Next_Runnable() P3 P5 . Idle P1 Q3 Get_Next_Runnable() Q0 Q1 Q2 empty \"Promote\" Get_Next_Runnable() empty P4 P5 . . . Idle P4 P4 will enter at Q0 when unbl... Date Added: 2009-06-26 03:41:18 |
| pumping-lemma.ps Path: UC Davis >> CS >> 120 Fall, 2008 Description: %!PS-Adobe-2.0 %Creator: dvipsk 5.55a Copyright 1986, 1994 Radical Eye Software %Title: pumping-lemma.dvi %Pages: 1 %PageOrder: Ascend %BoundingBox: 0 0 612 792 %EndComments %DVIPSCommandLine: dvips -o pumping-lemma.ps pumping-lemma.dvi %DVIPSParamet... Date Added: 2009-06-26 03:48:23 |
| outline2.pdf Path: Midwestern State University >> CPTS >> 223 Fall, 2009 Description: CptS 223 Advanced Data Structures Exam 2 Outline The following outlines the topics you should know, and the things you need to be able to do, for the exam. In general, you will not be responsible for C+ code presented in class, except as noted in t... Date Added: 2009-06-26 04:39:29 |
| unplugged.pdf Path: San Diego State >> ART >> 340 Fall, 2008 Description: ... Date Added: 2009-06-26 05:21:30 |
| gdawgconfidentialitystatement0108.pdf Path: UCSD >> BETA >> 031308 Fall, 2009 Description: Confidentiality Statement for GDAWG-SIO Interviews The GDAWG-SIO Interview project seeks to give a prominent voice to people at SIO who might have been overlooked or felt isolated, because of their ethnicity, gender, sexual orientation, abilities, ec... Date Added: 2009-06-26 05:34:22 |
| final.txt Path: Georgia Tech >> CC >> 4710 Fall, 2009 Description: Floyd\'s algorithm for all pairs shortest paths Greedy vs Dynamic Programming vs Divide and Conquer Prim vs Kruskal MST Perl questions 20-30% Regular expressions DFS & BFS of graph giving visited list and also path recursive vs recursively enumerable ... Date Added: 2009-06-26 05:34:43 |
| hw2.doc Path: Bergen CC >> CS >> 150 Fall, 2009 Description: University of California at Berkeley College of Engineering Department of Electrical Engineering and Computer Sciences EECS150 Spring 2000 Homework #2 This homework is due on Friday February 4th by 11am. Homework will be accepted in the EECS150 box o... Date Added: 2009-06-26 05:42:14 |
| PtolemyIIExtensions.pdf Path: Bergen CC >> EE >> 249 Fall, 2009 Description: Extending Ptolemy II Edward A. Lee Robert S. Pepper Distinguished Professor and Chair of EECS, UC Berkeley EECS 249 Guest Lecture Berkeley, CA September 20, 2007 Ptolemy II Extension Points Define actors Interface to foreign tools (e.g. Python, MAT... Date Added: 2009-06-26 05:43:09 |
| sol7.pdf Path: Bergen CC >> EE >> 221 Fall, 2009 Description: EECS 221 A 1 Recall that the pair (A, C) is completely observable if and only if: rank A I C =n Solutions # 7 (1) for each (A), i.e. if v is an eigenvector of A then Cv = 0. Suppose there exists a positive denite matrix P = P T such that AT P +... Date Added: 2009-06-26 05:44:28 |
| lec15b&w-01.pdf Path: Bergen CC >> EE >> 100 Fall, 2009 Description: Feedback Ampliers A() = Amplier Gain (No Feedback) f () = Feedback Coecient A () = 0 A() 1 + f ()A() Instability in Feedback Ampliers A() 1 + f ()A() 1 + f ()A() 0 Nyquist Criterion for Stability arctan Instability if Im(A()f () Re(A()f ... Date Added: 2009-06-26 05:44:54 |
| lec26b&w-01.pdf Path: Bergen CC >> EE >> 100 Fall, 2009 Description: Differencing Amplifier i1 - i2 = I0 tanh[q(V1 - V2 )/(2kT )] i1 V1 i2 V2 I0 Differencing Amp Contd. 1.0 0.5 I1- I2 I0 0.0 -0.5 -1.0 -50.00 -25.00 0.00 25.00 50.00 V1- V2 , mV Darlington Pair Vcc RL Iin IL / 2 Vin Current Mirror I2 I1 I1 I2 Em... Date Added: 2009-06-26 05:44:56 |
| chap18b.pdf Path: Southern Oregon >> ES >> 111 Fall, 2008 Description: Geog 112: Physical Geography II Topography of Arid Lands Greg Jones, Department of Geography Fluvial Erosion in Arid Lands: Mechanical weathering and erosion in arid regions result in a process called differential erosion, with resistant layers pro... Date Added: 2009-06-26 05:51:19 |
| Lecture20.ppt Path: Berkeley >> I >> 202 Fall, 2009 Description: Psychology of Category Structure Facets vs. Hierarchies SIMS 202 Profs. Hearst & Larson UC Berkeley SIMS Fall 2000 Last Time q S bols and Language ym q Le xical Re lations Major Lexical Relations q WordNe classifie le t s xical re lations ynonym... Date Added: 2009-06-26 05:55:16 |
| TP2-AsieduSud-Est.pdf Path: NSULA >> GGR >> 1005 Fall, 2009 Description: ... Date Added: 2009-06-26 05:59:51 |
| textbook errata Path: UPenn >> STAT >> 430 Summer, 2009 Description: Errata Introduction to Probability, 1st Edition Dimitri P. Bertsekas and John N. Tsitsiklis Athena Scientific, 2002 (last updated 9/10/05) These are corrections to the first and second printings of the book, and have been fixed in the third printing.... Date Added: 2009-06-28 11:47:24 |
| Kaplan Verbal Reasoning Test 10 Path: NYIT >> WRIT >> 101 Spring, 2009 Description: Verbal Reasoning Section Test 10 Dear Future Doctor, The following Section Test and explanations should be used to practice and to assess your mastery of critical thinking in each of the section areas. Topics are confluent and are not necessarily in ... Date Added: 2009-06-28 15:08:22 |
| sheep_brain_sup Path: Palomar >> BIOL >> 31712 Spring, 2009 Description: ... Date Added: 2009-06-28 21:41:03 |
| ch1 Path: UWO >> ECON >> 1020 Spring, 2009 Description: What is Economics? Definition of Economics All economic questions arise because we want more than we can get. Scarcity is our inability to satisfy all our wants. Faced with scarcity we must make choices. Economics is the social science that st... Date Added: 2009-06-30 15:27:07 |
| 05-Renal cortex Path: Pacific >> BIOL >> BIOL 011 Spring, 2009 Description: ... Date Added: 2009-06-30 17:31:58 |
| 78-Spongy (or penile) urethra Path: Pacific >> BIOL >> BIOL 011 Spring, 2009 Description: ... Date Added: 2009-06-30 17:34:59 |
| MAE_314_Rabiei_HW3 Path: N.C. State >> MAE >> 314 Summer, 2009 Description: ... Date Added: 2009-07-01 15:49:22 |
| Volcano Composition (5) Path: Washington >> ESS >> 106 Spring, 2009 Description: Volcano Composition 1. What is magma? a. Varying composition i. Melt composition ii. Gas content iii. Amount of crystals iv. Responsible for viscosity and power 2. Primary control on melt viscosity a. Viscosity i. Resistance to flow, notion of intern... Date Added: 2009-07-02 04:40:58 |
| Homework1 Path: Pittsburgh >> ECON >> 1150 Summer, 2009 Description: Mehmet Soytas Wednesday, May 13, 2009 Applied Econometrics I, Summer, 2009 (due: Monday, May 18, 2009) Homework Assignment 1 1. Show that the .rst least squares assumption , E(ui j Xi ) = 0 , implies that E(Yi j Xi ) = 0 + 1 Xi . 2. Write down t... Date Added: 2009-07-02 20:29:04 |
| Bio1AL_Sum09_lab6_lecture Path: Berkeley >> BIO 1A >> 1AL Summer, 2009 Description: Bio 1A Lab Lecture Outline # 7 GMB II July 13th, 2009 I. Warning: Lab lecture does not replace reading the lab manual and reading Campbell. A. Practice problems. B. Practice lab exams Lab Exam Reader. Do them, expect somewhat similar problems. C. L... Date Added: 2009-07-04 02:34:37 |
| wk1 lectures Path: Agnes Scott >> MGMT >> 303 Spring, 2008 Description: Course Documents LECTURETTE 1.1 \"AN ANALYSIS OF UNITED STATES VS. JAPANESE MANAGEMENT\" Research conducted in comparing American style management vs. the Japanese style of management are clearly distinct from one another. As an example the cofounder ... Date Added: 2009-07-06 17:27:20 |
| Soln18016 Path: LSU >> CE >> 2460 Spring, 2009 Description: COSMOS: Complete Online Solutions Manual Organization System Chapter 18, Solution 16. m = 5 kg, a = 200 mm = 0.2 m = ( 2 )( 360 ) 60 = 12 rad/s. x = 0, y = 0, z = 12 rad/s Use parallel axes x, y, z with origin at the mass center as show... Date Added: 2009-07-07 12:10:53 |
| Soln18001 Path: LSU >> CE >> 2460 Spring, 2009 Description: COSMOS: Complete Online Solutions Manual Organization System Chapter 18, Solution 1. m = 5.4 kg, a = 600 mm = 0.6 m, b = 300 mm = 0.3 m Total length of rod. l = 2a + 2b = 1.8 m m 5.4 = = 3 kg/m l 1.8 Mass per unit length. = Use principal axe... Date Added: 2009-07-07 12:10:53 |
| problem21_20 Path: Texas A&M >> PHY >> 208 Fall, 2009 Description: 21.20: F F1 F2 and F F1 F2 since they are acting in opposite directions at x = 0 so, 1 4.00 10 9 C 5.00 10 9 C F (6.00 10 9 C) 2.4 10 6 N to the right. 2 2 40 (0.200 m) (0.300 m) ... Date Added: 2009-07-08 13:22:48 |
| Chap12-1_volti Path: Clemson >> ENGL >> 101 Spring, 2009 Description: STS 101 Chapter 12 Click to edit Master subtitle style Forms of Electronic media The telegraph showed up in 1844 Telegraph succeeded in uniting distant locales, regulating railroad traffic, and transmitting the news around the world. But teleg... Date Added: 2009-07-08 16:43:34 |
| 213 lec12 set1 Path: MSU Bozeman >> PHYS >> 213 Spring, 2002 Description: %1w | ~ ~ | z x w u fDyD}{y8v G A 5 C H8E$D`\"A@0 @2 9 7 5 3 ) 0( \' ! Vs # r # w s } i h h yfh s qyh retrrg2rp o nr k j80h m l W ig@ e Y W W fd iH V 2 2 S f 1 ) X( \' 1 ) 0( \' i y q y q p ... Date Added: 2009-07-08 18:49:53 |
| samples Path: MIT >> CSE >> 6.046J/18. Fall, 2001 Description: Introduction to Algorithms Massachusetts Institute of Technology Singapore-MIT Alliance Professors Erik Demaine, Lee Wee Sun, and Charles E. Leiserson 6.046J/18.410J SMA5503 Samples for Problem Set 8 Input sample 1. (From A Capsule History of Types... Date Added: 2009-07-09 10:48:12 |
| Lecture 3- Cost os Capital- Capital Structure Path: BCHS >> FIN >> FIN Spring, 2009 Description: Topics Covered Company and Project Costs of Capital Measuring the Cost of Equity Setting Discount Rates w/o Beta Certainty Equivalents Discount Rates for International Projects Company Cost of Capital A firm\'s value can be stated as the sum of... Date Added: 2009-07-10 01:46:55 |
| 2_36 Path: WVU >> MAE EE IEN >> mae ee ien Spring, 2009 Description: ... Date Added: 2009-07-10 13:25:18 |
| TwoSmall Path: Rutgers >> CS >> 111 Fall, 2007 Description: #1# # # # #<init>#()V#Code#LineNumberTable#main#([Ljava/lang/String;)V# # SourceFile#TwoSmall.java # # # #TwoSmall#java/lang/Object#IO#readInt#()I#reportBadInput#outputIn tAnswer#(I)V#!# #*# # # # #}#<#6#6#=# #6#6# #6#6#>#:# #6#!# #6#6#6#6#># ... Date Added: 2009-07-12 12:59:34 |
| scan0010 Path: Fairleigh Dickinson >> ECN >> 1211 Spring, 2009 Description: ... Date Added: 2009-07-12 18:30:48 |
| C1992 Path: Cornell >> PHYSICS >> 1112 Summer, 2009 Description: AP Physics C 1992 Scoring Guidelines The materials included in these files are intended for use by AP teachers for course and exam preparation in the classroom; permission for any other use must be sought from the Advanced Placement Program. Teacher... Date Added: 2009-07-13 19:58:03 |
| libnss_mdns4.so Path: Keller Graduate School of Management >> HR >> HR587 Summer, 2009 Description: ELF# #4# #4# #(#d#d#d#d)#d)#| #x#x)#x)#Qtd# # # ## # # # ##\"# W# # #`#@#N# #5# #_gmon_start_#_cxa_finalize#_Jv_RegisterClasses#fcntl#_assert_fail#socket#mems et#strncpy#connec... Date Added: 2009-07-14 21:31:59 |
| lab3_2008 Path: Carleton CA >> SYSC >> 3600 Winter, 2008 Description: CARLETON UNIVERSITY ELEC-3500 Department of Electronics Digital Electronics November 13, 2006 CMOS Sequential Logic Gates Design and Specification of Sequential Logic Gates and Library Cell Digital designs are composed of combinational logic (gates ... Date Added: 2009-07-16 03:15:55 |
| chapter%208-%20replacement%20marketing%20concepts Path: Carleton CA >> BUSI >> 2204 Winter, 2007 Description: Marketing Concepts: Testing Your Knowledge 1. List and explain some popular objectives and strategies used for individual and multiple products. Product objectives support a firm\'s broader marketing objectives and, ideally, focus on customer needs. O... Date Added: 2009-07-16 03:29:53 |
| Outline Path: USC >> AME >> 451 Fall, 2008 Description: AME 451: Linear Control Systems I Time: Instructor: Office: Phone: Office hours: email MW 5-6:20 H. Flashner Olin Hall 430E (213) 740-0489 M10-12, W12-2 hflashne@usc.edu Teaching Assistant: Hang Shi Office: TBD e-mail: hangshi@usc.edu Office hours... Date Added: 2009-07-20 16:58:34 |
| h2 Path: USC >> BUAD >> 306 Spring, 2009 Description: Problem Set #2 Solutions 16. Assets Current assets Cash Accounts receivable Inventory Total Fixed assets Net plant and equipment Total assets Liabilities and Owners\' Equity Current liabilities Accounts payable Notes payable Total Long-term debt Owne... Date Added: 2009-07-21 00:53:46 |
| PPE24_SeriesParallel Path: Berkeley >> PHYSICS >> 7B Spring, 2009 Description: Current, Resistance, and Circuits Series and Parallel Circuits RHJansen Equivalent Resistance The total resistance of two or more resistors in a part of a circuit or in the entire circuit. The value of one resistor that is equal to, and thus can r... Date Added: 2009-07-21 01:36:54 |
| Ess of Sys Anls- Rvw Sol- Ch 04 Path: DeVry Addison >> BIS >> 340 Spring, 2009 Description: Chapter 4: Review Questions Solutions 1. Describe systems analysis and the major activities that occur during this phase of the systems development life cycle. During systems analysis, you determine how the current information system functions and as... Date Added: 2009-07-21 11:31:05 |
| Discussion 01-28 Path: UC Davis >> ETX30 >> 001 Winter, 2009 Description: ETX 20 Discussion 01/28 Brittany Huntington bcrowland@ucdavis.edu Office Hours: By appointment Contact through SmartSite chat room Outline Questions? Reminders Lecture Review Personal Identification Alcohol and Drugs of Abuse Clandestine Met... Date Added: 2009-07-22 00:02:54 |
| Ch_322a_9.03 Path: USC >> CHEM >> 322AL Summer, 2009 Description: The Chemical Shift: Position of the Resonance The location in a spectrum of an nmr resonance or signal is characteristic of the type of hydrogen: aromatic, vinylic, aliphatic, adjacent to electronegative group,etc. Chemical shift is the term for the ... Date Added: 2009-07-22 20:32:37 |
| T_85_aashtoB Path: Universidad Nacional de Asuncion >> CEE >> 353 Spring, 2009 Description: SPECIFIC GRAVITY OF COARSE AGGREGATE AASHTO T 85 GLOSSARY Absorption: The increase in weight due to water contained in the pores of the material. Bulk Specific Gravity (also known as Bulk Dry Specific Gravity): The ratio of the weight in air of a uni... Date Added: 2009-07-23 00:44:12 |
| infi-07b-sol01_0 Path: The Open University >> MATH. >> 04101 Summer, 2006 Description: 2007 01 \" 20106 01 \" 1 . lim sin ax = 1 , a 0 : .1 x 0 ax , y 0 x 0 . y = ax sin y sin ax = lim =1 x 0 ax y 0 y lim : : sin 5 x sin 5 x - sin 3 x sin 5 x - sin 3 x x sin 3 x x lim = lim = lim 5 - 3 = x 0 x0 x sin x si... Date Added: 2009-07-23 14:39:46 |
| Chapter 4 Hands-On Project 4-4 Path: DeVry Cincinnati >> BIS >> 220 Summer, 2008 Description: Chapter 4 Hands-On Project 4-4 1. I click on the Start menu, then I click on Run and I type cmd and I hit enter. 2. I type getmac to find the NIC MAC address and then I hit enter. I got an error saying I didn\'t have a framedyn.dll. So I went to http:... Date Added: 2009-07-24 18:32:52 |
| ex1soln Path: Purdue >> ECE >> 202 Summer, 2009 Description: ECE 202 - Linear Circuit Analysis II Exam 1 Solutions September 25, 2008 Solution 1 F (s) = ln( Time shift property gives, L(f (t 2) = e2s F (s) Again, frequency shift property gives, L(et f (t 2) = = e2(s1) F (s 1) e2s s+1 ln( ) 2 e s s+2 ) s+1 ... Date Added: 2009-07-25 01:09:13 |
| ex1soln Path: Purdue >> ECE >> 202 Summer, 2009 Description: ECE 202 - Linear Circuit Analysis II Exam 1 Solutions September 25, 2008 Solution 1 F (s) = ln( Time shift property gives, L(f (t 2) = e2s F (s) Again, frequency shift property gives, L(et f (t 2) = = e2(s1) F (s 1) e2s s+1 ln( ) 2 e s s+2 ) s+1 ... Date Added: 2009-07-25 01:13:53 |
| 790-106 Path: Rutgers >> 790 >> 106 Spring, 2009 Description: LAW AND POLITICS, 790:106 Prof. Lisa L. Miller, Spring 2009 https:/sakai.rutgers.edu Professor Lisa L. Miller Department of Political Science 303 Hickman Hall Office hours: Wednesdays 1:30-3:00, or by appointment miller@polisci.rutgers.edu Teaching A... Date Added: 2009-07-25 20:01:41 |
| chm2211ps1 Path: Pensacola Junior College >> CHEM >> 2211 Spring, 2009 Description: CHM 2211 Problem Set 1 Aromaticity and Aromatic Compounds I. Which of the Following Are Aromatic? (Circle the Aromatic Species) O NH N H H H N H II. 1. Name These Compounds: 2. CH3CH2 NH2 NO 2 CH3 3. HO Cl 4. CH3 O 5. 6. COOH OH 7. ... Date Added: 2009-07-26 08:17:37 |
| lecture14 Path: Harvard >> COMPUTERSC >> CS51 Spring, 2009 Description: 5/11/2009 Notes COMPUTER SCIENCE 51 Spring 2009 cs51.seas.harvard.edu Midterm good job! will go over in sections see Profs if you struggled Prof. Greg Morrisett Prof. Ramin Zabih This week: mutation 5.8 of... Date Added: 2009-07-26 11:33:12 |
| 395.Berman.v.Parker Path: Rutgers >> 220 >> 395 Spring, 2009 Description: Berman et al., Executors, v. Parker et al. Supreme Court of the United States 348 U.S. 26; 75 S. Ct. 98; 99 L. Ed. 27 October 19, 1954, Argued November 22, 1954, Decided PRIOR HISTORY: Appeal from the United States District Court for the District of ... Date Added: 2009-07-27 15:15:24 |
| POTW1 Path: Waterloo >> MATH >> 135 Fall, 2005 Description: MATH 135 POTW #1 - Due Monday 26 September 2005 Fall 2005 Four wounded Mathies have to cross the MC-DC bridge at night to escape from their rabid Classical Algebra prof. The bridge is damaged, and so can only take two Mathies at a time. When two Ma... Date Added: 2009-07-27 19:30:27 |
| math237_a2 Path: Waterloo >> MATH >> math137 Spring, 2007 Description: SOLUTIONS FOR ASSIGNMENT 2 A3. Consider f : R2 R defined by f (x, y) = f (0, 0) = sin(xy) , (x, y) = (0, 0) ln(x2 + y 2 + 1) 0. Prove that fx (0, 0) and fy (0, 0) exist, but that f is not continuous at (0, 0). From the definition of first order par... Date Added: 2009-07-28 22:09:36 |
| solution_hw13 Path: Berkeley >> MATH >> 110 Fall, 2008 Description: ... Date Added: 2009-07-31 03:04:44 |
| 8 Path: Abilene Christian >> 1 >> 1 Spring, 2001 Description: Update Letters TRENDS in Plant Science Vol.13 No.1 Unexpected silencing effects from T-DNA tags in Arabidopsis Lucia Daxinger1, Ben Hunter3, Mazhar Sheikh3, Vincent Jauvion2, Virginie Gasciolli2, Herve Vaucheret2, Marjori Matzke1 and Ian Furner3 1... Date Added: 2009-08-01 02:35:46 |
| H02- Chapter 17 Path: Texas >> CH 302 >> 90262 Spring, 2009 Description: fernandez (jf23742) H02: Chapter 17 McCord (90262) This print-out should have 29 questions. Multiple-choice questions may continue on the next column or page find all choices before answering. A reminder that EXAM 1 is on Monday, August 20th, fro... Date Added: 2009-08-01 16:46:14 |
| Chapter05FALL05 Path: North Alabama >> BIOCHEMIST >> 100 Spring, 2005 Description: Chapter 5 - Properties of Enzymes Characteristics of enzymes 1) biological catalysts 2) not consumed during a chemical reaction 3) speed up reactions from 1000 - 1017, with a mean increase in rate of 00,000 4) exhibit stereospecificity -> act on a si... Date Added: 2009-08-02 16:30:07 |
| chapt30 Path: Vanderbilt >> PHYSICS >> 2049 Spring, 2009 Description: Chapter 30: Induction and Inductance Problem 1 In Fig. 30-37, the magnetic flux through the loop increases according to the relation B = 6t2 + 7t, where B is in milliwebers and t is in seconds. (a) What is the magnitude of the emf induced in the loop... Date Added: 2009-08-03 15:03:57 |
| EGR75HW4 Path: Duke >> EGR >> 75 Spring, 2009 Description: ... Date Added: 2009-08-03 20:26:24 |
| 8 Path: LSU >> BIOL >> 4125 Spring, 2009 Description: PROKARYOTIC DIVERSITY BIOL 4125 SPRING 2009 LECTURE 8 Overview of the Bacteria and Archaea II Highly resolved Tree Of Life based on completely sequenced genomes The phylogenetic tree is based on 31 universal protein families and covers 191 specie... Date Added: 2009-08-04 05:24:05 |
| Supplement_1_Order_of_the_Synoptics Path: LSU >> HNRS >> 3030 Spring, 2009 Description: Agreement/Disagreement in Order in the Synoptics John arrested To Galilee Kingdom at hand Fishermen called To Capernaum Jesus teaches Q sermon People astonished Leper healed Centurion\'s boy Demon in synagogue At Peter\'s house Healing the ill Preachin... Date Added: 2009-08-04 05:31:47 |
| GENERAL_INFO_SPRING_2009 Path: UCSD >> BIBC 102 >> BIBC 102 Spring, 2009 Description: METABOLIC BIOCHEMISTRY - BIBC 102 GENERAL INFORMATION Spring 2009 INSTRUCTOR: LECTURES: OFFICE HOURS: Paul Price, 2150C Bonner Hall T, Th 11:00 -12:20am in York 2722 T, Th 12:30am to 1:30pm. PROBLEM SETS: Please obtain a problem set/answers packet ... Date Added: 2009-08-04 17:39:09 |
| chap005 Path: Rutgers >> ACCT >> Intermedia Spring, 2009 Description: Chapter 5 Income Measurement and Profitability Analysis AACSB assurance of learning standards in accounting and business education require documentation of outcomes assessment. Although schools, departments, and faculty may approach assessment and ... Date Added: 2009-08-04 20:02:04 |
| Ch21- W09 Path: York University >> ECON >> 1010 Winter, 2008 Description: Introduction to Macroeconomics AS/ECON1010 3.0 Section R W09 Professor: Art Noordeh, PhD Web site: www.noordeh.pageout.net Teaching Assistants ROOM: 1098 VH 1. Negar Razavilar Office hrs: M W; 10 1 pm Email: razavi2@yorku.ca 1. Lulu Lo Office hrs:... Date Added: 2009-08-04 22:02:35 |
| HW1 Q3 [Andersen01a] Path: USC >> CSCI >> 551 Spring, 2009 Description: b) What is the key, title, and authors of the paper? Ans: [Andersen01a] Resilient overlay networks, David G. Andersen, Hari Balakrishnan, M. Frans Kaashoek, and Robert Morris. c) What are the key ideas or claims of the paper (state the idea and exp... Date Added: 2009-08-05 13:37:41 |
| E1 Path: UCSD >> CHEM >> 6c Spring, 2009 Description: Name: _ Date: _ 1. Given: S2O42-(aq) SO32-(aq), basic solution. How many electrons appear in the balanced half-reaction? A) 6 B) 1 C) 2 D) 3 E) 4 2. For the reaction cyclobutane(g) 2ethylene(g) at 800 K, a plot of ln[cyclobutane] vs t gives a strai... Date Added: 2009-08-05 18:08:27 |
| solutions%20ch04%20P4-7 Path: UT Dallas >> BUSINESS >> 4444 Spring, 2009 Description: AIM 3331-0U1 Solutions to suggested assignments Chapter 4 PROBLEM 4-7 Rap Corp. Income Statement (Partial) For the Year Ended December 31, 2007 Income from continuing operations before income tax. Income tax.. Income from continuing operations. Dis... Date Added: 2009-08-06 16:22:17 |
| Assignment10bFacultyLabVersion Path: University of Sydney >> DISCIPLINE >> ACCT2012 Winter, 2008 Description: ... Date Added: 2009-08-10 00:23:56 |
| 2prob09092002.doc Path: Michigan State University >> WORD >> 485 Fall, 2009 Description: PRR 485 In Class Exercise #2 September 9, 2002 In this exercise, you are presented with a reference or other information you need to find. You will formulate a short research approach / strategy, present that strategy and have several minutes to try ... Date Added: 2009-08-10 18:16:11 |
| dr_example_harassment.doc Path: Penn State >> JLG >> 484 Fall, 2009 Description: <?xml version=\"1.0\" encoding=\"UTF-8\"?> <Error><Code>NoSuchKey</Code><Message>The specified key does not exist.</Message><Key>52d1c696ffa33d064396b864e9f5f1de5923fdc9.doc</Key><RequestId>9 49FBC2AE1955B52</RequestId><HostId>gNp6q+XCqS/EbdKYiGoju2hQa4z... Date Added: 2009-08-10 19:51:05 |
| fig3.04.ps Path: Cal Poly Pomona >> HD >> 28497 Fall, 2009 Description: %!PS-Adobe-3.0 %BoundingBox: 54 54 558 738 %Title: Graphics produced by IDL %For: pomona astrolap 3@BRACKLAP2, C:\\RSI\\IDL55\\MYDAT\\HD28497\\PAPER %Creator: IDL Version 5.5, Microsoft Windows (Win32 x86) %CreationDate: Sun Jan 18 07:40:25 2004 %Document... Date Added: 2009-08-10 19:51:59 |
| 001063_1.pdf Path: Pittsburgh >> AEI >> 3644 Fall, 2009 Description: ... Date Added: 2009-08-10 19:52:24 |
| 75147_1.pdf Path: Pittsburgh >> AEI >> 10702 Fall, 2009 Description: ... Date Added: 2009-08-10 19:52:29 |
| colorfilters.pdf Path: Texas A&M >> AGCJ >> 308 Fall, 2008 Description: ... Date Added: 2009-08-10 19:53:40 |
| nursing205-articles-spring2009.pdf Path: Harrisburg Area Community College >> LIB >> 205 Fall, 2009 Description: NURSING 205 ARTICLES 1. Molnar, Arletta. \"One Drunk Over the Line\", Nursing 2006 Critical Care, November 2006, Vol. 1, No.6. 2. Captain, C. \"Is Your Patient a Suicide Risk?\" Nursing 2006. August, 2006, pg. 43-47. 3. Peterson, Margaret H. \"Understand... Date Added: 2009-08-10 19:54:18 |
| Electrified.pdf Path: Sveriges lantbruksuniversitet >> PHYS >> 100 Fall, 2009 Description: Name:_ Partners:_ Last 2 digits of student #: _ _ Physics 100 Drop-in Lab Project Electrified Objects When objects are rubbed they acquire a net electrical charge. All material consists of charged particles, but usually these charges are balanced s... Date Added: 2009-08-10 19:56:15 |
| HW4.pdf Path: Midwestern State University >> MATH >> 201 Fall, 2009 Description: ... Date Added: 2009-08-10 19:56:26 |
| Watt linkage 3D problem.pdf Path: Colorado >> MCEN >> 1025 Fall, 2008 Description: Lab 13 - Linkage Design Extra Credit Assignment For extra credit (worth 1/2 lab), you may make a moveable model of a Watt linkage as demonstrated in lecture 4, and shown below. ... Date Added: 2009-08-10 19:57:14 |
| ch19sc6realinteg.pdf Path: UPenn >> MATH >> 241 Fall, 2008 Description: Math 241 Rimmer 19.6 Evaluating Real integrals 2 F ( cos , sin ) d 0 Convert to a complex integral with contour C being the unit circle. z = ei dz = iei d dz d = iz cos = 1 i ( e + e-i ) 2 sin = 1 i ( e - e-i ) 2i cos = 1 ( z + 1z ) 2... Date Added: 2009-08-10 19:58:17 |
| Proposal Evaluation Tool.07.doc Path: Mercer >> FACULTY >> 605 Fall, 2009 Description: Georgia Baptist College of Nursing of Mercer University NUR 605 Qualitative Methods of Inquiry in Nursing Fall, 2006 Scholarly Writing (20%) and Presentation (20%) Research Proposal Evaluation Tool Faculty Evaluators: Dr. Helen Hodges, Dr. Susan Gun... Date Added: 2009-08-10 19:58:42 |
| AUT05.doc Path: Cal Poly >> MEC >> 2100 Fall, 2009 Description: GAGNANTS DES COMPTITIONS Automne 2005 LE DLESTAGE : QUIPE 22 PERFORMANCE QUIPE 11 DESIGN : PROTOTYPES ... Date Added: 2009-08-10 19:59:19 |
| Berkeley-1.pdf Path: Simmons >> LIS >> 470 Fall, 2009 Description: ABCDEFG HIJKLMN OPQRSTU VWXYZab cdefghijklm nopqrstuvw xyz?! * ABCDEFGHIJKLMNOPQRSTUVWXYZ abcdefghijklmnopqrstuvwxyz 0123456789 [ Ss \" \" \" \" ] ABCDEFGHIJKLMN... Date Added: 2009-08-10 19:59:46 |
| archi.ps Path: UC Davis >> ECS >> 165 Fall, 2009 Description: %!PS-Adobe-2.0 %Creator: dvips(k) 5.86 Copyright 1999 Radical Eye Software %Title: main.dvi %Pages: 6 %PageOrder: Ascend %BoundingBox: 0 0 612 792 %DocumentFonts: ZapfDingbats %EndComments %DVIPSWebPage: (www.radicaleye.com) %DVIPSCommandLine: dvips ... Date Added: 2009-08-10 20:00:38 |
| Econ113_Spring2007_Exam2C.pdf Path: SIU Carbondale >> ECON >> 113 Fall, 2009 Description: Econ 1132, Spring 2007 April 20, 2007 Exam 2c, 100 points Neatly print your name . . . . . . . . . . . . . . . . . . . . . . . . . . . The exam ends at 11:50 a.m.; there are 5 problems. Points for each problem are given in parentheses with the prob... Date Added: 2009-08-10 20:01:12 |
| N260OF.pdf Path: Rappahannock Community College >> EGR >> 260 Fall, 2009 Description: EGR 260 Circuit Analysis File: N260OF Final Exam Overview Test#1 Material (25%) Basic definitions and units Relationships for Q, I, V, P, and W Simple resistive circuits Circuits with dependent sources Pdelivered = Pabsorbed Test#2 Material (35%) M... Date Added: 2009-08-10 20:01:42 |
| chem201_BF3_line.pdf Path: Hudson VCC >> CHEM >> 201 Fall, 2009 Description: A B D Trap Electronic Pressure Guage BF3 Reservoir C H L Rx Tube Trap E G J I K Me3N Reservoir AA CC BB Calib. Trap DD Connectors O-ring plug/needle valve Glass vacuum valve Fill line from BF3 & Me3N tanks (non toccare) Hg manometer ... Date Added: 2009-08-10 20:01:55 |
| Allmost.txt Path: New Hampshire >> CS >> 516 Fall, 2008 Description: # test20.txt: # very large test which tests most of the features # of the program, they are listed below in non-outputting # comments: INVALID INPUT = x Nashua 12 ;invalid command with right number of paramters ;invalid command ;i... Date Added: 2009-08-10 20:01:58 |
| N260OF.pdf Path: Delaware Tech >> EGR >> 260 Fall, 2009 Description: EGR 260 Circuit Analysis File: N260OF Final Exam Overview Test#1 Material (25%) Basic definitions and units Relationships for Q, I, V, P, and W Simple resistive circuits Circuits with dependent sources Pdelivered = Pabsorbed Test#2 Material (35%) M... Date Added: 2009-08-10 20:02:57 |
| YDR523C.t2k.w0.5-logo.pdf Path: UC Santa Cruz >> YDR >> 523 Fall, 2009 Description: YDR523C.t2k w0.5 5 4 3 2 1 D S Y F L I W V L E I X L X L L L L X X X X X X X X X X L K E L L L S X X L S A V XXXXXXXXXXXXXXXXX N K E G D S E K R L V L L I 1 10 20 30 40 H 5 4 3 2 1 K D E K H E T E T E XXXXX E Y ILDLM C ... Date Added: 2009-08-10 20:03:18 |
| Midterm.pdf Path: Mercer >> TCO >> 285 Fall, 2009 Description: Join Us! March 27 For our Signiature H C h il i Z EZT Independts Unite! Come find out what all the Independents Unite! President Samual Collins 301.5555 Samuel.collins@student.mercer.edu FUSS is about! Cookoff All Funds Raised Directly Ben... Date Added: 2009-08-10 20:03:35 |
| set6soln.ps Path: UCSD >> PORD >> 622 Fall, 2009 Description: %!PS-Adobe-2.0 %Creator: dvips(k) 5.86 Copyright 1999 Radical Eye Software %Title: set6soln.dvi %Pages: 6 %PageOrder: Ascend %BoundingBox: 0 0 612 792 %DocumentFonts: CMBX12 CMR12 CMMI12 CMEX10 CMSY10 CMMI8 CMR8 MSBM10 %+ MSAM7 CMSY8 CMMI6 CMR10 MSAM... Date Added: 2009-08-10 20:04:34 |
| 217dirac.ps Path: UC Santa Cruz >> PH >> 217 Fall, 2009 Description: %!PS-Adobe-2.0 %Creator: dvips(k) 5.90a Copyright 2002 Radical Eye Software %Title: 217dirac.dvi %CreationDate: Mon Nov 03 09:14:37 2003 %Pages: 3 %PageOrder: Ascend %BoundingBox: 0 0 612 792 %DocumentFonts: CMR17 CMBX12 CMR10 CMMI10 CMSY8 CMSY10 CMR... Date Added: 2009-08-10 20:04:55 |
| galston.doc Path: UVA >> PLAP >> 101 Fall, 2008 Description: vti_encoding:SR|utf8-nl vti_syncwith_localhost\\c\\:\\documents and settings\ athan jones\\my documents\\my web sites\\personal2/c\\:/documents and settings/nathan jones/my documents/my web sites/personal2:TR|04 Aug 2005 19:47:45 -0000 vti_timelastmodified:... Date Added: 2009-08-10 20:06:34 |
| OneD.doc Path: Air Force Academy >> DMH >> 244 Fall, 2009 Description: One Dimensional Simplification In one dimension, where stress and strain exist only in the x-direction, or all forces are subjected parallel to a one dimensional beam, the above equations can be simplified by using the following relations: = E du =... Date Added: 2009-08-10 20:06:38 |
| dodgeball.pdf Path: New Haven >> UNH >> 04212008 Fall, 2009 Description: ... Date Added: 2009-08-10 20:06:40 |
| lecture_3.pdf Path: Southern Illinois University, Carbondale >> CHEM >> 434 Fall, 2008 Description: Lecture #3 Electromagnetic Radiation and Spectrometry Reading: Chapter 6, page 132 -163. Basics of electromagnetic radiation: - wave and particle character. Interaction of electromagnetic radiation with matter. Quantum mechanical properties of rad... Date Added: 2009-08-10 20:08:29 |
| Anonymous_EthicsAssignment.pdf Path: Allan Hancock College >> ITEC >> 810 Fall, 2009 Description: ITEC810 ETHICS ASSIGNMENT Situation: You work for a large software company. You are involved in preparing a tender for a project, which is essential for the company\'s survival: if you don\'t win the contract, you will have to fire two employees who re... Date Added: 2009-08-10 20:09:46 |
| w9.pdf Path: Rutgers >> MATH >> 152 Fall, 2008 Description: ... Date Added: 2009-08-10 20:09:54 |
| w10.ps Path: Rutgers >> MATH >> 152 Fall, 2008 Description: %!PS-Adobe-2.0 %Creator: dvips(k) 5.86 Copyright 1999 Radical Eye Software %Title: w10.dvi %Pages: 7 %PageOrder: Ascend %BoundingBox: 0 0 612 792 %EndComments %DVIPSWebPage: (www.radicaleye.com) %DVIPSCommandLine: dvips w10.dvi -o w10.ps %DVIPSParame... Date Added: 2009-08-10 20:09:57 |
| m265nt.pdf Path: East Los Angeles College >> M >> 265 Fall, 2009 Description: M265 A-yeu Hai, A-yeu Hxe, A-yeu Dao. Written by Wang Jian-guo. Notes This narrative is found in Document N (no. 16, page 401). Title. Here, and throughout the piece, the first two of the three names are written incorrectly as \"At yeul Hens\" and \"At... Date Added: 2009-08-10 20:10:00 |
| exm_math11219_11164_01.pdf Path: Allan Hancock College >> MATH >> 11164 Fall, 2009 Description: WINTER TERM EXAMINATION 2001 Page 1 of 6 ENGINEERING MATHEMATICS 1B/ MATHEMATICS 1B (MATH 11219 / MATH 11164) Question 1 (COMPULSORY QUESTION) Evaluate each of the following showing all work, or if tables are used, indicating the table entry concern... Date Added: 2009-08-10 20:10:44 |
| e-mail.txt Path: UT Chattanooga >> ENCH >> 435 Fall, 2009 Description: Chris-Boudreaux@utc.edu Boudreaux, Chris Benjamin-Dalton@utc.edu Dalton, Benjamin Jim-Henry@utc.edu Henry, Jim Wayne-Johnson@utc.edu Johnson,Wayne Mallory Frank-Jones@utc.edu Jones, Francis Nicholas-Reinhardt@utc.edu Reinhardt, Nicholas Donald-Scott@... Date Added: 2009-08-10 20:11:17 |
| Quiz_3.pdf Path: Fond du Lac >> MATH >> 113 Fall, 2009 Description: Math 113 Name: Take-Home Quiz 3 Due Wednesday, February 25, 2009 Follow instructions carefully, and show all your work. Partial Credit will be given if you show your reasoning. 1. Sketch graphs of the following trigonometric functions: (a) (3 pts)... Date Added: 2009-08-10 20:12:35 |
| chapt02_lecture.pdf Path: Tyler College >> SCIENCE >> 2401 Fall, 2009 Description: 1 Chapter 2 The Chemistry of Life Atoms, Ions and Molecules Water and Mixtures Energy and Chemical Reactions Organic compounds 2 Atoms, Ions and Molecules The chemical elements Atomic structure Isotopes and radioactivity Ions, electrolyte... Date Added: 2009-08-10 20:12:38 |
| speedup.ppt Path: RIT >> CS >> 531 Fall, 2008 Description: vti_encoding:SR|utf8-nl vti_title:SR|Speedup vti_timelastmodified:TR|12 Jan 2000 21:17:50 -0000 vti_author:SR|ptt vti_modifiedby:SR|ptt vti_timecreated:TR|12 Jan 2000 22:23:46 -0000 vti_backlinkinfo:VX|courses/531/schedule.html vti_extenderversion:SR... Date Added: 2009-08-10 20:13:17 |
| midterm2soln.pdf Path: Oregon >> MATH >> 111 Fall, 2008 Description: Chris Phan Math 111 Tuesday, 2 February 2004 Midterm II Solutions Midterm II Solutions 1. True-False: (a) Every one-to-one function has an inverse. True. One-to-one functions are exactly the functions for which you can find an inverse (without rest... Date Added: 2009-08-10 20:13:58 |
| slac-pub-9517.pdf Path: Stanford >> PUBS >> 9500 Fall, 2009 Description: SLAC-PUB-9517 September 2002 SUMMARY OF THE RF-TECHNOLOGY WORKING GROUP (T3) C. Adolphsen, J. Cornuelle, T. Lavine, H. Padamsee, S. Tantawi (October 16, 2001) The Next-generation Linear Collider The next-generation linear collider will require hig... Date Added: 2009-08-10 20:14:14 |
| slac-pub-9535.pdf Path: Stanford >> PUBS >> 9500 Fall, 2009 Description: SLAC-PUB-9535 October 2002 The Apparent Host Galaxy of PKS 1413+135: HST, ASCA and VLBA Observations Eric S. Perlman1,2, John T. Stocke3, Chris L. Carilli4, Masahiko Sugiho5 , Makoto Tashiro6 , Greg Madejski7, Q. Daniel Wang8 , John Conway9 arXiv:... Date Added: 2009-08-10 20:14:16 |
| HO-5bc.pdf Path: UMass Dartmouth >> CIS >> 361 Fall, 2009 Description: Handout-5(CIS 361) 2-Way Automata Remark: This problem can also be solved using a direct product of both automata. Example: A = { x {a, b}* : |x|a = multiple of 3 |x|b = even } 1. A = (S, , , , , } ) s0, sa, sr) S x {L , R} : S x ( U... Date Added: 2009-08-10 20:14:33 |
| Dome_Temp.txt Path: Allan Hancock College >> PHYSICS >> 003 Fall, 2009 Description: Time Time In Secs Dome Temp 2009_06_19 08:56:02 3328246562 20.7612 2009_06_19 08:56:04 3328246564 20.898 2009_06_19 08:57:08 3328246628 20.7156 2009_06_19 08:58:11 3328246691 20.8524 2009_06_19 08:59:14 3328246754 20.9435 2009_06_19 09:00:17 33282468... Date Added: 2009-08-10 20:15:11 |
| hw9.pdf Path: Wisconsin Milwaukee >> PHYS >> 475 Fall, 2009 Description: Homework #9 (due on 04/21) Boas Chapter 14 6.18\'(includes 6.18); 6.35\'(includes 6.35); 7.4; 7.10; 7.16; 7.28; 7.35; Boas Chapter 1 16.26 Boas Chapter 12 23.8; 23.29; Extra-credit problem Kramers-Kronig relations In optics Kramers-Kronig relations pr... Date Added: 2009-08-10 20:16:04 |
| ex5a.pdf Path: Bethel VA >> PHYS >> 251 Fall, 2009 Description: Projectile Motion and Range: You throw a ball into the air with an initial velocity of 24 m s at an angle of 40o to the horizontal. You want to nd out: 1. the total time the ball is in the air 2. how far the ball travels horizontal distance 3. what i... Date Added: 2009-08-10 20:16:06 |
| eq_list.pdf Path: Bethel VA >> PHYS >> 251 Fall, 2009 Description: s i fe hi ud jj m r d d rhi jj p d e d ( YRDtaD s Vca h Vf V `XWggXfed s i R hi tw g q o nhi F p m 8#k i i i R hi g w atRxwu s q ycv caY V Db`XW1U e jlxk i d i d i fe hi d jj fe d d taR... Date Added: 2009-08-10 20:16:07 |
| 16.7-note.pdf Path: Auburn >> MATH >> 2630 Fall, 2008 Description: 178 CHAPTER 16. VECTOR CALCULUS 16.7 16.7.1 Surface Integrals (pdf ) Surface Integral Suppose f is a continuous function of three variables whose domain includes a surface S. We can compute the surface integral of f over the surface S. Divide S ... Date Added: 2009-08-10 20:16:55 |
| output.txt Path: Syracuse >> HW >> 504 Fall, 2009 Description: Hours 5 9 1.8 7.1 24 ... Date Added: 2009-08-10 20:17:06 |
| T2functionalanalysisabc2d.pdf Path: Allan Hancock College >> IMS >> 5047 Fall, 2009 Description: 1 IMS 5047 - MANAGING BUSINESS RECORDS Functional Analysis of Business Activities These notes are based on material prepared by Anne Picot, Barbara Reed and Frank Upward, with some alterations by Judith Ellis (2004). The material is not to be used b... Date Added: 2009-08-10 20:17:20 |
| 011030reform.txt Path: Chester >> ECO >> 343 Fall, 2008 Description: WSJ.com October 30, 2001 Business and Finance - Asia Economic Summit Attendees Agree Internal Reform Is Needed in Asia By JASON BOOTH Staff Reporter of THE WALL STREET JOURNAL Internal reform, not a rebound in U.S. imports, is the key to Asia\'s eco... Date Added: 2009-08-10 20:18:10 |
| 8-deadlock.ppt Path: Washington >> CS >> 451 Fall, 2009 Description: CSE 451: Operating Systems Spring 2005 Module 8 Deadlock Ed Lazowska lazowska @cs.washi ngton.edu Allen Center 570 (Is Google the greatest, or what?) 06/22/09 2005 Gribble, Lazowska, Levy 2 Definition A thread is deadlocked when it\'s waiting for... Date Added: 2009-08-10 20:19:14 |
| 4-process.pdf Path: Washington >> CS >> 451 Fall, 2009 Description: Process management CSE 451: Operating Systems Autumn 2003 Module 4 Processes Ed Lazowska lazowska@cs.washington.edu Allen Center 570 This module begins a series of topics on processes, threads, and synchronization this is the most important part o... Date Added: 2009-08-10 20:19:19 |
| midterm.pdf Path: Washington >> CS >> 451 Fall, 2009 Description: Midterm Total possible = 56 M e an = 37.18 M e dian = 38 4 3 Frequency 2 1 0 15 17 19 21 23 25 27 29 31 33 35 37 39 41 43 45 47 49 51 53 55 Score ... Date Added: 2009-08-10 20:19:41 |
| 02-arch-6.ps Path: Washington >> CS >> 451 Fall, 2009 Description: #%-12345X@PJL JOB @PJL SET RESOLUTION = 600 @PJL ENTER LANGUAGE = POSTSCRIPT %!PS-Adobe-3.0 %Title: Microsoft PowerPoint - 2-arch %Creator: Pscript.dll Version 5.0 %CreationDate: 4/8/2002 11:4:56 %BoundingBox: (atend) %Pages: (atend) %Orientation: Po... Date Added: 2009-08-10 20:19:56 |
| 10-paging_TLBs.pdf Path: Washington >> CS >> 451 Fall, 2009 Description: CSE 451: Operating Systems Lecture 10 Paging & TLBs Managing Page Tables Last lecture: size of a page table for 32 bit AS with 4KB pages was 4MB! far too much overhead how can we reduce this? observation: only need to map the portion of the a... Date Added: 2009-08-10 20:19:58 |
| 4-process.pdf Path: Washington >> CS >> 451 Fall, 2009 Description: CSE 451: Operating Systems Winter 2009 Module 4 Processes Mark Zbikowski Gary Kimura Process management This module begins a series of topics on processes, threads, and synchronization this is the most important part of the class Today: processe... Date Added: 2009-08-10 20:20:03 |
| 3-struct.ppt Path: Washington >> CS >> 451 Fall, 2009 Description: Systems Winter 2006 Module 3 Operating System Components and Structure Ed Lazowska lazowska @cs.washi ngton.edu Allen Center 570 OS structure The OS sits between application programs and the hardware it mediates access and abstracts away ugliness ... Date Added: 2009-08-10 20:20:15 |
| ch7_community_ecology.pdf Path: CSU San Marcos >> BIOL >> 338 Fall, 2009 Description: IB 27 E 2B7 V 6 g Pcf5DD3I f E \"i$ IE4 YT42u Y V 6EIW sF0550cI ac5X@ $ 8 6 VB I 6 T V 6 E I W P7 aP0F rcI ac5X@ $ I E 4 YB Y I W W Y q Y 6 V f aF9c550FgE aF8 t $ j e d k `d 5Xj pes`k i me`d eh w l k j i e y y x prd a5 ew I 67 T ) H3F4Y I ... Date Added: 2009-08-10 20:21:46 |
| artblog.pdf Path: UMBC >> USERPAGES >> 142 Fall, 2009 Description: artblog http:/www.fallonandrosof.com/2004/05/doing-time.html roberta fallon and libby rosof\'s artblog 1 of 7 6/24/05 2:55 PM artblog http:/www.fallonandrosof.com/2004/05/doing-time.html about art reviews, deep thoughts, and gossip from Philad... Date Added: 2009-08-10 20:23:32 |
| Prototype Requirements Graded.pdf Path: Oakland University >> ME >> 463 Fall, 2009 Description: AME40463 Senior Design Project: Spring 2008 Prototype Evaluation Criteria 4/19/2008 Date: _ Group B3: Spinnitech 75 Overall Rating (out of 90): _ 15 Rating: _ 1. Throughput (15 pts.) 15 pts: 10 pts: 5 pts: 0 pts: Each step finishes in 20 seconds ... Date Added: 2009-08-10 20:23:43 |
| 13 Mill2.pdf Path: Western Michigan >> HIST >> 3360 Fall, 2008 Description: Women in European History John Stuart Mill, Continued 1. Discussion Oct. 31, 2006 What were Mill\'s solutions to the gender inequality of his times? List as many as you can see in his work. 2. In presenting his argument, Mill had quite a bit to sa... Date Added: 2009-08-10 20:24:53 |
| hw4.pdf Path: Old Dominion >> PHYSICS >> 112 Fall, 2009 Description: ... Date Added: 2009-08-10 20:25:32 |
| phys213lec29.pdf Path: Montana >> PHYSICS >> 213 Fall, 2009 Description: Lecture 29: 3/31/06 Homework HW#9 posted on web tonight, due next Friday MP#22 is due Monday at 5pm. MP#21 is due Friday at 5pm. Read 41.3-41.8 Practice problems from Serway (Not to be turned in!) Problems 41-1, 41-2, 41-41 (Solutions on bulletin b... Date Added: 2009-08-10 20:26:04 |
| hw5.pdf Path: Whatcom Community College >> CIS >> 125 Fall, 2009 Description: CIS 125 Homework # 5 Name _ 1. True/False: In order to transfer a file with FTP, both computers must be running the same operating system. 2. Which of the following file extensions denotes that a file should be transferred in ASCII mode? a. ... Date Added: 2009-08-10 20:27:29 |
| Hw13.pdf Path: George Mason >> MATH >> 351 Fall, 2008 Description: ... Date Added: 2009-08-10 20:28:07 |
| 1124.pdf Path: UPenn >> CIS >> 500 Fall, 2009 Description: CIS 500 Software Foundations Fall 2003 24 November CIS 500, 24 November 1 Plans This week: Chapter 18 (not 19, as earlier predicted) Next week: Chapter 19 Final class: Monday, December 8 (review session) Final exam: Wednesday, December 17th There ... Date Added: 2009-08-10 20:28:52 |
| finalproject.pdf Path: Old Dominion >> CPSC >> 360 Fall, 2009 Description: CPSC 360 Spring 2005 Weigle Final Project Assigned: Friday, March 18, 2005 You may work in groups of 2 or 3 for this project. (You must get approval from me to work alone.) You may choose one of the suggested projects described below or propose yo... Date Added: 2009-08-10 20:30:32 |
| Transformation201.pdf Path: Bellevue College >> BIOLOGY >> 211 Fall, 2009 Description: Transformation of E. coli with pGAL DNA can be incorporated into some bacteria by the process of transformation. The Streptococcus pneumoniae bacteria that Fred Griffith studied in 1928 used transformation to incorporate the genes for capsule product... Date Added: 2009-08-10 20:32:32 |
| EATING VOCABULARY.doc Path: Pima CC >> JGILMARTIN >> 9172 Fall, 2009 Description: EATING VOCABULARY 1. 2. 3. 4. 5. 6. 7. 8. 9. 10. 11. 12. 13. 14. 15. 16. 17. 18. 19. Table: Zhuo zi Chair: Yi zi Bowl: Wan Plate: Pan zi Cup: Bei zi Spoon: Shao zi Napkin: Can jin zhi Chopsticks: Kuai zi Food: Fan, Cai, Can Rice: Mi fan Meat: Rou Veg... Date Added: 2009-08-10 20:34:11 |
| MAT515Homework1.pdf Path: SUNY Stony Brook >> MAT >> 515 Fall, 2008 Description: The homework is divided into two sections. The first section consists of problems which you must hand in. The second section consists of problems which you do not have to hand in. You should try to solve all the homework problems. Homework will serve... Date Added: 2009-08-10 20:34:54 |
| ButtonExample1.txt Path: UMBC >> CSEE >> 202 Spring, 2001 Description: package swingExamples; / ButtonExample1 / JFrame with one button import javax.swing.JFrame; import javax.swing.JButton; public class ButtonExample1 { private JFrame frame; private JButton button1; public ButtonExample1( ) { / create JFrame... Date Added: 2009-08-10 20:35:16 |
| Technology Questions for the Coordinator.doc Path: Cleveland State >> ETE >> 566 Fall, 2009 Description: Technology Questions for the Coordinator 1) 2) 3) 4) 5) 6) What is your job title? What does your job entail? How would you like to see technology used throughout the district? What grants are available for technology use? Who is the current district... Date Added: 2009-08-10 20:36:07 |
| 10Rain.ppt Path: Fond du Lac >> MLG >> 100 Fall, 2009 Description: Condensation, Clouds and Precipitation Condensation, Clouds and Precipitation 1 Condensation, Clouds and Precipitation Introduction Systems Earth\'s Atmosphere Energy and EarthSun Relationships Energy Balance Temperature Pressure and Wind... Date Added: 2009-08-10 20:36:21 |
| acceleration-in-nozzle.pdf Path: Washington >> ME >> 333 Fall, 2009 Description: ... Date Added: 2009-08-10 20:37:12 |
| Oliphant_article.pdf Path: Washington >> HIST >> 112 Winter, 2008 Description: ... Date Added: 2009-08-10 20:37:52 |
| 06-swingintro.pdf Path: NSCC >> CSC >> 143 Fall, 2009 Description: Overview Roadmap Today: introduction to Java Windows and graphical output Future: event-driven programs and user interaction CSC 143 Java Introduction to Graphical Interfaces in Java: AWT and Swing Reading: Sec. 17.1-17.3, 17.7 Topics A bit of... Date Added: 2009-08-10 20:37:56 |
| exit_values.sh.txt Path: Parkland >> CSC >> 128 Fall, 2009 Description: #!/bin/bash echo this used to be the speed limit exit 55 ... Date Added: 2009-08-10 20:38:08 |
| lab_groups.txt Path: Parkland >> CSC >> 128 Fall, 2009 Description: Groups Lab 15 points. Read the web page that I have linked to in Week14. Also read and look at the man pages for the utilities and practice the utilities that are on the web page. Then make a directory in your bin called groups In that directory ... Date Added: 2009-08-10 20:38:13 |
| Chapter5&10.pdf Path: North Central State College >> PSY >> 160 Fall, 2009 Description: Male Sexual Anatomy and Physiology Chapter 5 External male anatomy Penis reproductive, urinary and sexual Average size flaccid 3.75 inches x 1.2 inches Average size erect 6 inches x 1.5 inches The foreskin protects the glans penis from abrasions a... Date Added: 2009-08-10 20:38:55 |
| B&B\'02_19_speciation .pdf Path: Holy Cross College >> BIO >> 117 Fall, 2009 Description: THE PROCESS OF SPECIATION * We usually think of species as a collection of individuals which share a common phenotype including morphology, behavior and ecological relationships with their environment. This view is based on what is known as the typ... Date Added: 2009-08-10 20:39:21 |
| csc317a3.pdf Path: SD State >> CSC >> 317 Fall, 2009 Description: Computer Organization & Architecture Assignment #3 Gamradt Due: 02-11-05 Show all work and clearly label everything using the techniques and conventions shown in class. Design a binary counter: 1) 2) Using T flip-flops with the following cou... Date Added: 2009-08-10 20:39:28 |
| lecture06.pdf Path: Miami >> CSC >> 220 Fall, 2008 Description: Lecture 6 CSC220: Programming II (Data Structures) - Fall 2002 Dr. Christian A. Duncan csc220@mail.cs.miami.edu 1 Announcements Read Chapter 4 by next Tuesday. Quiz this Thursday (on Chapters 1 and 2) Lab 2 due this Wednesda... Date Added: 2009-08-10 20:39:31 |
| Rintanen2.ps Path: CSU Channel Islands >> ICS >> 280 Fall, 2009 Description: %!PS-Adobe-2.0 %Creator: dvipsk 5.58f Copyright 1986, 1994 Radical Eye Software %Title: ijcai99qbf.dvi %Pages: 6 %PageOrder: Ascend %BoundingBox: 0 0 596 842 %EndComments %DVIPSCommandLine: dvips ijcai99qbf.dvi -D 600 -Z -o ijcai99qbf.ps %DVIPSParame... Date Added: 2009-08-10 20:40:39 |
|
|
Get Started With Course Hero Today!
Get study guides, join study groups, and more!
Sign up in seconds with your Facebook account!
Course Hero is a Facebook Application Partner.
Click below to sign-up for FREE.
Our Social Learning Network was built to provide students and key learning partners like professors a platform to share, meet and collaborate while accelerating their comprehension of course-related theories and concepts. We are committed to providing you immediate access to a growing wealth of study materials and an unparalleled academic network of students, professors and other key partners. Why do you care? Because you want the best grade possible and at times need a 24/7 resource that’s responsive to your needs. |
|
What People Are Saying About Course Hero
|
|||
|
|||
|
Explore the benefits of joining Course Hero's social learning network.
|
|||
 |
Get millions of study materials now!Need lecture notes for a missed class or want insightful explanation of the theories and concepts you learn in class? Look no further, Course Hero’s Study Materials empowers you to find a broad and deep set of materials that can help you right now!
Click below to sign-up for FREE.
|
||
 |
Get over 200,000 textbook solutions now!Having difficulty with your homework and need documents that are relevant for your Textbook? Don't be frustrated. Course Hero's Textbook Help presents you study materials from many college courses.
Click below to sign-up for FREE.
|
||
 |
Meet over 300,000 students and your fellow classmates now!Want to meet your current classmates or those that took the class last year? Don’t worry or have anxiety. Course Hero’s Study Groups gives you the seamless opportunity to develop both anonymous or direct relationships with those classmates whom you want to meet and get help from right now!
Click below to sign-up for FREE.
|
||
