Course Solutions And Notes - Lecture 7-GSA-GrantWriting(385) b6
| LAB2-ABSTRACT-ASSIGNMENT.doc Path: IPFW >> BIOL >> 219 Fall, 2008 Description: RESEARCH ABSTRACT ASSIGNMENT: Biology 219, Fall 2006 Prepare an abstract for the shoot gravitropism experiment. An abstract contains all of the same basic components as a research paper (Introduction, Methods, Results, and Discussion), but in abbrevi... Date Added: 2009-06-03 07:45:54 |
| PreparationMATH175test3.pdf Path: Boise State >> MATH >> 175 Fall, 2008 Description: \"MATH. 175. PREPARATION FOR TEST 3, SPRING 2009\" The test material is from sections 8.1, 8.2, 8.3, 8.4 and 8.5 from the book. Besides Calculus I (prerequisite) and the previous material learned in this course you should know: What is infinite seque... Date Added: 2009-06-03 07:47:39 |
| advertising.pdf Path: LSU >> APPL >> 003 Fall, 2008 Description: www.manship.lsu.edu Degree: Bachelor of Arts in Mass Communication Total Semester Hours for Degree: 128 Area Head: Lance Porter ph: 225-578-7377 email: lporter@lsu.edu To pursue this major, students must be admitted to the School of Mass Communicatio... Date Added: 2009-06-03 07:47:54 |
| ece6730_a5.pdf Path: Utah >> ECE >> 6730 Fall, 2008 Description: ECE 6730: RF Integrated Circuit Design Spring 2009 Assignment #5 Topic: Mixers, VCOs Due Date: Apr. 7, 2009 Problem 1: Shown in Fig. 1 is a BJT operating as a mixer. Assuming that VLO = V1 cos LO t and VRF = V2 cos RF t, calculate the conversion g... Date Added: 2009-06-03 07:50:08 |
| WA_20080501.pdf Path: Washington >> ESS >> 200805 Fall, 2009 Description: WA 2008/ 5/ 1 0:00:00; 1.5 - 5.0 Hz; Envelope lowpass at 0.05 Hz 0 SNB-Z 15 -1 MCW-Z 10 -2 RPW-Z 15 -3 B001-Z 20 -4 B007-Z 20 -5 SQM-Z 100 -6 B013-Z 20 -7 HDW-Z 30 -8 GNW-Z 15 -9 CPW-Z 10 -10 0 0.1 0.2 0.3 0.4 0.5 0.6 0.7 ... Date Added: 2009-06-03 07:51:06 |
| WA_20080516.pdf Path: Washington >> ESS >> 200805 Fall, 2009 Description: WA 2008/ 5/16 0:00:00; 1.5 5.0 Hz; Envelope lowpass at 0.05 Hz 0 SNBZ 20 1 MCWZ 10 2 RPWZ 15 3 B001Z 30 4 B007Z 20 5 SQMZ 100 6 B013Z 40 7 HDWZ 100 8 GNWZ 20 9 CPWZ 10 10 B018Z 20 11 0 0.1 0.2 0.3 0.4 0.5 0.6 0.7 0.8 0... Date Added: 2009-06-03 07:51:08 |
| OR_20080827.pdf Path: Washington >> ESS >> 200808 Fall, 2009 Description: OR 2008/ 8/27 0:00:00; 1.5 5.0 Hz; Envelope lowpass at 0.05 Hz 0 KMOZ 20 1 VLLZ 80 2 TDHZ 80 3 SSOZ 40 4 GMOZ 50 5 FRISZ 20 6 HUOZ 10 7 MOONZ 40 8 IROZ 10 9 DBOZ 20 10 BBOZ 30 11 0 0.1 0.2 0.3 0.4 0.5 0.6 0.7 0.8 0.9 ... Date Added: 2009-06-03 07:51:26 |
| OR_20080410.pdf Path: Washington >> ESS >> 200804 Fall, 2009 Description: OR 2008/ 4/10 0:00:00; 1.5 - 5.0 Hz; Envelope lowpass at 0.05 Hz 0 KMO-Z 20 -1 VLL-Z 80 -2 TDH-Z 80 -3 SSO-Z 40 -4 GMO-Z 50 -5 FRIS-Z 20 -6 HUO-Z 10 -7 MOON-Z 40 -8 IRO-Z 10 -9 DBO-Z 20 -10 BBO-Z 30 -11 0 0.1 0.2 0.3 45N 120W... Date Added: 2009-06-03 07:52:01 |
| 2025-L04.pdf Path: Georgia Tech >> ECE >> 2025 Fall, 2008 Description: EE-2025 Fall-2000 Web-CT Info Bulletin Board has all OFFICIAL msgs Consult the FAQs Lectures are being posted PDF format (4 per page) Lecture 4 Spectrum Representation 1-Sept-00 Upcoming Events: Quiz #1 on 18-Sept (Monday) 8/30/00 ECE-2025 ... Date Added: 2009-06-03 07:52:50 |
| 08-set-theory.pdf Path: St. Mary MD >> CS >> 773 Fall, 2009 Description: ! w y g i l p y h QRS y \" c QS 2 b 9 v u Q 6 ! P hu 9 Y # P f 5 y # 1 c 5 Q ~ 6 B a x 2 Q 2... Date Added: 2009-06-03 07:53:18 |
| down389.txt Path: Case Western >> BXS >> 389 Fall, 2009 Description: >ATPD_ANASP (P12406) ATP synthase delta chain (EC 3.6.3.14). MTSKVANTEVAQPYAQALLSIAKSKSLTEEFGTDARTLLNLLTENQQLRNFIDNPFIAAE NKKALIKQILSEASPYLRNFLLLLVDKRRIFFLPEILQQYLALLRQLNQTVLAEVTSAVA LTEDQQQAVTEKVLALTKARQVELATKVDSDLIGGVIIKVGSQVIDSSIRGQLRRLSLRL SNS >A... Date Added: 2009-06-03 07:53:56 |
| upperMS.pdf Path: Case Western >> ASTR >> 311 Fall, 2009 Description: The Upper Main Sequence O stars OBN and OBC stars Wolf-Rayet stars Meredith Danowski Astronomy 411 Feb. 14, 2007 Oh! O-stars Massive, bright, hot, bluest, shortest lifetime (3-6 Myr) Rarest main sequence stars (1 in 32,000) 30,000-60,000K 20-100 Ms... Date Added: 2009-06-03 07:53:58 |
| DesignPrinciples.pdf Path: Case Western >> EECS >> 444 Fall, 2009 Description: Design Principles Source: Computer Security: Art & Science by M. Bishop. Saltzer and Schroeder described eight principles for the design/implementation of security mechanisms. They are based on simplicity and restriction. The simpler a design is, the... Date Added: 2009-06-03 07:54:03 |
| crystal_kinet_08.pdf Path: Case Western >> EMAC >> 403 Fall, 2009 Description: 1 Crystallization kinetics. Kinetics of crystallization depends on both the diusion of the polymer and nucleation. Spherulite nucleation and growth occurs in three stages 1) nucleation 2) growth of spherulites 3) crystal thickening. Theoretically, ... Date Added: 2009-06-03 07:54:29 |
| assignment7.pdf Path: Texas San Antonio >> CS >> 2213 Fall, 2008 Description: CS 2213, Spring 2009 Assignment 7: Phone Book 1I Due: 5pm, Monday, April 13, 2009 Goal: The purpose of this assignment is to learn to use AA Trees to implement the Dictionary ADT. Objectives: be able to write code to implement insertion into an AA Tr... Date Added: 2009-06-03 07:54:54 |
| Lect11-Plan.pdf Path: Texas San Antonio >> CS >> 3773 Fall, 2008 Description: Software Management CS3773 Software Engineering Software engineering is a managed process People management Software cost estimation Quality management Configuration management Proposal writing Software planning Project monitoring Personnel selec... Date Added: 2009-06-03 07:55:11 |
| hw2.pdf Path: GWU >> CS >> 212 Fall, 2009 Description: George Washington University Department of Computer Science Csci 212 - Homework 2 Due date: March 13, 2009 Email to bowuzh@gwmail.gwu.edu by 11:59PM or submit to CS Dept by 5PM. 1. Consider the following Interval Coloring Problem. INPUT: A set S = {(... Date Added: 2009-06-03 07:55:59 |
| ePave.doc Path: Princeton >> CIV >> 401 Fall, 2009 Description: Delwin Olivan ePave In this project I will demonstrate how the integration of PHP, mySQL, and XML can increase the efficiency and decrease the amount of time required to maintain the site. By implementing HTML forms that update the various pages on t... Date Added: 2009-06-03 07:56:05 |
| 06-sql.pdf Path: Duke >> CPS >> 116 Fall, 2009 Description: Announcements (September 13) Homework #1 due next Tuesday 2 SQL: Part I CPS 116 Introduction to Database Systems Do we need a help session on Monday? Course project assigned today Choice of standard or open One- to three-person teams Two mileston... Date Added: 2009-06-03 07:57:05 |
| 102syll.pdf Path: Duke >> MTH >> 102 Fall, 2009 Description: Syllabus for Math 102, Fall 07-08, Clark Bray Mathematics for Economists, Simon and Blume; Notes on Integrals for Math 102, Bray (Note: New homework problems will be added throughout semester; be sure you are looking at a current version!) Linear Alg... Date Added: 2009-06-03 07:57:30 |
| Quiz10Key.pdf Path: Alabama >> CS >> 385 Fall, 2008 Description: CS385 1. Trapping 2. On Error 3. Branch 4. Err.Number 5. branch 6. On Error 7. Resume 8. Raise 9. Object 10. Runtime 11. Properties 12. Event 13. Text box 14. Label 15. List box 16. Command button 17. frm 18. End 19. SetFocus 20. Initialize Quiz 10 ... Date Added: 2009-06-03 07:59:26 |
| Solutions_molecular-spec-UV-Vis.pdf Path: Hudson VCC >> CHEM >> 221 Fall, 2009 Description: Solutions: Molecular spectrometry UV/Vis ... Date Added: 2009-06-03 08:11:54 |
| mauquills320.pdf Path: Hudson VCC >> ENGS >> 320 Fall, 2009 Description: ... Date Added: 2009-06-03 08:12:04 |
| P.pdf Path: BYU >> ME >> 440 Fall, 2009 Description: ME340-002 FALL 2005 Heat Transfer Class Project Heat transfer is a physical phenomenon which occurs in all situations where a temperature difference exists. It can be observed in micro-scale and in the scale of the universe, in the performance of com... Date Added: 2009-06-03 08:16:01 |
| sqlserver.txt Path: Benjamin Franklin Institute of Technology >> CSE >> 5260 Fall, 2009 Description: - Go to the \"developer\" folder on the cd - Double click \"Auto Run\" - Select \"SQL Server 2000 Components\" - Select \"Install Database Server\" - Be sure to install both server and client tools - Be sure to select Windows AND SQL Server authenticat... Date Added: 2009-06-03 08:19:51 |
| slides7_09.pdf Path: UC Davis >> ECON >> 260 Fall, 2009 Description: (4/27/09) Topic 7: Law of One Price and International Goods Market Integration; Part1: Empirical evidence on the Law of One price Motivation: - Recall that four of the five reasons for failures in PPP deal with failures in the law of one price: - no... Date Added: 2009-06-03 08:19:55 |
| sp09-hwk3.pdf Path: UNC Charlotte >> MBAS >> 6310 Spring, 2008 Description: Sports Economics Spring 2009 Homework #3 Name: _ Answer the following questions as completely as possible. You can use this file and email it to me or use your own paper. You can cooperate with each other, but each student must turn in their own co... Date Added: 2009-06-03 08:21:22 |
| week4-m.ppt Path: Augustana >> HELIOS >> 103 Fall, 2009 Description: PH 103 Dr. Cecilia Vogel Lecture 9 Review diffraction interference Outline Microscope Virtual object Coherence diffraction grating Spectral analysis Microscope Two lenses can do more than one Type of lens: two converging lenses objective len... Date Added: 2009-06-03 08:22:31 |
| 472hw3.pdf Path: ASU >> MAT >> 472 Fall, 2009 Description: ... Date Added: 2009-06-03 08:23:03 |
| VegCropUpdate-10.pdf Path: Wisconsin >> BLOG >> 605 Fall, 2009 Description: Vegetable Crop Update - #10 July 24, 2008 The vegetable crop update is archived on the Wisconsin Crop Manager website at: http:/ipcm.wisc.edu/wcm/. We welcome your input and suggestions. Important Dates: Bean Variety and Sweet Corn Hybrid Demo, Centr... Date Added: 2009-06-03 08:24:15 |
| module21-mcast.pdf Path: UVA >> CS >> 458 Fall, 2008 Description: IP Multicasting Relates to Lab 10. It covers IP multicasting, including multicast addressing, IGMP, and multicast routing. 1 Applications with multiple receivers Many applications transmit the same data at one time to multiple receivers Broadcas... Date Added: 2009-06-03 08:24:59 |
| 02-baby_shower.ppt Path: UC Davis >> ATT >> 0501 Fall, 2009 Description: We\'re having a baby shower for Julie Pelletier (Harada lab) and Nancy Hofmann (Theg lab)! When: Jan. 31st, 2:00 p.m. Where: 1020 LSA What: Refreshments and gift-opening. If you have parenting advice or storiesbring them to share! If you would like... Date Added: 2009-06-03 08:27:09 |
| museum_CV3.pdf Path: Pittsburgh >> WIND >> 0083 Fall, 2009 Description: Robert S. Stephenson 1558 Leavenworth Street, San Francisco, CA 94109 home: 415 373-5239, cell: 415 341-3784, email: rstephe@alumni.princeton.edu Summary As an e-learning and collaboration architect, my focus lies at the intersection of education, ... Date Added: 2009-06-03 08:28:00 |
| heating_cooling_complete.pdf Path: Texas A&M >> MATH >> 308 Fall, 2008 Description: Heating and Cooling of Building Let T(t) represent the temperature inside a building at time t. Here we just consider the effect of the outside temperature M(t) on the temperature inside the building. Experimental evidence has shown that this factor ... Date Added: 2009-06-03 08:28:43 |
| MCE466-19.ppt Path: Maryville MO >> MCE >> 466 Fall, 2009 Description: Chapter 11 Three-Dimensional Stress Analysis Topics: 3-D Stress Analysis Tetrahedral Elements (4 and 10 node) Hexahedral (Brick) Elements (8 and 20 nodes) Abaqus tutorial 3-D Analysis 1 Stress Components 3-D Problems 2 Strain Components 3... Date Added: 2009-06-03 08:29:31 |
| 37_WorkBookSolutions.pdf Path: Maryland >> PHYS >> 270 Fall, 2008 Description: ... Date Added: 2009-06-03 08:30:00 |
| lottery.pdf Path: Sanford-Brown Institute >> CS >> 148 Fall, 2009 Description: CS148 Building Intelligent Robots Enrollment Form Name: Email: Grad Year: Concentration: 23 Jan 2003 Enrollment in CS148 is limited to 26 students. It is therefore important that each student be dedicated to the course and put forth significant eff... Date Added: 2009-06-03 08:36:14 |
| T040070-00.pdf Path: Caltech >> T >> 040070 Fall, 2009 Description: LASER INTERFEROMETER GRAVITATIONAL WAVE OBSERVATORY LIGO Laboratory / LIGO Scientific Collaboration LIGO- T040070-00-R 4/20/2004 Research Plan on Noise Effects of Electric Charge on Advanced LIGO Gregg Harry Distribution of this document: LIGO S... Date Added: 2009-06-03 08:36:15 |
| S3_105.pdf Path: Caltech >> ACM >> 105 Fall, 2008 Description: ACM 105 Problem Set 3 Solutions Stphane Lintner e October 29,2003 Problem 1 Prove that if the -algebra B is generated by a collection C of subests of Y , and F : X Y is any map, Then f -1 (B) is the -algebra generated by f -1 (C). Solution Let A den... Date Added: 2009-06-03 08:36:34 |
| Visit Florida - analysis9.doc Path: CSU Northridge >> VCMKT >> 004 Fall, 2009 Description: VISIT FLORIDA Research 1. Company Analysis 2. Competitive Analysis 3. Consumer Analysis 4. SWOT Analysis Amy Thomas Mkt. 642 September 24, 2003 Page 1 of 6 Company Analysis: VISIT FLORIDA holds the primary goal of increasing the usage of the Florid... Date Added: 2009-06-03 08:36:44 |
| InsideGrundyCountyFebruary292008.pdf Path: Iowa State >> NR >> 89291 Fall, 2009 Description: INSIDE GRUNDY COUNTY February 29, 2008 by Bill Arndorfer Grundy County Extension Education Director You can attract or discourage birds from taking up residence near your home or farmstead by altering the surrounding environment. The publication Mana... Date Added: 2009-06-03 08:38:18 |
| 13642.txt Path: UCCS >> CS >> 591 Fall, 2009 Description: Rule: - Sid: 13642 - Summary: This event is generated when activity relating to the spyware application \"easy Keylogger\" is detected. - Impact: Unkown. Possible information disclosure, violation of privacy, possible violation of policy. - Detaile... Date Added: 2009-06-03 08:40:08 |
| 07Ffinsoln.pdf Path: Oklahoma State >> MATH >> 2153 Fall, 2008 Description: Math 2153 Final Exam 1. We exchange variables x and y and then solve for y. 1 + ln y 2 + ln y (2 + ln y)x = 1 + ln y 2x + (ln y)x = 1 + ln y 2x 1 = ln y (ln y)x 2x 1 = (1 x) ln y 2x 1 = ln y 1x 1 0 2x 1 A @ y = e 1x x= Solutions (Multiply bot... Date Added: 2009-06-03 08:40:27 |
| Lect_20_FeatrSub_2.pdf Path: UT Arlington >> CSE >> 5367 Fall, 2008 Description: Randomized Feature Subset Selection Exponential search methods - Branch and Bound (BNB) - Approximate monotonicity with branch and bound Randomized algorithms - Random generation plus sequential selection - Simulated annealing - Genetic algorithms ... Date Added: 2009-06-03 08:41:51 |
| Math422prosp04.pdf Path: Washington University in St. Louis >> MATH >> 422 Fall, 2009 Description: Math 422, Theory of Functions of a Complex Variable II Spring 2004 Instructor: David Wright Office: Room 114, Cupples I Phone: 314 935-6781 (office) E-mail: wright@einstein.wustl.edu Website: www.math.wustl.edu/~wright/ MWF 2:00-3:00 Office Hours:... Date Added: 2009-06-03 08:42:20 |
| 2008_uhcl_Fianalpublication010609.pdf Path: UH Clear Lake >> TAB >> 701382 Fall, 2009 Description: Solutions Through Education Humanity Coming Together Connecting Cultures - An Interview with Commemorating NASAs 50th Anniversary World Glimpses Accounting Outreach - Micro Lending Turkish Ambassador and Consul General Atila Uzer A Publicatio... Date Added: 2009-06-03 08:42:52 |
| 4_Grafton.pdf Path: Princeton >> PUP >> 100 Fall, 2009 Description: History, Politics, and Culture Anthony Grafton In , Princeton University Press published a slender book by one of its longtime authors, Felix Gilbert: History: Politics or Culture? Reections on Ranke and Burckhardt. This learned and eloquent study of... Date Added: 2009-06-03 08:46:55 |
| April_3_2009_ppt.pdf Path: Midwestern State University >> AS >> 350 Fall, 2009 Description: Fig. 10-10 Fig. 10-12 Number of stages in spermatogenesis Species Bull Mouse Rat Quail Dog Boar Stallion Man The stages make up one cycle. Stages 12 12 14 10 8 8 8 6 The length of time to complete each stage is different The cycle of the seminife... Date Added: 2009-06-03 08:47:26 |
| l17post.ppt Path: Michigan State University >> PSY >> 395 Summer, 2008 Description: Lecture 17: Internal Validity and Experiments Outline No Review Exam 2 Causal Relations Video Games and Violence Internal Validity Threats to Internal Validity To Show Cause and Effect (J. S. Mill) X must precede Y in Time X must covary wit... Date Added: 2009-06-03 08:47:59 |
| ex9f.doc Path: Catholic >> FACULTY >> 301 Fall, 2009 Description: Chapter 9 Exercise F For the sake of clarity, Ive color coded the major, minor and middle terms in each answer. 2) All material systems are systems governed by the laws of physics All living systems are material systems All living systems are system... Date Added: 2009-06-03 08:48:18 |
| hw13-3.pdf Path: UPenn >> MWRIGHT >> 114 Fall, 2009 Description: Math 114, Section 13.3, Problem 49 We will use a scalar projection to find the distance from a point P1 (x1 , y1 ) to the line ax + by + c = 0. Strategy: Let n be a vector in the plane orthogonal to the line. Let v be a vector from any point on the l... Date Added: 2009-06-03 08:54:10 |
| week_in_review_4.pdf Path: Ill. Chicago >> CHEM >> 222 Fall, 2008 Description: ... Date Added: 2009-06-03 08:54:43 |
| maxmin.pdf Path: N.C. State >> MATH >> 133 Fall, 2009 Description: An amazing article on Calculus 1 MAX-MIN! The notion of max-min problems is something that is tackled in just about every calculus class. Yet, the proof behind it is wonderful yet often ignored. We won\'t fall for that mistake! Indeed, the problem o... Date Added: 2009-06-03 08:55:34 |
| hw10.pdf Path: Ill. Chicago >> MATH >> 18781 Fall, 2009 Description: Homework due Wednesday December 8. Read Chapter 6 and sections 8.1, 8.2 and 8.4 in An Introduction to the Theory of Numbers. Problems to turn in: page 300 section 6.1 problems: page 307 section 6.2 problems: page 311 section 6.3 problems: page 319 se... Date Added: 2009-06-03 08:55:48 |
| sec1.pdf Path: Stanford >> CS >> 121 Fall, 2009 Description: CS121 Section 1 April 10, 2009 Search Space Formulation A search space consists of the following: General definition of a state Initial state Goal test Successor function Problem 1: The Monkey and the Bananas (from 3.7, page 90 in Russell & Norvig. M... Date Added: 2009-06-03 08:56:02 |
| lecture23.pdf Path: Cornell >> CS >> 6810 Fall, 2009 Description: COM S 6810 Theory of Computing April 14th, 2009 Lecture 23: PCP: Probabilistic Checkable Proofs Instructor: Rafael Pass The idea behind a probabilistic checkable proof is: the prover writes a proof the verier is lazy and/or does not have time, an... Date Added: 2009-06-03 08:56:13 |
| hw1.pdf Path: N.C. State >> PY >> 506 Fall, 2008 Description: ( UTA 4 D DH 4 2C yT q vC U4 qT q p UA f 64 U4 fAR4 p p CR x4 4 2C D CA 2 0Y ob08@b8@5t5QQ@b4 @8cQCC@8S 6TCR4C4 p 4 2C TC CR H46 2 D Y H46 CA D 4 2C )H U C v4 U p UA H UTA TC... Date Added: 2009-06-03 08:56:49 |
| exposure.pdf Path: Stanford >> CS >> 148 Fall, 2009 Description: Exposure and Tone Mapping Topics Perception of light intensities Camera exposure Exposure correction - levels and curves Creating a high dynamic range (HDR) image Displays and gamma HDR and tone reproduction CS148 Lecture 12 Pat Hanrahan, Winter 2... Date Added: 2009-06-03 08:57:19 |
| 08_HEA09_Supenovae_Remnants_1.pdf Path: East Los Angeles College >> PHYS >> 20692 Fall, 2009 Description: High Energy Astrophysics Supernovae and their Remnants 1/2 Giampaolo Pisano Jodrell Bank Centre for Astrophysics - University of Manchester giampaolo.pisano@manchester.ac.uk March 2009 Supernovae and their remnants - Introduction - Evolution of low... Date Added: 2009-06-03 08:58:18 |
| l1.pdf Path: UMass (Amherst) >> PUBP >> 608 Fall, 2009 Description: Outline Causality Data Research Design Notation Research Design, Causality, Data Michael Ash Lecture 1 Michael Ash Research Design, Causality, Data Outline Causality Data Research Design Notation Causality Statistical correlation is not causali... Date Added: 2009-06-03 08:58:22 |
| transcriptionkey.pdf Path: UMass (Amherst) >> LING >> 201 Fall, 2009 Description: lose [luz] loose [lus] breath [br ] breathe [bri] circus [s rk s] price [prajs] whale [wejl] isnt [ z nt] boyish [b j ] loudly [lawdli] rhythm [r m] batch [b ] cookies [k kiz] vision [v n] cringe [kr n ] January [ njuri] / [ nju ri] wrapped [rpt]... Date Added: 2009-06-03 08:59:08 |
| morgan1.pdf Path: Stanford >> SEP >> 103 Fall, 2009 Description: Stanford Exploration Project, Report 103, April 27, 2000, pages 205231 204 Stanford Exploration Project, Report 103, April 27, 2000, pages 205231 Ground roll and the Radial Trace Transform revisited Morgan Brown and Jon Claerbout1 ABSTRACT The R... Date Added: 2009-06-03 08:59:29 |
| prelim2soln.pdf Path: Cornell >> CHEM >> 390 Spring, 2008 Description: ChemE 3900 - Chemical Kinetics & Reactor Design Solution to 2nd Preliminary Exam, Spring 2009 1. The first experiment is represented by a rectangle with one vertex at the origin and the opposite vertex at X = 0.4, y = the 1/rate line. For all four pl... Date Added: 2009-06-03 09:00:00 |
| lebesgue-09.pdf Path: Stanford >> MATH >> 175 Fall, 2009 Description: Mathematics Department Stanford University Math 175 Lecture SupplementThe Lebesgue Integral L EON S IMON S PRING Q UARTER , 2009 These notes are meant as a quick introduction, assuming a minimum background in mathematical analysis, to the Lebesgue i... Date Added: 2009-06-03 09:01:30 |
| 2006112_f01n_0502406.pdf Path: Stanford >> DITC >> 1034 Fall, 2009 Description: Case 3:05-cv-02406-JSW Document 29-1 Filed 01/12/2006 Page 1 of 5 1 MILBERG, WEISS, BERSHAD & SCHULMAN, LLP 2 JEFF S. WESTERMAN (SBN 94559) KAREN T. ROGERS (SBN 185465) 3 355 South Grand Avenue, Suite 4170 Los Angeles, California 90071 4 Telephon... Date Added: 2009-06-03 09:02:01 |
| eee213.pdf Path: CSU Sacramento >> INDIV >> 90905 Fall, 2009 Description: EEE 213 Instructor Office : : MICROWAVE DEVICES AND CIRCUITS Preetham B. Kumar RVR 5006 FALL 2005 Office hours: MW: 11 a.m.- 1 p.m. Telephone : Internet : Prescribed Texts : References: 278-7949 http:/www.ecs.csus.edu/eee/bios/kumar.html \'Microw... Date Added: 2009-06-03 09:02:08 |
| pt.pdf Path: Kentucky >> MS >> 0304 Fall, 2009 Description: University of Kentucky Physical Therapy The Division of Physical Therapy offers the dual B.H.S./M.S. in Physical Therapy degree. The selection of students for the Dual Degree sequence will be on a competitive admissions basis with specific informati... Date Added: 2009-06-03 09:02:27 |
| pp-sols-1.pdf Path: Texas Tech >> MATH >> 2350 Fall, 2008 Description: REVIEW PROBLEMS FOR MATH 2350 SOLUTIONS Problem 1: Let F(t) be the vector-valued function F(t) = cos(t)i + sin(t) cos(t)j + sin2 (t)k, dened for all t. (a) Find F (t). (b) Compute F(t) and F (t) . (Note: F(t) is constant.) (c) Show that (F F )(t) =... Date Added: 2009-06-03 09:03:26 |
| semesterproject.doc Path: UNC Greensboro >> FMS >> 121 Fall, 2008 Description: Dr. Will Derusha FMS 121-01 SEMESTER PROJECT Spring 2004 Write a formal essay, of five to seven pages, that explores the works of a Spanish artist and the relation to at least one ekphrastic text. The essay will be based on both investigation and ... Date Added: 2009-06-03 09:04:29 |
| week8.pdf Path: Texas San Antonio >> CS >> 5363 Fall, 2008 Description: Week 8 Scope Rules: Rule 1. All constants, types, variables, and procedures defined in the same block must have different names. Example: const x = 10; var x, y: integer; x is redefined! The part of a block where a defined object can be referenced is... Date Added: 2009-06-03 09:05:14 |
| MT-Class-090413-Rambow-et-al-25-may-lrec.ppt Path: Carnegie Mellon >> CMT >> 731 Fall, 2009 Description: Parallel Syntactic Annotation of Multiple Languages Owen Rambow, Bonnie Dorr, David Farwell, Rebecca Green, Nizar Habash, Stephen Helmreich, Eduard Hovy, Lori Levin, Keith J. Miller, Teruko Mitamura, Florence Reeder, Advaith Siddharthan Interlingual... Date Added: 2009-06-03 09:06:24 |
| G050099-00.pdf Path: Caltech >> G >> 050099 Fall, 2009 Description: Maraging Steel - SUS perspective for round-table discusions Justin Greenhalgh for the Suspensions group G050099-00-K Outline Data sources Properties Treatment Unknowns LIGO-G050099-00-K 2 Data sources Papers (mostly from VIRGO group) listed in T0... Date Added: 2009-06-03 09:07:27 |
| 522.pdf Path: Yale >> GEOLOGY >> 1973 Fall, 2009 Description: ... Date Added: 2009-06-03 09:11:41 |
| bp205Example2.pdf Path: Harvard >> BIOPHYSICS >> 205 Fall, 2009 Description: Genetically Engineering Yeast to Understand Molecular Modes of Speciation Mark Umbarger Biophysics 242 May 6, 2004 Abstract: An understanding of the molecular mechanisms of speciation (reproductive isolation) is potentially very powerful as it shoul... Date Added: 2009-06-03 09:12:34 |
| CONFER9(9)-ans.pdf Path: UConn >> FILES >> 201 Fall, 2009 Description: Introduction to Linguistics: 104-201B CONFERENCE 9 MARCH 22, 2002 ANSWERS TO PRACTICE PROBLEMS PRACTICE PROBLEM 9: MARCH 18 Do Exercise 10 in the textbook (p. 220). Do not draw separate tree structures for the deep structure (original, underlying st... Date Added: 2009-06-03 09:13:45 |
| class30quiz1-MATH1271.ppt Path: Minnesota >> MATH >> 1271 Fall, 2008 Description: Calculus MATH1271 > Quizzes > Class30quiz1-MATH1271 by Scot Adams 1+1= i. ii. iii. iv. 1 2 3 4 0% 1 0% 2 0% 3 0% 4 1 21 2 22 3 23 4 24 5 25 6 26 7 27 8 28 9 29 10 30 11 31 12 32 13 33 14 34 15 35 16 36 17 37 18 38 19 39 20 40... Date Added: 2009-06-03 09:16:16 |
| hmk4.pdf Path: North-West Uni. >> D >> 1103 Fall, 2009 Description: Homework #4 Economics 411-1, fall 2003 Due Wednesday, October 22 Christiano 1. This is a continuation of question 2 in the previous problem. Now think of the planner in each period as though they were a dierent person, not bound by any commitments th... Date Added: 2009-06-03 09:16:35 |
| lect_notes17.pdf Path: Lehigh >> CHM >> 436 Fall, 2009 Description: Applications of Protein Mass Spectrometry Terry D. Lee Beckman Research Institute of the City of Hope, Duarte, CA Information In A Mass Spectrum 100 80 60 40 20 400 100 627.8 545 453 591 456 515 600 552 879 735 822 372 1039 1088 1119 1255 628 1104 ... Date Added: 2009-06-03 09:16:37 |
| 3325-SingerReganSlides.pdf Path: Minnesota >> MCGIN >> 017 Fall, 2009 Description: P. Singer, Not for Humans Only Only Singer and Regan on the Moral Status of Nonhuman Animals Casey McGinnis Environmental Ethics Spring 2009 How should the effects of our actions on nonhuman beings figure in moral deliberations about the environmen... Date Added: 2009-06-03 09:16:43 |
| ICSchallenges.doc Path: Washington >> TC >> 520 Fall, 2009 Description: Challenges to Effective Information and Communication Systems in Humanitarian Relief Organizations Christina Maiers University of Washington maiers@u.washington.edu Abstract An effective information and communication system (ICS) is a central compone... Date Added: 2009-06-03 09:17:25 |
| Week6_2_emissions.pdf Path: Washington >> ATMOS >> 111 Fall, 2009 Description: Global Cumulative CO2 Emissions Global Cumulative CO2 Emissions 1990-2100 Scenarios are grouped into four categories: low, medium-low, medium-high, and high emissions. Each category contains one marker scenario plus alternatives that lead to compar... Date Added: 2009-06-03 09:18:04 |
| Liechtenstein.ppt Path: Minnesota >> ANTH >> 1095 Fall, 2009 Description: UnderConstruction. Sorryfortheinconvenience http:/news.bbc.co.uk/1/hi/world/europe/4307700.stm Understanding GlobalCultures Liechtenstein http:/www.d.umn.edu/cla/faculty/troufs/anth1095/fsweek05.html#Day09 http:/news.bbc.co.uk/1/hi/world/europe/4... Date Added: 2009-06-03 09:18:48 |
| DailyQ31Morrison1.pdf Path: St. Mary's CA >> PHYSICS >> 123 Fall, 2009 Description: Forum: Daily Interpretive Questions Times Read: 12 Date: Sat Nov 17 2007 10:32 Author: Kocher, Cassie <ck1@stmarys-ca.edu> Subject: Re: Morrison, pp3-59, for Mon 11/19 Remove Do Paul D and Sethe truly love each other, or are they just reaching out to... Date Added: 2009-06-03 09:19:33 |
| Econ1101ProfMax.pdf Path: Minnesota >> LARGELECT >> 1101 Fall, 2009 Description: Notes on: the Profit Maximizing Quantity and Cost Curves of a Perfectly Competitive Firm Below are notes about the profit-maximizing quantity and cost curves for a perfectly competitive firm. We discussed the profit-maximizing quantity in lecture on ... Date Added: 2009-06-03 09:19:47 |
| project2.pdf Path: Evansville >> CS >> 215 Fall, 2009 Description: CS 215 - Fundamentals of Programming II Spring 2005 - Programming Project 2 20 points Out: February 3, 2005 Due: February 10, 2005 Reminder: Programming Projects (as opposed to Homework problems) are to be your own work. See syllabus for denitions o... Date Added: 2009-06-03 09:19:51 |
| SCOPE.DOC Path: Washington >> DEPTS >> 593 Fall, 2009 Description: English 593: Hypertext: Blakes Four Zoas: Scope & Purpose The primary objective in this project is to create a useable and intelligent tool for scholars and students of William Blake. While the importance of The Four Zoas is generally recognized, i... Date Added: 2009-06-03 09:20:08 |
| essay_proforma.pdf Path: East Los Angeles College >> PHY >> 202 Fall, 2009 Description: PHY202 - Quantum Mechanics - Essay Marking Proforma Component Content Criteria Is the essay factually correct? Is the coverage of the topic well balanced? Does the student appear to understand the material? Is it well explained? Is there evidence of ... Date Added: 2009-06-03 09:23:26 |
| 7Mott.pdf Path: Montclair >> MEDIA >> 1988 Fall, 2009 Description: ... Date Added: 2009-06-03 09:24:57 |
| recitation-5.pdf Path: SUNY Buffalo >> CSE >> 562 Fall, 2009 Description: CSE562 Database Systems Spring 2009 Recitation Week #13 Problem 1 Consider a transaction that performs the following actions in the given order 1. Write object A 2. Write object B 3. Commit Decide whether each one of the following snapshots of the d... Date Added: 2009-06-03 09:25:15 |
| PlyNO2.pdf Path: East Los Angeles College >> ACE >> 0204 Fall, 2009 Description: parts per billion 10 20 30 40 50 60 70 80 90 0 01/04/02 02/04/02 03/04/02 04/04/02 05/04/02 06/04/02 07/04/02 08/04/02 09/04/02 10/04/02 11/04/02 12/04/02 13/04/02 14/04/02 15/04/02 16/04/02 17/04/02 18/04/02 19/04/02 20/04/02 21/04/02 22/04/02 23/04... Date Added: 2009-06-03 09:25:57 |
| 6_7_12_co-op_corner.pdf Path: Northeastern >> PDFS >> 090410 Fall, 2009 Description: 6 The Northeastern Voice April 10, 2009 Sea and hear Professor studies underwater communications BY SUSAN SALK - M ilica Stojanovic says the best way to think about the need for better underwater communications is to consider the Titanic. After th... Date Added: 2009-06-03 09:27:44 |
| 7.pdf Path: Northeastern >> PDFS >> 090130 Fall, 2009 Description: January 30, 2009 The Northeastern Voice 7 NOTABLE notable quotable William Fowler, Distinguished Professor of history, has been appointed to serve on the Honorary $50m Capital Campaign Steering Committee of the New England Historic Genealogical So... Date Added: 2009-06-03 09:27:50 |
| CdfNO2.pdf Path: East Los Angeles College >> ACE >> 0209 Fall, 2009 Description: parts per billion 10 20 30 40 50 60 70 80 90 0 01/09/02 02/09/02 03/09/02 04/09/02 05/09/02 06/09/02 07/09/02 08/09/02 09/09/02 10/09/02 11/09/02 12/09/02 13/09/02 14/09/02 15/09/02 16/09/02 17/09/02 18/09/02 19/09/02 20/09/02 21/09/02 22/09/02 23/09... Date Added: 2009-06-03 09:28:32 |
| 883018a.ppt Path: Villanova >> ECE >> 8830 Fall, 2009 Description: ECE 8830 Electric Drives Topic 18: Sensorless and Adaptive Vector Control of Induction Motor Drives Spring 2004 Introduction Position encoders/resolvers are expensive and introduce reliability con... Date Added: 2009-06-03 09:29:43 |
| Carpal_Tunnel_Info-2.pdf Path: Idaho >> EDUC >> 492 Fall, 2009 Description: What is Carpal Tunnel Syndrome? Carpal Tunnel Syndrome (CTS) is the result of an impairment to the median nerve caused by cumulative trauma through use of the muscles and tendons in and around the carpal tunnel. CTS can begin with a simple case of mu... Date Added: 2009-06-03 09:31:06 |
| NwcPM10.pdf Path: East Los Angeles College >> ACE >> 0402 Fall, 2009 Description: microgrammes per cubic metre 10 20 30 40 50 60 70 80 0 01/02/04 02/02/04 03/02/04 04/02/04 05/02/04 06/02/04 07/02/04 08/02/04 09/02/04 10/02/04 11/02/04 12/02/04 13/02/04 14/02/04 Date 15/02/04 16/02/04 17/02/04 18/02/04 19/02/04 20/02/04 21/02/04 2... Date Added: 2009-06-03 09:32:26 |
| README.txt Path: Acton School of Business >> COMP >> 422 Fall, 2009 Description: - Intel(R) Fortran Compiler for Linux* README -- Introduction The Intel(R) Fortran Compiler 10.1 for Linux* provides the performance benefits of the Intel Fortran Compiler for applications... Date Added: 2009-06-03 09:33:36 |
| eled_and_special_education.pdf Path: Messiah >> MAJORS >> 0607 Fall, 2009 Description: Elementary & Special Education Dual Certification (Department of Education) Major Requirements Major Courses Credits Semester Completed [EDUC 120] The Teaching Profession 1 _ [EDUC 201] Education and American Society 3 _ [EDUC 203] Educational Psycho... Date Added: 2009-06-03 09:35:35 |
| 14-Bpred-3x1.pdf Path: Princeton >> COS >> 471 Fall, 2009 Description: Lecture 14: Dealing with Branches ! \"# $% \' % \' Program Notes + \", -+ .! / 2 *! 6 8 % 9 # \"/ \" ( 0 \" 1 \" 34 \" \" 55 5 74 \" 5 5 5 : 34 \" 5 9 ; -( \"/ \" ! \"< / \" \" ) Distribution (Approximate Grades) C B A Distribution = > = > = ... Date Added: 2009-06-03 09:36:22 |
| 20012chs.pdf Path: VCU >> PDFS >> 20012 Fall, 2009 Description: 16 College of Humanities and Sciences AFAM BIOL m Sum er 2001 College of Humanities and Sciences African-American Studies AFAM 305 SOCIOLOGY OF THE BLACK FAMILY 11995 901 (3) MW 0600PM 0840PM CREIGHTON-ZOLLA May 30 Jul 18 (8 wks) HIBBS 0203 SA... Date Added: 2009-06-03 09:37:47 |
| Introduction.doc Path: Murray State KY >> CAMPUS >> 525 Fall, 2009 Description: Introduction Since you are taking this course as an elective, you are apparently interested in robotics. Therefore, the first question we should address is, \"Why are you interested in robotics?\" Specifically, what do you hope to get out of this cours... Date Added: 2009-06-03 09:38:53 |
| 16table3.pdf Path: Oregon State >> SR >> 1060 Fall, 2009 Description: Table 3. Effect of Palisade on Geronimo Kentucky bluegrass yields when applied to bale and flail and bale only plots, near Madras, Oregon, 2004. Treatment Bale & Flail Untreated Palisade Palisade Bale Only Untreated Palisade Palisade Rate prod/ac -1.... Date Added: 2009-06-03 09:41:04 |
| DoellerMark_set03.pdf Path: SUNY Geneseo >> PHYS >> 224 Fall, 2009 Description: Doeller, Mark L p224s09 Due Thr, Feb 12, 2009 at 23:30 Physics 224, Analytical Physics IV Written Assignment: None. Section 1 Set 3 CA ID 9117 PA 12. [1pt] Find the kinetic energy required for the electrons to resolve atomic features of size 0.11 nm... Date Added: 2009-06-03 09:41:20 |
| musiced_bs.pdf Path: Plymouth >> MTD >> 0506 Fall, 2009 Description: Plymouth State University CURRICULUM PLANNING GUIDE with APPLICATION of TRANSFER CREDIT Student: Student ID: Enrollment Date: BS MUSIC EDUCATION 2005-2006 Total semester hours required: 124 Total semester hours transferred: _ Credits To Be Taken Pl... Date Added: 2009-06-03 09:42:10 |
| educ328a.pdf Path: Moravian >> PUBLIC >> 200570 Fall, 2009 Description: MORAVIAN COLLEGE Ed 328: SOCIAL STUDIES IN THE ELEMENTARY SCHOOL Spring, 2006 Dr. Jack Dilendik 320 PPHAC email: jdilendik@moravian.edu (610) 861-1557 Office: T, Th 2:00 3:30 and Monday Eve. by Appt. The present divorce between scholarship and meth... Date Added: 2009-06-03 09:44:10 |
| educ328a.pdf Path: Moravian >> PDFS >> 200570 Fall, 2009 Description: MORAVIAN COLLEGE Ed 328: SOCIAL STUDIES IN THE ELEMENTARY SCHOOL Spring, 2006 Dr. Jack Dilendik 320 PPHAC email: jdilendik@moravian.edu (610) 861-1557 Office: T, Th 2:00 3:30 and Monday Eve. by Appt. The present divorce between scholarship and meth... Date Added: 2009-06-03 09:44:10 |
| smart-bombs-dumb-strategy.pdf Path: UPenn >> RIDER >> 790 Fall, 2009 Description: Precision Firepower: SMART BOMBS, DUMB STRATEGY You may fly over a land forever; you may bomb it, atomize it, pulverize it and wipe it clean of life-but if you desire to defend it, to protect it, and keep it for civilization, you must do this on the... Date Added: 2009-06-03 09:47:28 |
| Syllabus101.pdf Path: Acton School of Business >> FX >> 4533 Fall, 2009 Description: MATH 101: Single Variable Calculus I Summer 2009 Instructor: Fei Xu Time: MTWRF 9:00 am - 12:05 pm. Office: Herman Brown 42 1 p.m. 2 p.m. E-mail: fx4533@rice.edu Location: TBA Phone: (713) 3488304 Office Hours: MTWRF 1 p.m. 2 p.m. Web Site: http:... Date Added: 2009-06-03 09:47:41 |
| hw7.pdf Path: Columbia >> EE >> 4710 Fall, 2009 Description: HW #7 ELEN E4710 - Intro to Network Engineering Due 4/24/2003 Spring 2003 Prof. Rubenstein Homework must be turned in at the beginning of class on the due date indicated above. CVN students have one additional day. Late assignments will not be accept... Date Added: 2009-06-03 09:49:58 |
| Ride_04Nov2007_11.txt Path: Princeton >> GROTH >> 20071104 Fall, 2009 Description: The stone structure in the middle seems to be a five sided barbecue grill. Behind it is a set of shelves with a hibachi on top. To the left of the shelves is what appears to be an old fashioned cooler. To the right is a table: a metal frame and an un... Date Added: 2009-06-03 10:01:15 |
| problemset3-radcarbe.pdf Path: Contra Costa College >> CHEM >> 426 Fall, 2009 Description: 1 Problem Set 3. March 25, 2009 CHEM 426/626 Dr. H.M. Muchall _ Name Wherever possible, draw structures to support an explanation. Use a few key sentences. No lengthy writing is required! You should be fine with the space available. 1. The ESR sp... Date Added: 2009-06-03 10:03:36 |
| ch19.ppt Path: Towson >> C >> 578 Fall, 2009 Description: Copyright 2007 Ramez Elmasri and Shamkant B. Navathe Slide 19- 1 Chapter 19 Database Recovery Techniques Copyright 2007 Ramez Elmasri and Shamkant B. Navathe Chapter 19 Outline Databases Recovery 1. Purpose of Database Recovery 2. Types of Fail... Date Added: 2009-06-03 10:07:17 |
| 06LongTermAndSDIC.pdf Path: Bryn Mawr >> VJDMATH >> 201 Fall, 2009 Description: Math 210 Long Term Behavior and Sensitive Dependence on Initial Conditions: I. Use your sketch of the slope field for: on which you have drawn solution curves. Questions: Look at the t=0 vertical line in the (t,y) plane. a. Give an initial condition ... Date Added: 2009-06-03 10:18:00 |
| chap4_lect13_wire.pdf Path: UMBC >> CPATEL >> 315 Fall, 2009 Description: Principles of VLSI Design Interconnect and Wire Engineering CMPE 413 Interconnect Analysis of interconnect is becoming as important as transistors in modern processes. Modern processes use 6-10 metal layers Layer T (nm) W (nm) S (nm) AR Layer stac... Date Added: 2009-06-03 10:20:46 |
| art.pdf Path: Washington >> HST >> 388 Fall, 2009 Description: WESTERN TRAVELERS, EASTERN ANTIQUITIES, AND THE IMAGE OF THE TURK IN EARLY MODERN EUROPE AMANDA WUNDER University of Wisconsin-Madison Abstract Educated elite Europeans who visited Constantinople on diplomatic, scholarly, and commercial enterprises ... Date Added: 2009-06-03 10:23:07 |
| cher.pdf Path: Washington >> HIST >> 388 Fall, 2008 Description: ... Date Added: 2009-06-03 10:23:08 |
| nuke2.pdf Path: UF >> PHY >> 4803 Fall, 2009 Description: Nuclear Spin and Stability PHY 3101 D. Acosta Nuclear Spin n neutrons and protons have s = (ms = ) so they are fermions and obey the PauliExclusion Principle The nuclear magneton is eh m eh 1 N = = e = B 2mp mp 2me 1840 The proton magnetic momen... Date Added: 2009-06-03 10:27:42 |
| M18.0809.BU_Security_LIST.pdf Path: Wisconsin >> INSTR >> 0809 Fall, 2009 Description: LIST OF STAFF AUTHORIZED TO VIEW BUDGET UNIT LEVEL PLANNING ALLOCATION REPORTS UNIT DIV DEPT LAST NAME A A A A A A A A A A A A A A A A A A A A A A A A A A A A A A A A A A A A A A A A A A A A A A A A A A A A A A A A A A A A A A A A A A A A 1 1 1 1 2 2... Date Added: 2009-06-03 10:44:45 |
| ECE351_HW7_S.pdf Path: Rose-Hulman >> ECE >> 351 Fall, 2009 Description: R3 + 10k -VEE U1 LF411 VCC + Vin R1 + + AC Sweep - V- 2 4 - V2 DC = 15 B1 1 6 5 1k Vo + + + R2 1k V1 Magnitude = 1 Phase = 0 OUT + V+ 3 B2 - V3 DC = 15 0 7 - 0 + + R4 1k 0 -VEE VCC 0 * Profile: \"SCHEMATIC1-AC Sweep\" Date... Date Added: 2009-06-03 10:48:12 |
| T0207.t2k.stride-ebghtl-logo.pdf Path: UCSC >> T >> 0207 Fall, 2009 Description: T0207.t2k stride-ebghtl 3 2 1 C E T X 10 20 30 40 E 3 2 1 T H E T H E EE TT E T X T T C X X X X X X X T T H C C E E E C C E E EXBXX X X X X E CTT ETCCTT CC 51 60 T E H 70 LR DPM GRELDWPF DAPRLRAWLDAAPH A HHHHHHHH X X X X X ... Date Added: 2009-06-03 11:08:42 |
| T0250.t2k.near-backbone-11-logo.pdf Path: UCSC >> T >> 0250 Fall, 2009 Description: T0250.t2k near-backbone-11 3 2 1 A B D E C G F KGH G X X X I J G J G H E H K H HIKGGGHCGHFF E D G G G X X X XXX X X J I I J X X I K J I C D K B A D XX XX G I J C G H E D A G X X X X A H B B E E J G E D G H K H H C E E F X X X X ... Date Added: 2009-06-03 11:08:51 |
| assign4.pdf Path: Allan Hancock College >> ICS >> 336 Fall, 2009 Description: NAME . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . (Please underline your family name.) Assignment 4 Math336 Part... Date Added: 2009-06-03 11:15:40 |
| CS 350 - Chapter4.pdf Path: Drexel >> CS >> 350 Fall, 2009 Description: CS 350 Software Design A Standard Object-Oriented Solution Chapter 4 Before studying design patterns, many programmers solve a problem by starting with a general solution and refine it until you are ready to code (OK or you do not design at all) Sp... Date Added: 2009-06-03 11:23:27 |
| huang2008.pdf Path: Penn State >> LXC >> 933 Fall, 2009 Description: Nonlinear Pricing in Yellow Pages Yao Huang Pennsylvania State University Isabelle Perrigne Pennsylvania State University Quang Vuong Pennsylvania State University September 2008 Preliminary Draft * The last two authors are grateful to the Natio... Date Added: 2009-06-03 11:25:44 |
| ddd.pdf Path: Boise State >> CS >> 253 Fall, 2009 Description: Debugging with DDD Users Guide and Reference Manual First Edition, for DDD Version 3.3.9 Last updated 15 January, 2004 Andreas Zeller Debugging with DDD Users Guide and Reference Manual Copyright c 2004 Universitt des Saarlandes Lehrstuhl Software... Date Added: 2009-06-03 11:36:30 |
| IEEE on RIM & NPT.pdf Path: Michigan >> SI >> 110 Fall, 2008 Description: Sponsored By The Story Behind the BlackBerry Case By: Kirk Teska In 1991, 164 306 patent applications were filed with the U.S. Patent and Trademark Office (PTO). One was filed by Thomas Campana Jr. It, and the additional patents he ultimately recei... Date Added: 2009-06-03 11:45:07 |
| Perils of Google Sufficing.pdf Path: Michigan >> SI >> 110 Fall, 2008 Description: The Peloponnesian War and the Future of Reference, Cataloging, and Scholarship in Research Libraries By Thomas Mann Prepared for AFSCME 2910 The Library of Congress Professional Guild representing over 1,600 professional employees www.guild2910.org J... Date Added: 2009-06-03 11:45:49 |
| T0401.t06.n_notor2-logo.pdf Path: UCSC >> T >> 0401 Fall, 2009 Description: T0401.t06 n_notor2 3 2 1 1 10 20 30 40 N 3 2 1 S N S H G I N H N 51 60 70 80 90 B N 3 2 1 H N H N G P N P B N B N B N 101 110 120 130 B N B N S N S N H N H N G N 140 VD L GDLDI TSIKYIAPSFDDFLGKAIY L NF N KL Q N ... Date Added: 2009-06-03 11:51:42 |
| T0492.t06.str2-logo.pdf Path: UCSC >> T >> 0492 Fall, 2009 Description: T0492.t06 str2 4 3 2 1 1 10 20 30 40 G 4 3 2 1 T Z Y Q A Q A Z T H T T Z A Z T 51 60 A Z T Y Z A Z H G T 70 IQ I NVRGY ELSLRKSAAEMIEVE Y Z 50 MF S LRDAK CGQTVKVVKLHGTGALKRR I MD M GI T R GC E I Y IR K V A PL G D P ... Date Added: 2009-06-03 11:52:35 |
| T0206.t2k.CB_burial_14_7-logo.pdf Path: UCSC >> T >> 0206 Fall, 2009 Description: T0206.t2k CB_burial_14_7 2 1 AA A X 1 10 20 30 40 A 2 1 B D A D A B A B A B A A B A B A B B A B A B A B B A A A B B C B B B A BB ACCCBCAAACC A AC A C D B A D C D CDDDDDDDDDDBCDCADDADDDDBADDDACBBDBBB D C C CCCCCCCCCCAACDDCCDCCCCADC... Date Added: 2009-06-03 11:53:11 |
| T0482.t04.bys-logo.pdf Path: UCSC >> T >> 0482 Fall, 2009 Description: T0482.t04 bys 5 4 3 2 1 1 10 20 30 40 E 5 4 3 2 1 P T E H E P E P T E P H G E P H G T P E P E P Y P E P T P 51 60 70 80 90 E H 5 4 3 2 1 E P H G T P H G P H 101 110 P D P T P E P H 120 AK L HAHPG EPVDLERIIRHE 100 FS D... Date Added: 2009-06-03 11:55:08 |
| multiD.pdf Path: W. Alabama >> CS >> 240 Fall, 2009 Description: Multi-dimensional data 16-1 Quad-tree example * * * * * * * * * * * * * * * * * * * * Multi-dimensional data 16-2 kd-tree example 140 130 120 110 100 80 * * * * * * 40 30 10 * * * 10 20 30 40 50 70 80 110 140 x = 50 y = 120 x = 30... Date Added: 2009-06-03 12:10:14 |
| Ka_Mu_Al.pdf Path: George Mason >> ECE >> 646 Fall, 2008 Description: Analysis of security aspects of web services By Lavanya Kanchanpalli, Mahesh Mutham and Raghu Ram Ala 1. Introduction XML Web services provide programmatic access to application logic using standard Web protocols, such as XML and HTTP. XML Web servi... Date Added: 2009-06-03 12:19:05 |
| new work.pdf Path: Penn State >> KFV >> 100 Fall, 2009 Description: Total wavelength of particle is (E is relativistic energy): Since (m is relativistic): (mass is relativistic) The wavelength equation is arrived at without the extra 2 as on page 91 of The Modern Revolution in Physics. The rest of this PDF consist... Date Added: 2009-06-03 12:19:58 |
| ABE 482 Lecture 8.pdf Path: Air Force Academy >> ABE >> 482 Fall, 2009 Description: ABE 482-Environmental Engineering in Biosystems September 22 Lecture 8 Compost Recipe Example 3 How much water should we add to our piles to reach 60% wet basis moisture content in each one? Summary of Composting Composting is \"controlled\" decompo... Date Added: 2009-06-03 12:20:20 |
| 40tperhour.xls Path: Air Force Academy >> ABE >> 295 Fall, 2009 Description: Speed (%) 10 10 10 10 10 10 10 10 10 10 20 20 20 20 20 20 20 20 20 20 30 30 30 30 30 30 30 30 30 30 40 40 40 40 40 40 40 40 40 40 50 50 50 50 50 50 50 50 50 50 Flowrate t DM/h 35.4 44.5 44.9 36.4 35.8 36.3 40.5 41.3 38.2 42.1 42.0 41.7 36.0 37.7 41.... Date Added: 2009-06-03 12:20:37 |
| T0387.t06.str2-logo.pdf Path: UCSC >> T >> 0387 Fall, 2009 Description: T0387.t06 str2 4 3 2 1 1 10 20 30 40 Z Y Z Y A Z Y Z 4 3 2 1 T S Z A Z T Z A Z T H T T Q 51 60 70 80 A Z T T H T S A 90 II E VNGVN VLDEPYEKVVDRIQSSGKN V TL L VC G K KA Q D T V 50 SM K PKLCR LAKGENGYGFHLNAIRGLP G SF I ... Date Added: 2009-06-03 12:26:04 |
| 19_24.pdf Path: SUNY Buffalo >> MAE >> 381 Fall, 2009 Description: ... Date Added: 2009-06-03 12:37:36 |
| exF_05c.pdf Path: Texas A&M >> M >> 151 Fall, 2009 Description: MATH 151 FALL 2005 FINAL EXAM TEST FORM A NAME (print) LAST FIRST SIGNATURE SECTION NUMBER INSTRUCTIONS 1. In Part I, problems 3-12, circle the correct choice on your exam. Write your answers to problems 1-2 in the space provided. Calculators a... Date Added: 2009-06-03 13:01:25 |
| F0625.pdf Path: Georgia Tech >> CHAPTER >> 3055 Fall, 2009 Description: PCSrc 0 M u x 1 IF/ID ID/EX EX/MEM MEM/WB Add 4 RegWrite Shift left 2 Add Add result Branch PC Address Instruction memory Instruction Read register 1 MemWrite Read register 2 Registers Read Write data 2 register Write data Read data 1 ... Date Added: 2009-06-03 13:04:18 |
| jd.txt Path: CSU San Bernardino >> ETEC >> 544 Fall, 2009 Description: Joe DiMaggio was born in Martinez California in 1914. In 1930 Joe dropped out of Galileo high school and started working at an orange-juice bottling plant. He continued trying out different jobs, such as working at the cannery or delivering groceri... Date Added: 2009-06-03 13:10:59 |
| jd.txt Path: CSU San Bernardino >> WIN >> 544 Fall, 2009 Description: Joe DiMaggio was born in Martinez California in 1914. In 1930 Joe dropped out of Galileo high school and started working at an orange-juice bottling plant. He continued trying out different jobs, such as working at the cannery or delivering groceri... Date Added: 2009-06-03 13:11:00 |
| 3118tips.pdf Path: Minnesota >> MATH >> 3118 Fall, 2008 Description: Tips for Success in Math 3113-3118 Come to class prepared. This means with your homework ready to turn in, prepared to discuss or present the assigned problems, and having read the next section of the text. Note that we will collect homework before ... Date Added: 2009-06-03 13:17:49 |
| Lect09.ppt Path: UMBC >> CSEE >> 104 Spring, 2001 Description: Algorithms III: Problem Solving and Pseudocode Topics q Problem Solving Examples q Pseudocode q Control Structures Reading q Section 3.3 - 3.10 (don\'t worry about understanding the C code, just the pseudocode) CMSC 104, Lecture 09 Methods of Proble... Date Added: 2009-06-03 13:30:28 |
| BiostatsWorkshop3.pdf Path: UMass (Amherst) >> WEEK >> 736 Fall, 2009 Description: Problems in Biological Statistics 22.736 Winter 2006 Workshop 3: Graphics, Comparisons, and Relationships (Quinn and Keough Ch. 4, Ch. 5 section 5.0 to 5.1, Ch. 14 section 14.0 to 14.2.1) It is always advisable to examine a data set using graphica... Date Added: 2009-06-03 13:30:46 |
| Lecture.34.ppt Path: Utah State >> CS >> 6370 Spring, 2008 Description: What Is Software Testing? And Why Is It So Hard? CS 5/6370 Lecture 34 Source What is Software Testing? And Why is it so Hard? James A. Whittaker IEEE Software, v. 17, n. 1, pp. 70-79 Testing Terminology Software testing is executing code to det... Date Added: 2009-06-03 13:34:55 |
| PKG_TO71&TO72.pdf Path: New Hampshire >> ECE >> 617 Fall, 2008 Description: Databook.fxp 1/13/99 2:09 PM Page G-4 G-4 01/99 TO-71 Package Dimensions in Inches (mm) 0.210 (5.34) 0.170 (4.32) 0.230 (5.84) 0.195 (4.96) 0.209 (5.31) 0.175 (4.44) Dia. Dia. 0.030 (0.76) Max. 0.750 (19.05) Max. 0.500 (12.70) Min 6 Leads - Dia... Date Added: 2009-06-03 13:38:31 |
| Lect09.ppt Path: UMBC >> CMSC >> 104 Fall, 2006 Description: Algorithms III: Problem Solving and Pseudocode Topics q Problem Solving Examples q Pseudocode q Control Structures Reading q Section 3.3 - 3.10 (don\'t worry about understanding the C code, just the pseudocode) CMSC 104, Lecture 09 Methods of Proble... Date Added: 2009-06-03 13:41:10 |
| LeChatelierConcentration.pdf Path: UMass (Amherst) >> CHEM >> 122 Fall, 2009 Description: LeChatelier and Concentration When a system is at equilibrium, Q = K. Changing the concentration of reactants or products that are part of the equilibrium constant expression cause the reactant quotient, Q, to change. Q will no longer be equal to K a... Date Added: 2009-06-03 13:51:18 |
| LeChatelierConcentration.pdf Path: UMass (Amherst) >> CHEM >> 112 Fall, 2008 Description: LeChatelier and Concentration When a system is at equilibrium, Q = K. Changing the concentration of reactants or products that are part of the equilibrium constant expression cause the reactant quotient, Q, to change. Q will no longer be equal to K a... Date Added: 2009-06-03 13:52:13 |
| GUIs.pdf Path: W. Alabama >> SE >> 382 Fall, 2009 Description: Excerpts from Java Learning to Program with Robots Byron Weber Becker University of Waterloo For CS349 | SE 382 students at the University of Waterloo Copyright 2005 by Thumbodys Thinking Inc. All rights reserved. Cover art by Joel Weber Becke... Date Added: 2009-06-03 13:54:54 |
| 223mt207.pdf Path: UWO >> DSMITH >> 223 Fall, 2009 Description: Mathematics 223b Second Midterm Exam March 10, 2007 Instructions: Print your name and your instructor\'s name on the SCANTRON answer sheet. Sign the SCANTRON answer sheet, and mark your student number and section on the SCANTRON answer sheet. Use a PE... Date Added: 2009-06-03 14:01:08 |
| CSTR-PFR_plots.pdf Path: Cornell >> WEB >> 390 Fall, 2009 Description: ChemE 3900 - Chemical Kinetics & Reactor Design Templates for graphical analysis of CSTRs and PFRs 1st Order Reaction, k = 1/min, [A]0 = 1 mol/L 10 8 reciprocal rate, 1/r (Lmin)/mol 6 4 2 0 0 0.1 0.2 0.3 0.4 0.5 0.6 0.7 0.8 0.9 1 fractional conv... Date Added: 2009-06-03 14:02:11 |
| prelim2soln.pdf Path: Cornell >> WEB >> 390 Fall, 2009 Description: ChemE 3900 - Chemical Kinetics & Reactor Design Solution to 2nd Preliminary Exam, Spring 2009 1. The first experiment is represented by a rectangle with one vertex at the origin and the opposite vertex at X = 0.4, y = the 1/rate line. For all four pl... Date Added: 2009-06-03 14:02:11 |
| ddd.pdf Path: Washington University in St. Louis >> CSE >> 361 Fall, 2009 Description: Debugging with DDD Users Guide and Reference Manual First Edition, for DDD Version 3.3.9 Last updated 15 January, 2004 Andreas Zeller Debugging with DDD Users Guide and Reference Manual Copyright c 2004 Universitt des Saarlandes Lehrstuhl Software... Date Added: 2009-06-03 14:02:14 |
| 202-20060921.pdf Path: Berkeley >> IS >> 202 Fall, 1998 Description: 8. Classification (1) file:/C:/Documents%20and%20Settings/glushko/My%20Documents/L. 8. Classification IS 202 - 21 September 2006 Bob Glushko 1 of 38 9/21/2006 8:14 AM 8. Classification (1) file:/C:/Documents%20and%20Settings/glushko/My%20Docum... Date Added: 2009-06-03 14:09:20 |
| 202-20061102.pdf Path: Berkeley >> IS >> 202 Fall, 1998 Description: 20. Multimedia Search and Retrieval (1) file:/C:/Documents%20and%20Settings/glushko/My%20Documents/L. 20. Multimedia Search and Retrieval IS 202 - 2 November 2006 Bob Glushko 1 of 30 11/2/2006 8:28 AM 20. Multimedia Search and Retrieval (1) fi... Date Added: 2009-06-03 14:09:23 |
| Lab06Extra.pdf Path: HWS >> MATH >> 131 Fall, 2009 Description: Math 131 Post-Lab 6 Take Home Quiz: Due Friday 1. Solve the dierential equation: dy y 1/3 = 1/3 , dx x y(1) = 27. Watch your algebra. 2. a) A small pond contains 400,000 gallons of fresh water. At the start of a rainstorm (t = 0), sewers overow and ... Date Added: 2009-06-03 14:16:23 |
| MineralHandbooks.LST.pdf Path: Washington University in St. Louis >> EPSC >> 352 Fall, 2008 Description: D:\\352\\2008\\MineralHandbooks.LST.wpd EPSc 352: Handbooks for Mineral Identification Best books preceded by *. Arem, Joel. 1991. Rocks and Minerals. Phoenix: Geoscience Press, Inc. ISBN #0-945005-06-7 Bishop, A.C.; Wolley, A.R.; and Hamilton, W.R. 19... Date Added: 2009-06-03 14:28:22 |
| CHAPTER 8.pdf Path: Cornell >> ECON >> 331 Fall, 2007 Description: Basic Facts Transaction Costs Liquidity Asymmetric Information Conicts of Interest Financial Crises US Other Countries Last lecture Stocks are valued as the present value of future dividends. Uncertainty about dividends makes stock prices sensitive ... Date Added: 2009-06-03 14:37:24 |
| Rose-Hulman.ppt Path: Rose-Hulman >> CSSE >> 120 Fall, 2009 Description: As you arrive: Contact Before Work Start your laptop and enter our Angel course site: angel.rose-hulman.edu Sit beside your partner Turn to a neighbor and ask: Why did you choose to come to RoseHulman? What other choices did you have? Why d... Date Added: 2009-06-03 14:42:10 |
| PH425_Expt_1K_Notes_Jan_14.doc Path: Rose-Hulman >> PH >> 425 Fall, 2009 Description: 1 PH 425 Experiment 1K Notes Jan 14, 2006 Part A. The 480 pulser output must be set Negative (I think the switch is wired backwards. The next page gives some notes of mine on how the 480 switches work. Part B The next page shows the connections I ... Date Added: 2009-06-03 14:42:12 |
| diet.txt Path: Calvin >> M >> 344 Spring, 2007 Description: # loss = wt loss in six weeks # diet = one of two diet plans (A or B) # block: subject were divided into three groups based on wt before study # loss diet block 12.4 A heavy 9.2 B heavy 11.2 A med 9.8 B med 8.5 A light 6.5 B light ... Date Added: 2009-06-03 14:42:44 |
| sg3.doc Path: W. Kentucky >> CSC >> 364 Fall, 2009 Description: CSC 364 Study Guide for the Final Exam Date: Tuesday, December 12, 1 3 pm. Chapter 13a: Know how to implement the search and split operations for the Red-Black and 2-3-4 trees. Given a series of values, be able to show what a 2-3 or 2-3-4 tree will ... Date Added: 2009-06-03 14:44:08 |
| PSY710(Overview-Deletes).ppt Path: Wisconsin >> PSY >> 710 Fall, 2009 Description: Design and Analysis of Psychological Experiments (PSY 710) Instructor: John J. Curtin Teaching Assistant: Alexa Romberg Today\'s Outline Quick introductions Syllabus & course outline Goals for course Ongoing evaluation Multivariate framework 2 ... Date Added: 2009-06-03 14:45:17 |
| posterafci.ppt Path: Wisconsin >> ENGR >> 160 Fall, 2009 Description: Designing GENIUS Version 2 to Model Inter-Facility Relationships About GENIUS LWR Fuel (MT) Demand Existing Supply Percentage GENIUS (Global Evaluation of Nuclear Infrastructure Utilization Scenarios) is the top-level code in the SINEMA nuclear fuel... Date Added: 2009-06-03 14:46:27 |
| aviationinstrumentationgroup.doc Path: Wisconsin >> ENGR >> 160 Fall, 2009 Description: ... Date Added: 2009-06-03 14:46:30 |
| finalsyllabusdocument.doc Path: Wisconsin >> ENGR >> 101 Fall, 2009 Description: Inter-Engineering 101 Contemporary Issues in the Engineering Profession Instructors: M. Robinson B. Schmidt D. Woolston E. Zaki Fall 2005 mrobinson@engr.wisc.edu schmidt@engr.wisc.edu woolston@engr.wisc.edu zaki@engr.wisc.edu 1150 Eng. Hall 1150 Eng.... Date Added: 2009-06-03 14:46:32 |
| me364exam1fall2005takehome_solution.doc Path: Wisconsin >> ME >> 364 Fall, 2009 Description: ME 364 Exam #1, Take home portion Name _ Lecture time (circle one): 11:00 or 2:25 Please read the statement below and sign and date where indicated. I have not communicated with anyone about this take home exam. The work presented here is my own. S... Date Added: 2009-06-03 14:46:45 |
| F07_Lecture13_transport1.ppt Path: Wisconsin >> CS >> 640 Spring, 2005 Description: CS640: I ntr oducti on to Computer Networ ks Adi tya Akel l a L ectur e 14 TCP I Tr anspor t Pr otocol s: TCP Segments, Fl ow contr ol and Connecti on Setup Tr anspor t Pr otocol s L owest l evel endto-end pr otocol . H eader gener ated by sender... Date Added: 2009-06-03 14:47:15 |
| lab_1.doc Path: Wisconsin >> ENGR >> 556 Fall, 2009 Description: IES/CEE 556 Remote Sensing Digital Image Processing LAB 1: Digital Image Histograms, Contrast Enhancements, and Level Slicing Revised January 23, 2006 This lab is designed to teach you how to enhance the contrast of digital imagery so that visual int... Date Added: 2009-06-03 14:47:52 |
| Week5a.ppt Path: Wisconsin >> G >> 724 Fall, 2009 Description: Transient Water Balance Eqn. Inflow = Outflow + S Recharg e Discharge OUT IN = qx qy qz ( + + - W ) x y z x y z = change in storage = - V/ t Ss = V / (x y z h) V = Ss h (x y z) t t OUT IN = qx qy qz h ( + + - W ) = - Ss x y z t h h h h ( ... Date Added: 2009-06-03 14:48:11 |
| Homework_4-answer.ppt Path: Wisconsin >> PHARM >> 620 Fall, 2008 Description: Answer to homework question 4 (The question should have asked for the similarities between yeast pol II and E. coli RNA polymerase)-see page 269 in the Weaver text RNA polymerase II subunits (RPB1-12) 1. RPB1 (220 kD): This largest subunit has homolo... Date Added: 2009-06-03 14:50:50 |
| march2electricalhazards.ppt Path: Wisconsin >> ENGR >> 556 Fall, 2009 Description: Electrical Hazards March 2, 2006 Electrical accident stats Electricity basics types of hazards Identification and prevention (LOTO) OSHA Standards Electrocution Fatality Stats Table 1. Fatal occupational injuries by event or exposure, 1999-2004 Typ... Date Added: 2009-06-03 14:51:43 |
| amit_projectpresentation.ppt Path: Wisconsin >> ENGR >> 556 Fall, 2009 Description: Sub pixel Classification using Hyperspectral Image of Ray Mine, Arizona Amit Malhotra IES/CEE 556 Spring 2002 Objective To study various classification techniques used for Hyperspectral Imagery mainly sub pixel. To compare sub pixel class... Date Added: 2009-06-03 14:53:56 |
| conejo100a.txt Path: TCU >> COSC >> 40503 Fall, 2009 Description: ighk*e*fghk-0.5*jghk-0.5 ighj*e*fghj-0.5*kghj-0.5 ebgk*e*fbgk-0.5*hbgk-0.5 ebgj*e*fbgj-0.5*hbgj-0.5 ebgi*e*fbgi-0.5*hbgi-0.5 ebgh*e*fbgh-1.0 hdik*e*edik-0.5*fdik-0.5 hdij*e*edij-0.33*fdij-0.33*kdij-0.33 gajk*e*dajk-0.5*fajk-0.5 ebfk*e*hbfk-1.0 ebfj*e... Date Added: 2009-06-03 14:54:48 |
| BI153StudyGuide01.doc Path: SEMO >> BI >> 153 Fall, 2009 Description: BI 153 Study Guide 01 Characteristics of Life Terms. Explain terms, and match terms with appropriate concepts. Use terms appropriately in short and long answers. complexity organization metabolism homeostasis growth development heredity Concepts.... Date Added: 2009-06-03 14:55:35 |
| ch05.ppt Path: Oregon State >> BA >> 260 Fall, 2008 Description: Entrepreneurship Assembling the Team: Acquiring and Utilizing Essential Human Resources Ch. 5 \"Union may be strength, but it is mere blind brute strength unless wisely directed.\" Samuel Butler, 1882 Human Resources Knowledge Skills Talen... Date Added: 2009-06-03 14:57:02 |
| midtermsol.doc Path: UPenn >> STAT >> 111 Fall, 2008 Description: STAT111 Midterm Exam Summer 2003 Name_Date_ 1. Multiple choices. The degree of reading power(DRP) test is often used to measure the reading ability of children. Here is a frequency summary of the DRP of a sample of third grade students: Score 51-5... Date Added: 2009-06-03 14:59:52 |
| approach.doc Path: Mississippi State >> ECE >> 4512 Fall, 2009 Description: 3. Approach In order to understand the need for an electronic coolant system, it is necessary to present some background information on traditional coolant systems. A brief overview of why coolant systems are necessary and how traditional cooling s... Date Added: 2009-06-03 15:00:04 |
| Marakas-Ch04.ppt Path: SUNY Oswego >> ISC >> 410 Fall, 2009 Description: Chapter 4: Modeling Decision Processes Decision Support Systems in the 21st Century, 2nd Edition by George M. Marakas Marakas: Decision Support Systems, 2nd Edition 2003, Prentice-Hall Chapter 4 - 1 4-1: Defining the Problem and Its Structure A ful... Date Added: 2009-06-03 15:00:11 |
| gadgets.wsj.403.doc Path: Seattle >> MKTG >> 553 Fall, 2009 Description: More Gadgets Hit Shelves, But Many Are Half-Baked By PUI-WING TAM Staff Reporter of THE WALL STREET JOURNAL Sean Mills, eager to have the newest gadgetry, decided to plunk down $500 for a combined phone and hand-held computer. He liked its versatili... Date Added: 2009-06-03 15:00:19 |
| functions.PPT Path: Illinois Tech >> CS >> 561 Fall, 2009 Description: Functions A function is a systematic operation in which one set of events influences another set of events based on special ground rules. Function: Implies a definite end or purpose that the one in question serves or a particular kind of work it is... Date Added: 2009-06-03 15:00:56 |
| part1pokie.PPT Path: Delaware State >> CIS >> 20310 Fall, 2009 Description: Data Mining Outline PART I Introduction Related Concepts 1 Introduction Outline Goal: Provide an overview of data mining. Define data mining Data mining vs. databases Basic data mining tasks Data mining development Data mining issues 2 In... Date Added: 2009-06-03 15:02:47 |
| lecture_14.ppt Path: Colorado >> CSCI >> 5832 Fall, 2008 Description: CSCI 5832 Natural Language Processing Jim Martin Lecture 14 05/13/09 1 Today 3/4 Parsing CKY again Earley 2 05/13/09 Sample Grammar 3 05/13/09 Dynamic Programming DP methods fill tables with partial results and Do not do too much avoidabl... Date Added: 2009-06-03 15:03:16 |
| lecture_12.ppt Path: Colorado >> CSCI >> 5582 Fall, 2008 Description: CSCI 5582 Artificial Intelligence Lecture 12 Jim Martin CSCI 5582 Fall 2006 Today 10/10 Finish FOL FW and BW chaining Limitations of truth conditional logic Break Basic probability CSCI 5582 Fall 2006 Inference Inference in FOL involves sh... Date Added: 2009-06-03 15:03:16 |
| correctgraph.txt Path: VCU >> CMSC >> 691 Fall, 2008 Description: total 148 edges X Y nexthop 148 563 1 0 563 1 17 563 1 12 808 193 1 808 193 3 808 193 5 808 193 15 479 584 2 479 584 6 479 584 13 479 584 14 479 584 27 895 350 3 895 350 38 895 350 1 746 822 4 746 822 18 746 822 20 746 822 25 746 822 35 858 174 1 858... Date Added: 2009-06-03 15:04:42 |
| 04.ppt Path: South Carolina Upstate >> SCSC >> 511 Fall, 2009 Description: CSCS 511 Operating Systems Lecture 3 Concurrency: Processes, Threads, and Address Spaces Note S eslide areadapte fromslide 2005 S rschatz, Galvin, and Gagne and Prof. John : om s d s ilbe , Kubiatowicz le cture Review: History of OS tudy OSHistory?... Date Added: 2009-06-03 15:06:00 |
| CB1.ppt Path: Arkansas Little Rock >> FIN >> 7325 Fall, 2009 Description: Early Stage Sources of Capital Early Stage Sources of Capital 1 Stages of Entrepreneurial Development Seed $5,000 to $100,000 Startup $20,000 to $400,000 Growth $500,000 to $3,000,000 Late Growth $1,000,000 to $5,000,000 Harvest $2,000,000 to... Date Added: 2009-06-03 15:07:13 |
| bioinformatics_proposal_writing.ppt Path: Arkansas Little Rock >> BINF >> 7295 Fall, 2009 Description: A presentation on Proposal Writing By Barbara Rodela, M.A., and Judy Camp, M.A. University of Arkansas at Little Rock Office of Research and Sponsored Programs UALR Proposal Path Write Proposal Route Proposal for Approvals Find Funding Source ... Date Added: 2009-06-03 15:07:17 |
| CHAP11.ppt Path: Loyola Chicago >> COMP >> 374 Fall, 2009 Description: I/O Management and Disk Scheduling Chapter 11 Categories of I/O Devices Human readable Used to communicate with the user Printers Video display terminals Display Keyboard Mouse Categories of I/O Devices Machine readable Used to communicate... Date Added: 2009-06-03 15:08:14 |
| syllabus.doc Path: CUNY Baruch >> CSC >> 126 Fall, 2009 Description: CSC 126: Introduction to Computer Science Spring 2009 Instructor: Dr. Yumei Huo Office: Tel.: EMail: WWW: Course webpage 1N-202 (718) 982-2841 huo@mail.csi.cuny.edu http:/www.cs.csi.cuny.edu/~yumei/ http:/www.cs.csi.cuny.edu/~yumei/csc126Spring09.h... Date Added: 2009-06-03 15:08:21 |
| CS240Lec14.ppt Path: Binghamton >> CS >> 240 Fall, 2009 Description: CS 240: Data Structures Thursday, August 2nd Trees Traversals, Representations, Recursion and Helpers Submissions If you need a Project 1 grade, you need to schedule an appointment with me after class. Traversals Traversals are how we extract ... Date Added: 2009-06-03 15:08:46 |
| SampleFinalExam.doc Path: Wayne State University >> PHY >> 2140 Fall, 2008 Description: Final Exam PHY 2140 Date, 2003 Please type your name here Row: Seat: Please type your student number here Instructions: The following procedure must be followed in order to correct any (unlikely) mistakes in the grading. 1. Do all the questions. S... Date Added: 2009-06-03 15:10:18 |
| ClassNotes-11-30-01.txt Path: Rutgers >> ECE >> 579 Fall, 2009 Description: Scribes for the Class on 30 November 2001 Topics presented : Trust LGI model and Poblano in JXTA by Mandar Trust Publius Censorship Resistant Publishing System by Ananth Trust LGI Model: Law Governed Interaction is a mode interaction tha... Date Added: 2009-06-03 15:12:04 |
| 5-link.ppt Path: Rutgers >> CS >> 352 Spring, 2006 Description: CS 352 Internet Technology Data Link Layer Richard Martin Dept. of Computer Science Rutgers University 1 Data Link Layer 2 Data Link Layer Host A Application Layer Presentation Layer Session Layer Transport Layer Network Layer Data Link Layer Phys... Date Added: 2009-06-03 15:12:08 |
| grades.doc Path: SUNY Buffalo >> MAE >> 513 Fall, 2009 Description: ID# xxxx-7278 xxxx-0940 xxxx-2154 xxxx-2080 xxxx-1719 Base HW1 HW2 HW3 HF (25%) Presentation PF (25%) 95.00 100.00 100.00 24.58 4.62 23.10 90.00 100.00 100.00 24.17 4.10 20.50 100.00 100.00 100.00 25.00 4.86 24.30 98.00 100.00 100.00 24.83 4.40 22.0... Date Added: 2009-06-03 15:12:58 |
| AmyLeskow.doc Path: SUNY Buffalo >> PSY >> 516 Fall, 2009 Description: Psy 516 Assignment 1 Erwin Segal Amy Leskow 1. Everyone should study mathematics to a certain extent. As with any field of study, it will naturally suit some people, but not all. 2. Students should get a basic understanding of mathematics so they may... Date Added: 2009-06-03 15:13:18 |
| mortgage_dep.sas.txt Path: DePaul >> WEEK >> 423 Fall, 2009 Description: * Add title to output; title \"Mortage refusal rate by applicant racial profile\"; /* options in infile statement * delimiter = \"09\"x specifies data are spaced by Tabs; * firstobs = n specifies first obs is in n-th row; */ data mortgage; infile \"C:... Date Added: 2009-06-03 15:14:37 |
| rum-icom4029-lec01.ppt Path: UPR Mayagüez >> ICOM >> 4029 Fall, 2009 Description: Introduction to Programming Languages and Compilers C S 164 1 1 :0 0 1 2 :3 0 T T 1 0 Eva ns UPRM ICOM 4029 (Adapted from: Prof. Necul 1 ICOM 4036 - Outline P ro ntua rio C o urs e O utline Brie f His to ry o f P Ls P ro g ra m m ing La n... Date Added: 2009-06-03 15:15:44 |
| lect07.ppt Path: DePaul >> SE >> 477 Fall, 2009 Description: SE 477 Software and Systems Project Management Dennis Mumaugh, Instructor dmumaugh@cdm.depaul.edu Office: O\'Hare, Room 113 Office Hours: Wednesday, 4:30-6:00 October 22, 2008 SE 477: Lecture 7 1/71 Administrivia Comments and feedback Assignmen... Date Added: 2009-06-03 15:15:55 |
| Geog360_S06_FinalExamReview.doc Path: DePaul >> GEOG >> 360 Fall, 2009 Description: Geog 360 Final exam review June 2nd, 2006 Flow map What is a flow map? How is a flow map different than other thematic maps? What are three types of flow map? What are distinguishing characteristics of the flow maps? What are particular design con... Date Added: 2009-06-03 15:16:18 |
| 96-09-20.txt Path: NMSU >> CS >> 372 Fall, 2009 Description: On the last HW - how exactly did I manage to conclude it would go through the loop i/delta times? Well, I can\'t really explain how I saw it, but I can demonstrate that it\'s true. What we\'ll do is to add an extra variable, called count, to count the... Date Added: 2009-06-03 15:18:30 |
| RR_12-11-08.doc Path: RIT >> KJW >> 8694 Fall, 2009 Description: Kevin Whitfield Reading reactions, 12-11-08 1. I don\'t think their cave painting analogy is any good. 2. Their description of how a game is made is much to simplified and just plain wrong in parts. It\'s much like making a movie these days. 3. About... Date Added: 2009-06-03 15:20:28 |
| logo.doc Path: Michigan >> BIO >> 503 Fall, 2009 Description: This course covers the fundamental statistical concepts related to the practice of public health: descriptive statistics; probability; sampling; statistical distributions; estimation; hypothesis testing; chi-square tests; simple and multiple linear r... Date Added: 2009-06-03 15:20:48 |
| putback_out.txt Path: Michigan >> EECS >> 280 Fall, 2008 Description: Peeked at: a Get char : a Peeked at: b Putting char back! Peeked at: a ... Date Added: 2009-06-03 15:24:34 |
| TakeHomeQuestion3.doc Path: Wisconsin >> PSY >> 741 Fall, 2009 Description: Last Four Digits of IDNum: _ Please answer this question in 750 words or less. Rename this file as XXXXQ3.doc (where XXXX is the last four digits of your Student ID number). Email me this file when the answer is complete. Question 3 Consider the DSM-... Date Added: 2009-06-03 15:27:28 |
| Beverage.java.txt Path: Wisconsin >> CS >> 302 Fall, 2008 Description: / <- 80 -> / /* **/ /* * The Beverage class is used to represent a soft-drink beverage. It was * designed to show as much variance in class and instance membership as * CS302 studen... Date Added: 2009-06-03 15:27:51 |
| 170lab5.doc Path: Wisconsin >> ECE >> 170 Fall, 2009 Description: ECE 170 Lab #5 Thevenin\'s Theorem Thevenin\'s Theorem Lab In this lab you will become familiar with one of the most important theorems in circuit analysis, Thevenin\'s Theorem. Thevenin\'s Theorem can be used for two purposes: 1. To calculate the curr... Date Added: 2009-06-03 15:27:54 |
| 19990401docket973758.txt Path: Stanford >> SLAM >> 1012 Fall, 2009 Description: Case docket was last updated on: 04/01/99. Docket as of August 21, 1999 5:16 pm Page 1 Proceedings include all events. CLOSED 1:97cv3758 Rudd v. Suburban Lodges, et al ... Date Added: 2009-06-03 15:28:29 |
| HorstCh13.ppt Path: Oregon State >> CS >> 162 Fall, 2008 Description: CS 162 - Spring 2004 Chapter 13 Arrays and Array Lists Array Data structure (encapsulated data & operations) Data elements of specific type (primitive, Object reference) Access method is indexing Fixed length Get array length as data.length. (N... Date Added: 2009-06-03 15:28:50 |
| partyorg.ppt Path: SUNY Buffalo >> PSC >> 345 Fall, 2009 Description: PSC 345 CANADIAN POLITICS PARTY STRUCTURE Mass\" Parties: NDP, PQ, BQ, and Alliance \"Cadre\" Parties: Liberal and Conservatives P... Date Added: 2009-06-03 15:29:41 |
| RPC-Birell-CS545.ppt Path: Rutgers >> CS >> 545 Fall, 2008 Description: Implementing Remote Procedure Calls (RPC) Andrew S Birrel and Bruce Jay Nelson Xerox, PARC RPC Inter-machine process to process communication Local Pass networks, internets Procedure calling interface arguments get results Fits into high-lev... Date Added: 2009-06-03 15:30:40 |
| TCPW-oct-2003.ppt Path: UCLA >> CS >> 218 Fall, 2008 Description: TCP Westwood with Agile Probing: Handling Dynamic Large Leaky Pipes Problem Definition Leaky Pipes: packet loss due to error Unjustified cwnd cut and premature Slow Start exit Large Pipes: Large capacity and long delay Control scheme may not sca... Date Added: 2009-06-03 15:34:39 |
| chap4.ppt Path: Hudson VCC >> CS >> 101 Spring, 2009 Description: Chapter 4 2004 Morgan Kaufmann Publishers 1 Performance Measure, Report, and Summarize Make intelligent choices See through the marketing hype Key to understanding underlying organizational motivation Why is some hardware better than others f... Date Added: 2009-06-03 15:36:35 |
| chap4.ppt Path: Hudson VCC >> CS >> 121 Spring, 2009 Description: Chapter 4 2004 Morgan Kaufmann Publishers 1 Performance Measure, Report, and Summarize Make intelligent choices See through the marketing hype Key to understanding underlying organizational motivation Why is some hardware better than others f... Date Added: 2009-06-03 15:36:36 |
| J_ApJS_133_77_readme.txt Path: Maryland >> ASTRO >> 133 Fall, 2009 Description: J/ApJS/133/77 VLA radio continuum survey of Seyfert galaxies (Ho+, 2001) = Radio continuum survey of an optically selected sample of nearby Seyfert galaxies. Ho L.C., Ulvestad J.S. <Astrophys. J. Suppl. Ser. 133, 77 (2001)> =2001A... Date Added: 2009-06-03 15:37:09 |
| Resume_12-1-08.doc Path: Penn State >> TMK >> 222 Fall, 2009 Description: Tye Kreider Present Address: 501 Vairo Blvd. Apartment # 1421 State College, PA 16803 (717) 669-0060 tmk222@psu.edu Permanent Address: 749 Truce Road New Providence, PA 17560 (717) 284-5036 tyekreider@gmail.com Objective: Education: Aug. 2005 to pre... Date Added: 2009-06-03 15:37:18 |
| 01-lexcompl.doc Path: UC Davis >> ATT >> 0753 Fall, 2009 Description: WPC}C# #2#B# #Z# #!#0#+#LEXCOMPL.WPD # #\'#xD#HP DeskJet 890C Series (Copy 2)#X#Z#2#P#X#P#X#Z#2# #P#X#P# # #A#Z#\"#A#r#i#a#l# #R#e#g#u#l#a#r# #X# #x#2#P# #P# # #A#Z#\"#A#r#i#a#l# #R#e#g#u#l#a#r# # # #uh# #P#X# WPCuh# #M# #X# #x#2#P# #P# # #A#Z#\"#A#r#i#... Date Added: 2009-06-03 15:38:00 |
| results_songs.txt Path: North-West Uni. >> TEST >> 4000 Fall, 2009 Description: layer hash name format url type fingerprint channels first_frame bytesdownloaded frame_size duration samplerate bitrate size 3 bf3d0b0498a5002ebd00f5fd00cdec00bec8012aa6009e5200911900a2fe003420007e3800758c0a23e202356401521f0143f8011a4100d8c100e5f100... Date Added: 2009-06-03 15:38:01 |
| 1_164.txt Path: Georgia Tech >> CS >> 2003 Fall, 2009 Description: Paper #: 180 Title: Fundamental Challenges in Mobile Computing (1) Problems Mobile computing is different from Ethernet in two ways. First the computers are smaller and bits travel by wireless instead. Then how can this possibly make any difference ... Date Added: 2009-06-03 15:40:50 |
| 1_164.txt Path: Georgia Tech >> CS >> 8803 Fall, 2008 Description: Paper #: 180 Title: Fundamental Challenges in Mobile Computing (1) Problems Mobile computing is different from Ethernet in two ways. First the computers are smaller and bits travel by wireless instead. Then how can this possibly make any difference ... Date Added: 2009-06-03 15:40:50 |
| badslides.ppt Path: Wisconsin >> ENGR >> 497 Fall, 2009 Description: Cheetahs Cheetahs display little genetic diversity in captive or wild populations. Current range is parts of Africa and Iran, but once extended over much of Asia and Africa. Ice ages may have led to isolation and Effect of democracy on capital ma... Date Added: 2009-06-03 15:42:09 |
| createPalette.doc Path: Wisconsin >> CS >> 755 Fall, 2008 Description: HELP FOR CREATING A PALETTE FOR OCTOPUS 1.0 WHAT IS A PALETTE 1.1 What Does an Octopus Palette Do? A palette is an OCT cell that contains instances of cells and other information used by an application. It contains all the technology- specific inform... Date Added: 2009-06-03 15:43:04 |
| 03.doc Path: Citadel >> PHED >> 300 Fall, 2009 Description: Assignment Three PHED 300 Recreate the MS word document (ignore the watermark) hyperlinked to the online course syllabus Here are some helpful hints: Pictures are located in clip art - search under \"exercise\". If for some reason the pictures are not... Date Added: 2009-06-03 15:43:52 |
| googlefs-vijay.ppt Path: Virginia Tech >> CS >> 5204 Fall, 2000 Description: The File System Sanjay Ghemawat, Howard Gobioff, ShunTak Leung Google Vijay Kumar Outline Introduction Goals Architecture Operations Supported Master Operations Performance Conclusion 05/14/09 2 File System for Googl... Date Added: 2009-06-03 15:44:15 |
| c067_p06_sov_data_by_p06_ssprec.txt Path: Berkeley >> P >> 067 Fall, 2009 Description: +-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+--+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+--+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+--+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+--... Date Added: 2009-06-03 15:45:48 |
| PhastCons_Avg.txt Path: Washington >> SMOOTH >> 1600 Fall, 2009 Description: 0.121948 0.135537 0.0963797 0.0883346 0.115475 0.164163 0.102999 0.124238 0.13421 0.104402 0.10867 0.0611439 0.169093 0.347468 0.163217 0.0875714 0.0845948 0.16963 0.236992 0.191952 0.100444 0.084293 0.101182 0.0966954 0.205778 0.344826 0.101247 0.08... Date Added: 2009-06-03 15:47:40 |
| ControlDepen.ppt Path: Cal Poly >> CSC >> 315 Fall, 2009 Description: Control Dependencies This is the cause of control dependencies Control Dependencies This is the cause of control dependencies Branches Control Dependencies This solution removes branches entirely Control Dependencies This solution removes branches... Date Added: 2009-06-03 15:49:40 |
| hw2sol.txt Path: Washington University in St. Louis >> CS >> 533 Fall, 2009 Description: CS 533 - HOMEWORK 2 SOLUTION Page 1 - Version 1, Mar. 13, 1999 Problem 1 - According to http:/www.census.gov/hhes/housing/ahs/tab2-1.html the 1993 housing statistics indicate that there were 94,724,000 households 64% of which are occupant o... Date Added: 2009-06-03 15:49:52 |
| Econ122Syllabus.doc Path: UCSB >> ECON >> 122 Winter, 2008 Description: Announcements: Natural Resource Economics Economics 122/Env. Studies 179 (http:/www.econ.ucsb.edu/~deacon/Econ122Public/Econ122Syllabus.html) Robert Deacon Class: Discussion: Office hours: My office: Exams: TTh 9:30-10:45, Psych 1824 9:00-9:50 SH 14... Date Added: 2009-06-03 15:50:59 |
| CBA_SeepTents.doc Path: UCSB >> ESM >> 204 Fall, 2008 Description: Cost Benefit Analysis of Hydrocarbon Seep Tents The Santa Barbara Channel contains some of the world\'s most productive marine hydrocarbon seeps. The seeps emit both oil and natural gas. Both types of emissions cause pollution: oil pollutes the beache... Date Added: 2009-06-03 15:51:24 |
| Second_Law_App.ppt Path: N.C. State >> CH >> 433 Summer, 2008 Description: Chemistry 433 Lecture 11 Second Law Applications NC State University Summary of entropy calculations In the last lecture we derived formula for the calculation of the entropy change as a function of temperature and volume changes. These are summari... Date Added: 2009-06-03 15:51:50 |
| lec12.ppt Path: N.C. State >> ENGR >> 253 Fall, 2009 Description: CSC 253 Lecture 12 Compiletime vs. runtime arrays What are some advantages of compiletime arrays? a. b. c. d. e. f. Save memory Can be of variable size Shorter code Both a and b Both a and c Both b and c Compiletime vs. runtime arrays ... Date Added: 2009-06-03 15:53:31 |
| Firstname_Lastname_MidEval.doc Path: USC >> CSCI >> 577 Fall, 2009 Description: CSCI 577 Spring 2007 Mid-Semester Evaluation Form (10 points) Name: 1. Please provide any feedback about your client Role: Class ID: Team: 2. Please evaluate your teammates including DR and Intern students (Don\'t evaluate yourself. You can evaluate ... Date Added: 2009-06-03 15:57:21 |
| Support_Plan_S05b_T07.doc Path: USC >> CSCI >> 577 Fall, 2009 Description: System and Software Support Plan (SSSP) Version 1.5 System and Software Support Plan (SSSP) Data Mining of Digital Library Usage Data Team 07 Maxim Krivokon Project Manager Bo Lee Developer Vu Nguyen Developer Genesan Kim Developer IV&Ver Shi... Date Added: 2009-06-03 15:57:51 |
| customer2.txt Path: UMKC >> CS >> 201 Fall, 2009 Description: 92 MARY SMITH 0 266 JAMES JOHNSON 1 93 PATRICIA WILLIAMS 2 144 JOHN JONES 3 15 LINDA BROWN 4 5 ROBERT DAVIS 5 94 BARBARA MILLER 6 146 MICHAEL WILSON 7 7 ELIZABETH MOORE 8 237 WILLIAM TAYLOR 9 273 JENNIFER ANDERSON 10 53 DAVID THOMAS 11 222 MARIA JACK... Date Added: 2009-06-03 15:58:59 |
| polydata.txt Path: UMKC >> CS >> 352 Fall, 2009 Description: 13 p10 2 2 0 5 1 1 9 0 2 0 0 0 p11 -35 0 2 12 1 11 5 3 1 7 2 0 0 0 0 p6 2 2 1 -18 1 0 2 0 1 12 1 2 0 0 0 p9 200 200 111 -300 111 200 0 0 0 p1 -71 2 6 2 1 1 -5 2 4 3 2 1 25 0 8 10 4 0 0 0 0 p2 5 2 1 3 3 0 -6 0 1 8 1 2 0 0 0 p7 2 3 0 2 2 1 3 1 2 -1 0 3... Date Added: 2009-06-03 15:59:12 |
| airq.txt Path: Alabama >> EC >> 671 Fall, 2008 Description: The files AIRQ contain observations for 30 standard metropolitan statistical areas (SMSAs) for California in 1972. Variable list: airq vala rain coas dens medi Labels: airq: indicator for air quality (the lower the better) vala: value added of ... Date Added: 2009-06-03 16:00:00 |
| inputlog1.txt Path: UNC >> PHYS >> 006 Fall, 2009 Description: By default this log will appear each time a molecule is loaded. This option can be disabled in the General Preferences dialog. /LOAD PDB log file for D:\\D_Backup\\Teaching_Classes\\Handcrafting_Nanoworld_FYS_Spring_2004\\MISC\\Molecular_Modeling_Softwa... Date Added: 2009-06-03 16:03:46 |
| week09.txt Path: UNC >> MATH >> 232 Fall, 2008 Description: Topics on Monday: I will finish section 7.3, and start section 7.4. * Topics on Wednesday: I will try to answer any homework questions you may have, then try to finish section 7.4. ** Friday: Fall break:-).... Date Added: 2009-06-03 16:04:50 |
| 2006-Geog090-Week06-Lecture01-CentralLimitTheorem.ppt Path: UNC >> GEOG >> 090 Fall, 2008 Description: Inferential Statistics Descriptive statistics (mainly for samples) Our objective is to make a statement with reference to a parameter describing a population Inferential statistics does this using a two-part process: (1) Estimation (of a populati... Date Added: 2009-06-03 16:06:12 |
| Part_Names.doc Path: Washington >> ME >> 356 Fall, 2009 Description: Part Name - Aplhabetical Part Name Assembly Axle Big External Spline Big Internal Spline Drive Chock Drive Chock Bushing Drive Gear Drive Module Driver Driver Bushing Gear Race Hand Rail Hand Rim Hand Wheel Hand Wheel 4 Hand Wheel and Spoke Assembly ... Date Added: 2009-06-03 16:06:58 |
| packedspheres.doc Path: Minnesota >> PHYS >> 3003 Fall, 2009 Description: Face-centered cubic (fcc) Closed-packed hexagonal: AB stack Closed-packed hexagonal: ABC stack ... Date Added: 2009-06-03 16:07:10 |
| Astro101_Read_Me.txt Path: New Mexico >> ASTRO >> 101 Fall, 2009 Description: Astronomy 101 . Section 2 Fall 2008 Lecturer: Dr. J. Matthews, Office: Physics and Astronomy 1029 Phone: 277-2077 (usually UNreliable) Email (very reliable): johnm@phys... Date Added: 2009-06-03 16:07:23 |
| lecture3.ppt Path: UVA >> CS >> 205 Fall, 2008 Description: cs205: engineering software university of virginia fall 2006 Semantics and Specifying Procedures www.cs.virginia.edu/cs205 David Evans Java Semantics cs205: engineering software 2 The Stack and Heap String s = new String (\"hello\");... Date Added: 2009-06-03 16:07:49 |
| scan3.txt Path: UVA >> LAR >> 702 Fall, 2008 Description: begin 600 SCANNING.TXT M4V-A;FYI;F<@:6UA9V5S(B!T:C$N(\"!, M;V=G:6YG(FYI;F<@>6]U<B!D<F%W:6YG#0HS+B @2F]I M;FEN9R!D<F%W:6YG<PT*-\"X@($%D:G5S=4@:6UA9V4-\"C4N(\"!7 M5U<@9FEL92!F;W)M871S#0HV+B @5\')A;G-M:7-... Date Added: 2009-06-03 16:08:10 |
| ecetools_info_slide.ppt Path: The University of Akron >> EE >> 101 Fall, 2009 Description: Tom Hartley Professor of Electrical and Computer Engineering University of Akron Hometown: Mogadore, OH Columbus Mifflin`75 High School: Hobbies: Softball, Football, Boy Scouts Indiana Jones & the Last Crusade Favorite Movie: Favorite Food: Pizza... Date Added: 2009-06-03 16:09:31 |
| scienmeth.doc Path: Grinnell >> ANT >> 104 Fall, 2009 Description: SCIENTIFIC METHODOLOGY I. OBSERVATION A. Reliability B. Validity II. EXPERIMENTATION A. Hypothesis 1. Dependent variable (y) 2. Independent variable (x) 3. Empirical and Logical tests B. Controlled experiment C. Naturalistic study D. Combined methodo... Date Added: 2009-06-03 16:10:58 |
| Equations.doc Path: SHSU >> MGT >> 475 Fall, 2008 Description: Solving Systems of Equations Solving Simultaneous Equations As we discussed earlier in this course mathematical functions are use to model reality. Frequently, we use a combination of functions to describe or model business realities. For example, in... Date Added: 2009-06-03 16:14:20 |
| 22161.ppt Path: Pittsburgh >> SUPER >> 7 Fall, 2009 Description: LECTURE 8 CHILDBIRTH. BEHAVIOR OF THE WOMAN IN LABOR. Dr. Nagayeva S. FOREWORD The outcome of labor depends from woman\'s behavior and management ability of a body and breath. The given lecture represents brief instruction to correct woman\'s beh... Date Added: 2009-06-03 16:15:06 |
| 17351.ppt Path: Pittsburgh >> SUPER >> 7 Fall, 2009 Description: Mosquito Breeding Habitats in SSP in Gujarat Relationship of Poverty with Malaria in the Indian States Below Poverty Line in 1999-2000 Total malaria cases in India % NAMP population in BPL states at risk of malaria Year % Malaria cases in BPL state... Date Added: 2009-06-03 16:15:32 |
| edbi476_web.doc Path: CSU Bakersfield >> EGARZA >> 6 Fall, 2009 Description: CALIFORNIA STATE UNIVERSITY, BAKERSFIELD SCHOOL OF EDUCATION \"Caring and Reflective Professionals for a Democratic Society\" Dr. Emilio Garza EDBI 476 Introduction to Language Acquisition and Development COURSE SYLLABUS School of Education Philosophy ... Date Added: 2009-06-03 16:18:54 |
| survey2.txt Path: North Texas >> SURVEY >> 2 Fall, 2009 Description: gender age class trans_d trans_b trans_t dessert name Date Time Remote Name 2 3 5 1 4 Mary Poe 16 Nov 1999 12:25:50 rss0p133.acs.unt.edu 1 3 6 1 1 2 Karl Ho 16 Nov 1999 12:26:46 rss0p133.acs.unt.edu 1 5 6 1 5 Steven Hawkins 16 Nov 1999 12:27:31 ... Date Added: 2009-06-03 16:20:37 |
| 030314reform1.txt Path: Chester >> ECO >> 343 Fall, 2008 Description: WSJ.com - Schroeder Calls for Reforms To Overcome Economic Crisis March 14, 2003 6:27 a.m. EST EUROPEAN BUSINESS NEWS GERMAN ECONOMY Germany Votes to Extend Weekend Shopping Hour... Date Added: 2009-06-03 16:21:40 |
| Exam1_answer_key.doc Path: Lawrence >> CHEM >> 111 Fall, 2009 Description: Exam 1 answer key Multiple choice 1.c 2.a 3.b 4.b 5.c 6.b and c 7.a 8.a 9.d 10.d 11.d 12.c 13. a 14.b 15.a and b 16. NO is an odd electron molecule where the atons share 2 pairs of electrons, and the O has 2 additional lone pairs and the N has 3 add... Date Added: 2009-06-03 16:21:46 |
| ant-97.txt Path: Harvard >> ANT >> 1 Fall, 2009 Description: $Id: ant-97.txt,v 1.1 2000/02/26 18:35:15 ellard Exp $ Dan Ellard - ellard@ant.harvard.edu Penny Ellard - pellard@ant.harvard.edu THE ANT-1.0 ARCHITECTURE Overview The ANT is ... Date Added: 2009-06-03 16:21:54 |
| CBET000756.txt Path: Harvard >> CFA >> 000700 Fall, 2009 Description: Electronic Telegram No. 756 Central Bureau for Astronomical Telegrams INTERNATIONAL ASTRONOMICAL UNION M.S. 18, Smithsonian Astrophysical Observatory, Cambridge, MA 02138, U.S.A. IAUSUBS@CFA.HARVARD.E... Date Added: 2009-06-03 16:22:08 |
| ecos_hi.txt Path: Stockton >> STK >> 2153 Fall, 2009 Description: +-+ | Layer: ecos_hi Date of Processing to GRASS: Aug 8 18:36:06 1989| | Date of Processing to ARC/INFO: Jan 29 12:53 1996| | | | Ti... Date Added: 2009-06-03 16:23:06 |
| SBEVSL_chat_27Mar2008.txt Path: Dowling >> FRS >> 452 Fall, 2009 Description: Herbert J. Bernstein: Thurs, 27 Mar 08, 20:57 Paul Craig: Good evening. Herbert J. Bernstein: Good evening Herbert J. Bernstein: I just emailed a draft absract for the IUCr meeting to the sbevsl list. Paul Craig: I saw that. Is that meeting in Osaka?... Date Added: 2009-06-03 16:23:14 |
| CV_Harry_Eyres.doc Path: Gonzaga >> GUWEB >> 2 Fall, 2009 Description: CURRICULUM VITAE Name: Harry Charles Edward EYRES Address: 65 Blenheim Terrace London NW8 0EJ Tel/Fax: 020 7624 8994 e-mail: harryeyres@care4free.net Date of Birth: 21 March 1958 Education: 1970 - 1975: Eton College (Kings Scholar): A levels: English... Date Added: 2009-06-03 16:25:29 |
| StudentChoiceDataTable-ES.doc Path: Indiana State >> GOLDSTAR >> 3 Fall, 2009 Description: Indiana Gold Star School Counseling STUDENT CHOICES DATA TABLE ELEMENTARY Data Sources 1 DOE Benchmarks FINDING THE DATA a. b. c. d. e. f. Go to: www.doe.state.in.us Click on ASAP (\"Simply Amazing\" at the top of the page) Click on School Data Cli... Date Added: 2009-06-03 16:25:38 |
| Lab8_PEOC.txt Path: Wisc Platteville >> CS >> 243 Fall, 2009 Description: PEOC Lab - Parameters, Exceptions, Output, Command Line No NetBeans this time - you are going to do it using the command line. 1. Copy the peoc_lab8 folder to your J drive 2. Using Notepad, open _YOUR_ PEOC.java. One way is to highlight the... Date Added: 2009-06-03 16:26:14 |
| rpntutorial.txt Path: Stevens >> RRDTOOL >> 1 Fall, 2009 Description: RPNTUTORIAL(1) rrdtool RPNTUTORIAL(1) NNAAMMEE rpntutorial - Reading RRDtool RPN Expressions by Steve Rader DDEESSCCRRIIPPTTIIOONN This tutorial should help you get to grips with RRDtool RPN... Date Added: 2009-06-03 16:26:58 |
| 11-12-08 Path: Allegheny >> PSYCH >> 206 Fall, 2008 Description: Psychology 206 Class Notes 11/12/08 Sampling Distributions Distributions of statistics are NOT scores How does this work? Repeated Samples Calculate Statistic Make a distribution of the resulting statistics Recall, from Monday We calculated o... Date Added: 2009-06-03 16:27:36 |
| quiz4.txt Path: Binghamton >> CS >> 211 Fall, 2009 Description: CS 211: Engineering Programming Fall 2007 - Section 90 Quiz #4 - 2007/10/15 Name: _ = 1: Circle which of the following (it can be any number of them) are reasons to complete a full design before any code is written: a) To minimize the extr... Date Added: 2009-06-03 16:28:16 |
| NumericExampleOutput.txt Path: Binghamton >> CS >> 140 Fall, 2009 Description: A Program to Illustrate the Behavior and Limitations of Numeric Types Largest valid int number (Integer.MAX_VALUE) = 2147483647 Smallest valid int number(Integer.MIN_VALUE) = -2147483648 Let\'s experiment! Are the above values really the upper and ... Date Added: 2009-06-03 16:28:21 |
| 2002Exam3TakeHomeKeyFinal.doc Path: Carleton >> BIO >> 252 Fall, 2009 Description: Aquatic Biology 2002 Take Home Exam 3 Instructions: This exam is open notes and you may take as long as you like to complete it. Please do not work with anyone else on the exam. All answers should be typed, and no longer than one page long (I will... Date Added: 2009-06-03 16:28:36 |
| 01Johnson.ppt Path: Keystone >> BIOLOGY >> 101 Fall, 2009 Description: Essentials of the Living World Second Edition George B. Johnson Jonathan B. Losos Chapter 1 The Science of Biology Copyright The McGraw-Hill Companies, Inc. Permission required for reproduction or display. 1.1 The Diversity of Life Biology is the... Date Added: 2009-06-03 16:28:45 |
| MIDTERMEXAMVer9.doc Path: Wayne State University >> BE >> 1010 Fall, 2009 Description: BE1010 Fall 2002 MIDTERM EXAM 1. Explain and give an example of the Excel ABS function? (207) 2. When would you not want to buy the fastest and widest memory? (52) 3. What does RAM stand for? (245) 4. What is boot short for? (17) 5. What is a devices... Date Added: 2009-06-03 16:29:47 |
| mail25.txt Path: Rutgers >> CS >> 205 Fall, 2008 Description: From rohanf@remus.rutgers.edu Tue Nov 23 14:59:32 2004 Date: Tue, 23 Nov 2004 14:59:20 -0500 (EST) From: ROHAN FERNANDES <rohanf@remus.rutgers.edu> To: ROHAN FERNANDES <rohanf@remus.rutgers.edu> Subject: Grades for HW 8 put up. Hello, The breakdown ... Date Added: 2009-06-03 16:31:32 |
| Strange.txt Path: Millersville >> CS >> 161 Fall, 2009 Description: public class Strange { public static void main(String[] args) { first(); third(); second(); third(); } public static void first() { System.out.println(\"Inside first method\"); } public static void second() { System.out.println(\"I... Date Added: 2009-06-03 16:32:44 |
| assignment2.doc Path: NMSU >> LSC >> 311 Fall, 2009 Description: L SC 311 - 01 Fall 2003 Date Assigned: September 23, 2003 Date Due: October 21, 2003 50 Points Possible Name: _ Assignment 2: Facts & Objective Information I. Objective Information: Encyclopedias A. Locate and photocopy an entry on your topic in ... Date Added: 2009-06-03 16:34:12 |
| Learner-Anal.ppt Path: Minnesota >> CI >> 5336 Spring, 2008 Description: CI5336 Instructional Design Learner Analysis Transparency Masters to Accompany Smith & Ragan, Instructional Design, 2nd Edition Chapter 4 Learner Analysis Learner Analysis - 2 Learner Analysis Knowledge about learners from research Specific prio... Date Added: 2009-06-03 16:36:05 |
| QuadraticFormulaPPT.ppt Path: N. Arizona >> CH >> 244 Fall, 2009 Description: Using the Quadratic Formula Written by Clinton Henry Table of Contents Explanation of Quadratic Formula Example 1 Example 2 Conclusion Explanation of Quadratic Formula As you saw in the PowerPoint presentation in the last section, we showed how th... Date Added: 2009-06-03 16:38:15 |
| ppfhwk3.doc Path: N. Arizona >> ECO >> 284 Fall, 2008 Description: Name: _ HOMEWORK DUE September 22, 2003 The graph below represents the Production Possibilities Frontiers (PPFs) for two countries in an imaginary twogood world. Assume that Portugal and England have equal resource endowments. This is based on Ricard... Date Added: 2009-06-03 16:38:38 |
| Henry_Kressel.ppt Path: Caltech >> E >> 103 Spring, 2008 Description: Investing in a Transformed Market May 13, 2008 E/ME 103 Caltech Lecture Lessons Learned #1 MARKET Newcomers always face the challenge of gaining customer acceptance Sometimes simple ideas build huge value. Don\'t confuse complexity with value crea... Date Added: 2009-06-03 16:40:19 |
| C3tr.doc Path: Caltech >> C >> 3 Fall, 2009 Description: / C3tr.doc AJW, v 1.0, 2/10/98 / C3tr and its related packages are for CLEO III tracking, the OO way (c+). The packages are: - C3tr - which does CLEO III tracking - C3trProc - which is a suez processor that runs C3tr - ReconTracks - a set of classes ... Date Added: 2009-06-03 16:41:10 |
| G040241-00.ppt Path: Caltech >> G >> 040241 Fall, 2009 Description: LIGO Scientific Collaboration ITR 2003 Advisory Committee Meeting K. Blackburn1, P. Brady2, S. Finn3, E. Katsavounidis1*, S. Koranda2, A. Lazzarini1,A. Wiseman2, J. Zweizig1 1 LIGO Laboratory,2 Penn State University 3 University of Wisconsin, Milwauk... Date Added: 2009-06-03 16:41:13 |
| G010226-00.ppt Path: Caltech >> G >> 010226 Fall, 2009 Description: Summary Remarks: Management of LIGO Gary Sanders California Institute of Technology NRC Committee on Organization and Management of Research in Astronomy and Astrophysics June 14, 2001 LIGO-G010226-00-M This Presentation q q q Introduction to LIGO ... Date Added: 2009-06-03 16:41:47 |
| press.doc Path: Caltech >> SC >> 05 Fall, 2009 Description: World Network Speed Record Shattered Caltech, SLAC, Fermilab, CERN, Michigan, Florida, Brookhaven, Vanderbilt and Partners in the UK, Brazil, Korea and Japan Set 131.6 Gigabit Per Second Mark During the SuperComputing 2005 Bandwidth Challenge SEATTLE... Date Added: 2009-06-03 16:41:56 |
| G030393-00.ppt Path: Caltech >> G >> 030393 Fall, 2009 Description: Data Quality Segments Repository Keith Riles (University of Michigan) LIGO Scientific Collaboration Meeting Hannover University August 20, 2003 LIGO-G030393-00-Z Data Quality Segments Repository 2003.8.20 K. Riles - University of Michigan 1 What ... Date Added: 2009-06-03 16:42:24 |
| hwk6_examQs.doc Path: Winthrop >> CSCI >> 101 Fall, 2008 Description: CSCI 101 REVIEW QUESTIONS Homework 6 Write out and bring to class 14 (week after projects): FIVE MULTIPLE CHOICE QUESTIONS WITH ANSWER INDICATED suitable for use on the final, comprehensive exam. We will use these for review in class. You will tur... Date Added: 2009-06-03 16:42:42 |
| G060340-00.ppt Path: Caltech >> G >> 060340 Fall, 2009 Description: TheVirgo noisebudge t Romain Gouaty For the Virgo collaboration GWADW 2006, Isola d\'Elba 1 Summary Introduction : the sensitivity curves of Virgo Commissioning Analysis of the technical noises : - Length control noise - Angular control noise - M... Date Added: 2009-06-03 16:44:36 |
| verification.ppt Path: Auburn >> E >> 7770 Fall, 2009 Description: ELEC 7770 Advanced VLSI Design Spring 2007 Verification Vishwani D. Agrawal James J. Danaher Professor ECE Department, Auburn University Auburn, AL 36849 vagrawal@eng.auburn.edu http:/www.eng.auburn.edu/~vagrawal/COURSE/E7770_Spr07 Spring 07, Feb 6 E... Date Added: 2009-06-03 16:44:51 |
| Lab_11.doc Path: MNSU >> IT >> 100 Fall, 2008 Description: Lab 11, Spring 2007 Overview: In this lab you will continue to practice writing programs in Python. In last week\'s lab, you used input, output, and assignment statements, along with a simple selection statement. In this week\'s lab, you will extend yo... Date Added: 2009-06-03 16:48:23 |
| technology.doc Path: Iowa State >> MR >> 0126 Fall, 2009 Description: Alestle, IL 01-25-07 Staff Editorial Society is too dependent on technology Zach Groves, News Reporter Issue date: 1/25/07 Section: Editorial When Kip Dynamite sang the song \"I love technology\" at the end of the movie \"Napoleon Dynamite,\" he made it ... Date Added: 2009-06-03 16:48:38 |
| technology.doc Path: Iowa State >> PUBLIC >> 0126 Fall, 2009 Description: Alestle, IL 01-25-07 Staff Editorial Society is too dependent on technology Zach Groves, News Reporter Issue date: 1/25/07 Section: Editorial When Kip Dynamite sang the song \"I love technology\" at the end of the movie \"Napoleon Dynamite,\" he made it ... Date Added: 2009-06-03 16:48:38 |
| OM-05-StrategicCapacityManagement.ppt Path: New Mexico >> MGMT >> 720 Fall, 2008 Description: Strategic Capacity Management and Learning Curves Selected Slides from Jacobs et al, 9 Edition Capacity Capacity can be defined as the ability to hold, receive, store, or accommodate Strategic capacity planning is an approach for determining the o... Date Added: 2009-06-03 16:49:22 |
| cs477hw2spr06.doc Path: Idaho State >> CS >> 477 Fall, 2009 Description: CS 477 Operating Systems, Spr 2006 Assignment 2, due Feb 16th 1. Write a C/C+ program that creates a tree of processes. Each process spawns 2 children. The tree has 3 levels of nodes beyond the root level. Each process prints its PID, then spawns its... Date Added: 2009-06-03 16:49:50 |
| evaluation.ppt Path: WVU >> PUBA >> 430 Fall, 2009 Description: Summary Slide PROGRAM EVALUATION PA430 Week 7 2/293/1/00 PROGRAM EVALUATION A systematic assessment of the operation and/or outcomes of a program or policy Comparison against a set of explicit of implicit standards Means of contribut... Date Added: 2009-06-03 16:49:54 |
| 24-relations-intro.ppt Path: UVA >> CS >> 202 Fall, 2008 Description: Relations and Their Properties Rosen, section 7.1 CS/APMA 202 Aaron Bloomfield 1 What is a relation Let A and B be sets. A binary relation R is a subset of A B Example Let A be the students in a the CS major A = {Alice, Bob, Claire, Dan} Let B... Date Added: 2009-06-03 16:52:39 |
| persuasiveessay.doc Path: CSU Sacramento >> IMET >> 5 Fall, 2009 Description: Persuasive Essay Introduction Open with an attention-grabber Give background information needed to understand the issue Present your thesis statement Body Reason Reason Reason Evidence Evidence Evidence Analysis Analysis Analysis Order of I... Date Added: 2009-06-03 16:56:32 |
| cancer_noncancer.txt Path: UGA >> HCC >> 500 Fall, 2009 Description: 100 12 # Class Score Mean0 Std0 Mean1 Std1 Perm 1% Perm 5% Perm (user) Feature Desc 1 cancer 9.12 -0.01 0.02 -0.17 0.03 9.414643 7.077185 4.8930774 33367_s_at feature_2621 2 cancer 6.19 -0.06 0.03 -0.21 0.03 6.5018024 6.070054 4.4619584 35296_at fea... Date Added: 2009-06-03 17:00:18 |
| Socdim-Tentativeschedule-SOSC4352B.doc Path: Maple Springs >> SOSC >> 4350 Fall, 2009 Description: Final schedule of seminar presentations for SOSC 4352B October 31- ProvocationNovember 7- Sexual assault- Kavita Dogra and Khurram Shahid; Yuuki Nishiyasu November 21- Self-defense- John Ventrella, Monica Visperas, and Kendra Morrissey January 9- De... Date Added: 2009-06-03 17:07:28 |
| week10.doc Path: UAB >> CMPT >> 272 Fall, 2009 Description: CMPT 272 Formal Systems and Logic in Computing Science Exercises Week #10 Questions 1. Let A = { 1, 2, 3, 4, 5 }, B = { w, x, y, z }, C = { a, b, c, d, e, f, g } and D = { 6, 8, 10, 12 }, indicate if the following relations are functions or not. a)... Date Added: 2009-06-03 17:07:46 |
| guide_to_select_Nov_2000.doc Path: East Los Angeles College >> CE >> 00218 Fall, 2009 Description: A Bit of A Guide to Using Select! Contents Section 1. 2. 3. 4. 5. 6. 7. 8. 9. 10. 11 12. 13 14. Topic Introduction Starting the Select package Creating a new project Exiting from Select Retrieving an existing project Drawing a context diagram Drawing... Date Added: 2009-06-03 17:08:13 |
| 2-13-09 Path: Allegheny >> ECON >> 200 Spring, 2009 Description: Microeconomics Class Notes 2/13/09 HOMEWORK PROBLEMS: Chapter 3 End of Chapter (textbook) # 11, 14, 18-25 QUIZ MONDAY Why does the demand curve slope downward? Substitution effect always moves you away from the good that is more expensive (if... Date Added: 2009-06-03 17:45:43 |
| 4-27-09 Path: Allegheny >> ECON >> 200 Spring, 2009 Description: Microeconomics Class Notes 4/27/09 Monopolistic Competition Looks the closest to perfect competition Characteristics: Product differentiation each firm makes a slightly different product Product Differentiation: Ways to separate your product fr... Date Added: 2009-06-03 17:46:38 |
| Day3StoringInformation_VariablesAndConstants.doc Path: CSU Fullerton >> PROG >> 1030 Fall, 2009 Description: PROG1030 C Programming Day 3 Storing Information: Variables and Constants Storing Information with Variables A variable is a named data storage location in your computer\'s memory. By using a variable\'s name in your program, you are, in effect, refer... Date Added: 2009-06-03 19:28:24 |
| drrelax.doc Path: Cuyamaca College >> SRMK >> 3683 Fall, 2009 Description: 1) Sport Psychology For Every Skier http:/www.drrelax.com/skirace.htm Same method as the other two of going through search under Sport Psychology. Click on \"Sport Psychology For Every Athlete\" to get into the ski racer web site. This web site is pr... Date Added: 2009-06-03 19:32:48 |
| agric1.sps.txt Path: NSULA >> ENQ >> 10166 Fall, 2009 Description: file handle agric1.86/name=\'agric1.86\' lrecl=1602. Data List File=\'agric1.86\' / AREA 1 - 9 PROVINCE 1 - 2 AGREGION 3 - 4 CD 5 - 6 CCSD 7 - 9 GEOIDENT 10 - 1... Date Added: 2009-06-03 19:34:53 |
| agric1.sps.txt Path: NSULA >> SHERLOCK >> 10166 Fall, 2009 Description: file handle agric1.86/name=\'agric1.86\' lrecl=1602. Data List File=\'agric1.86\' / AREA 1 - 9 PROVINCE 1 - 2 AGREGION 3 - 4 CD 5 - 6 CCSD 7 - 9 GEOIDENT 10 - 1... Date Added: 2009-06-03 19:34:53 |
| JavaBasics.ppt Path: CSU Fullerton >> BPJ >> 444 Fall, 2009 Description: BPJ444: Business Programming using Java Java basics Tim McKenna Seneca@York Outline Java classes and members primitive and reference fields operators control flow statements the BigDecimal class the wrapper classes Java Class source code ... Date Added: 2009-06-03 19:45:19 |
| 31-servlet-mvc.ppt Path: Contra Costa College >> SOEN >> 343 Fall, 2009 Description: Java Server Pages and MVC May 15, 2009 Why JavaServer Pages? Servlets are fine, but what if? you have hundreds of line of html code? Writing HTML in println() can be ugly HTML Designers need to know Java and Vice versa. Not all HTML page d... Date Added: 2009-06-03 19:45:25 |
| 31-servlet-mvc.ppt Path: Contra Costa College >> TUTORIAL >> 343 Fall, 2009 Description: Java Server Pages and MVC May 15, 2009 Why JavaServer Pages? Servlets are fine, but what if? you have hundreds of line of html code? Writing HTML in println() can be ugly HTML Designers need to know Java and Vice versa. Not all HTML page d... Date Added: 2009-06-03 19:45:33 |
| 8IMMUNOTHERAPY.ppt Path: Maple Springs >> PSYCH >> 4080 Fall, 2009 Description: IMMUNOTHERAPY: The Human Therapeutic Cocaine Vaccine Why Is Cocaine Addiction so Difficult to Treat? Approaches to Cocaine Addiction The inability to create an effective pharmacotherapy for the the treatment of cocaine addiction is, at least i... Date Added: 2009-06-03 19:47:01 |
| SRT510Ex1A.doc Path: CSU Fullerton >> SRT >> 510 Fall, 2009 Description: SRT510 Exercise 1 \"G is for Garden\" A new garden centre Started by D. Plant Page 1 of 3 At startup D. Plant Invested $1M into the business. $200K was her own money, and $800K was provided by 4 lenders. Purchased seed beds and storage tables and... Date Added: 2009-06-03 19:47:23 |
| lect38.ppt Path: ECCD >> CHEM >> 1000 Fall, 2009 Description: Lecture 38 Electrochemistry II Standard Reduction Potentials Stronger Oxidizing Agent F2(g) + 2 eAg+(aq) + e- Eo, V 2 F-(aq) +2.87 Ag(s) +0.80 +0.34 0.00 - 0.76 - 3.04 Cu(s) Cu+2(aq) + 2 e H2(g) 2 H+(aq) + 2 e Zn(s) Zn+2(aq) + 2 eLi+(aq) + e-... Date Added: 2009-06-03 19:49:35 |
| 2008_Lecture_14_Summer_Crime-Deviance_Alternative-Aboriginal_Justice.ppt Path: Maple Springs >> SOCI >> 4360 Fall, 2009 Description: May 28th Lecture #14 Alternative Justice Models: Beyond the `Formal\' State-owned/ State-run Social Control Regimes (Aboriginal Justice/ Youth Justice) Continuation from last week. Prison for Women-Women in Prison Pains of imprisonment.is there a ... Date Added: 2009-06-03 19:51:16 |
| whatAreDTDs.ppt Path: UWI Mona >> CS >> 569 Fall, 2009 Description: What Are Real DTDs Like Group Members : Xijie Zeng Peiyu Cai Presentor : Xijie Zeng Outline Overview Introduction Local properties Global properties Overview XML is widely used in a variety of areas DTDs with different structu... Date Added: 2009-06-03 19:51:32 |
| 4.txt Path: McGill >> CIM >> 646 Fall, 2009 Description: TITLE: Random-Dot Single-Image Stereograms 1 Introduction Random-dot stereograms were briefly covered in class as part of the `Binocular Stereopsis\' lecture. This report will cover the generation of, and problems associated with, Single Image Ra... Date Added: 2009-06-03 19:52:01 |
| as2000A3.txt Path: McGill >> CS >> 208 Fall, 2009 Description: McGill University School of Computer Science Computers in Engineering 308-208 Assignment #3... Date Added: 2009-06-03 19:53:19 |
| ReadingGroup.txt Path: Brookdale >> CS >> 6505 Fall, 2009 Description: Reading group for Machine Learning, Summer 2004 - http:/www.cs.dal.ca/~eem/6505/ReadingGroup Members: Mehdi Shafiei Roger Zhang Audit: Pifu Zhang Singer Wang email alias: alias mlReading shafiei, hliu, rogerz, ssingh, pifu, swang General... Date Added: 2009-06-03 19:53:55 |
| me110_03-04.doc Path: East Los Angeles College >> ME >> 110 Fall, 2009 Description: s SCHOOL OF ENGINEERING MODULAR HONOURS DEGREE COURSE LEVEL 1 SEMESTER 2 2003/2004 ME110 1/10 AIRCRAFT AND AUTOMOTIVE SYSTEMS Examiners: Dr J Leary/Dr M Philip Attempt FOUR questions only Time allowed: 2 hours Total number of questions = 6 All ... Date Added: 2009-06-03 19:55:57 |
| Intro1000.ppt Path: Maple Springs >> LECTURES >> 1000 Fall, 2009 Description: Course Introduction AK/ITEC 1000.03 \"Introduction to Information Technologies\" http:/www.getfunnypictures.com/crt360.html [Prof. Peter Khaiter] 1 Contact Information Instructor Office Prof. Peter Khaiter TEL Bldg., # 3044 Mondays, Th... Date Added: 2009-06-03 19:57:01 |
| U7B-Notes-2004.doc Path: East Los Angeles College >> CS >> 1210 Fall, 2009 Description: UNIT 7B: One Lecture CASE STUDY: The `EvadeX\' Program Revisited Again - A Design Involving Recursion Unit Objectives: Describe mutual recursion and illustrate its application in problem-solving Further demonstrate the power of recursion in program ... Date Added: 2009-06-03 19:57:27 |
| abori_e.txt Path: Air Force Academy >> STA >> 575 Fall, 2009 Description: - 7 - ABORIGINAL PEOPLES OF CANADA ADAPTATIONS REGULATIONS (FIREARMS) INTERPRETATION 1. The definitions in this section apply in these Regulations. \"Abori... Date Added: 2009-06-03 19:57:57 |
| Lecture2.ppt Path: Laurentian >> ART >> 200901 Fall, 2009 Description: ... Date Added: 2009-06-03 20:00:03 |
| MT1Ans.doc Path: Laurentian >> CHEM >> 1000 Fall, 2009 Description: Question One (four marks) What is the difference in mass between a nickel that has a mass of 4.8 g and one that has a mass of 4.8673 g? This is a question of significant figures. The difference is 0.0673 which must be rounded off to the fewest deci... Date Added: 2009-06-03 20:00:26 |
| CHAP07PP.PPT Path: Laurentian >> MGT >> 3650 Fall, 2009 Description: Chapter 7 Global Alliances and Strategy Implementation PowerPoint by Kristopher Blanchard North Central University 2006 Prentice Hall 7-1 Strategic Alliances It is no longer an era in which a single company can dominate any technology or business... Date Added: 2009-06-03 20:01:55 |
| hefab11996338.txt Path: Allan Hancock College >> HEFAB >> 11996338 Fall, 2009 Description: 1996 The Parliament of the Commonwealth of Australia HOUSE OF REPRESENTATIVES Presented and read a first time Higher Education Funding Amendment Bill (No. 1) 1996 No. , 1996 (Employment, Education and Training) A Bill for a... Date Added: 2009-06-03 20:02:17 |
| x_mt2-fall07_answers.doc Path: Laurentian >> MGT >> 200703 Fall, 2009 Description: Midterm Two November 7, 2007 1. (20 pts) In trying to forecast the Canadian dollar price of the U.S. dollar in the next three months, what is your conclusion with respect to trend and volatility? Use fundamental analysis to support your conclus... Date Added: 2009-06-03 20:02:38 |
| intro.ppt Path: Laurentian >> ANTH >> 200303 Fall, 2009 Description: Agenda Bingo - Introductions Course Overview 5 min Break The Nature and Scope of Anthropology Core Concepts holism ethnology and ethnography Ethnocentrism vs cultural relativism Emic versus emic Value of Anthropology Break The Concept of Culture Fie... Date Added: 2009-06-03 20:02:54 |
| UofLFinancechapter5.ppt Path: Laurentian >> MGT >> 3040 Fall, 2009 Description: T5.1 Chapter Outline Introduction to Valuation: The Time Value of Money Chapter Organization 5.1 Future Value and Compounding Chapter 5 5.2 Present Value and Discounting 5.3 More on Present and Future Values 5.4 Summary and Conclusions CLIC... Date Added: 2009-06-03 20:03:06 |
| 3300assign10fall2008.doc Path: Laurentian >> AGST >> 33001 Fall, 2009 Description: Agricultural Studies 3300 Agricultural Systems Modeling I Fall 2008 Assignment # 10 Due Friday, December 5th , 2008, At 8am. PRIMAL: A carpenter produces tables (X1) and chairs (X2) for sale in a market. He makes a net income of $50 of each table an... Date Added: 2009-06-03 20:04:54 |
| midterm2overview.ppt Path: Laurentian >> ECON >> 200801 Fall, 2009 Description: UTILITY AND DEMAND CHAPTER 7 7-1 2003 Pearson Education Canada Inc. Household Consumption Choices A household\'s consumption choices are determined by: Consumption possibilities Preferences Consumption Possibilities: Budget Constraint The bu... Date Added: 2009-06-03 20:04:55 |
| engg2000-outline.doc Path: Laurentian >> ENGG >> 200503 Fall, 2009 Description: ENGINEERING 2000 ENGINEERING MECHANICS (Statics) Fall 2005 http:/directory.uleth.ca/users/seyeb0 Instructor: Behnam Seyed-Mahmoud Office: E886 University Hall Phone: 329-2360 Email: Required Text: Required Workbook: Engineering Mechanics Statics a... Date Added: 2009-06-03 20:05:44 |
| 2245f-Preliminaries.ppt Path: Laurentian >> HLSC >> 2245 Fall, 2009 Description: ASSESSMENT PRELIMINARIES INITIAL CONTACT Establish whether person has strong preference for time (day/evening; weekday/weekend) and therapist (male/female) (assuming your agency has some flexibility for these things). Assign the case to someone with... Date Added: 2009-06-03 20:06:19 |
| readingsforMar42008.doc Path: Virgin Islands >> LAW >> 300 Fall, 2009 Description: EUS 300 Course Outline March 4 2008 Article 234: The reference for a preliminary ruling How the ECJ \"federalizes\" the EU judicial system Readings: excerpts from cases: 1. NV Algemene Transport en Expeditie Onderneming van Gend & Loos v Netherlands I... Date Added: 2009-06-03 20:07:57 |
| RFP_template06v1.0.doc Path: Virgin Islands >> SENG >> 321 Fall, 2009 Description: MetroLink Bus Tracking System Request for Proposal Version 1.0 January 20, 2006 Bus Tracking System Request for Proposal Project Version 1.0 Document History Version 1.0 When 20060120 Who MetroLink Team What Initial Drafting Table of Conte... Date Added: 2009-06-03 20:09:33 |
| rcfilters.doc Path: East Los Angeles College >> ES >> 153 Fall, 2009 Description: RC HIGH PASS AND LOW PASS FILTER SECTIONS High Pass Filter (Series Capacitor) [Bogart P370] V2 1 H(j ) = - (j ) = -V1 1-j c/ 1 fc = -2RC 1 H(j ) = -(1+( c/ )2) L(j ) = tan-1 ( c/ ) Magnitude Response [ c = 1/RC] Phase Response 1 1 Exact res... Date Added: 2009-06-03 20:10:47 |
| lecture3.ppt Path: East Los Angeles College >> PH >> 121 Fall, 2009 Description: Issues in Philosophy Guy Longworth g.longworth@mac.com The argument from \"queerness\" Why does Mackie believe that subjectivism is correct? Mackie believes that subjectivism is correct because he believes that objective moral values would have to be ... Date Added: 2009-06-03 20:11:01 |
| syll928-07.doc Path: East Los Angeles College >> EC >> 928 Fall, 2009 Description: EC928 Microeconomic Topics in Development and Transition Introduction: Acemoglu, and Robinson \"The Social Origin of Dictatorship and Democracy\". Chapter 1,2,3, * Amoglu, D, S. Johnson and J. Robinson (2001) \"The Colonial Origins of Comparative Develo... Date Added: 2009-06-03 20:14:09 |
| Marks-final.txt Path: W. Alabama >> CS >> 486 Fall, 2009 Description: #Id A1 A2 Midterm A3 A4 Final Project Course 12222 85 45 53 80 100 63 66.8 26109 98 89 91 89 100 72 84.6 27332 53 32437 36970 85 76 43 79 100 46 61 56462 0 0 77 33 50 48 42.9 71100 82 73 88 94 95 76 82.4 80624 96 10... Date Added: 2009-06-03 20:16:33 |
| table_ascii_examen_dec_hex.txt Path: Université du Québec à Montréal >> INF >> 7212 Fall, 2009 Description: Unicodes de valeurs 32 127 exprims en bases 10 et 16 Char Dec Hex | Char Dec Hex | Char Dec Hex - (sp) 32 0x20 | @ 64 0x40 | ` 96 0x60 ! 33 0x21 | A 65 0x41 | a 97 0x61 \" 34 0x22 | B 66 0x42 | b 98 0x... Date Added: 2009-06-03 20:18:18 |
| note3_0820.doc Path: Laurentian >> CS >> 250 Fall, 2009 Description: Class Note CS 250 Part III: Introduction to Assembly Language 1 1. Why Assembly Language? Complete control over the processor Space efficiency Faster running (execution) System programs Communication programs 2. Four steps involved in Assem... Date Added: 2009-06-03 20:19:56 |
| mcm10mins.doc Path: East Los Angeles College >> COST >> 261 Fall, 2009 Description: COST 261 EMC IN COMPLEX AND DISTRIBUTED SYSTEMS MINUTES OF THE TENTH MANAGEMENT COMMITTEE MEETING BUDAPEST, HUNGARY 3rd & 4th June 2002 Attendees. Prof A C Marvin Prof J Catrysse Prof G Varju Dr J Welinder Prof P Degauque Prof J Skrzypczynski Prof H ... Date Added: 2009-06-03 20:21:55 |
| SA350D01.TXT Path: Sveriges lantbruksuniversitet >> ARTS >> 20033 Fall, 2009 Description: Sheet1 PROFILE OF STUDENTS IN SFU COURSES COURSE: SA 350-4 D01 LOCATION: SFU TITLE: SOCIOLOGICAL THOUGHT SECTION TYPE: SEM SEMESTER: 2003-3 ENROL: 27 = PROGRAM OF STUDENT (Top 5 programs reported in each category Programs with < 3 students not shown ... Date Added: 2009-06-03 20:22:43 |
| 2320Lecture24.ppt Path: Laurentian >> PSYC >> 2320 Fall, 2009 Description: Read: Sacks for Thursday Loftus for Tuesday Vokey for Thursday Iconic Memory a brief storage of \"raw data\" in the visual system Echoic Memory Auditory information is stored in a similar sensory \"buffer\" Echoic memory seems to last for several se... Date Added: 2009-06-03 20:24:03 |
| phys326d01.txt Path: Sveriges lantbruksuniversitet >> PHYS >> 19981 Fall, 2009 Description: PROFILE OF STUDENTS IN SFU COURSES COURSE: PHYS 326-3 D01 LOCATION: SFU TITLE: ELECTR/INSTRUMENT. SECTION TYPE: LEC SEMESTER: 1998-1 ENROL: 7 ... Date Added: 2009-06-03 20:27:14 |
| v03.n405.txt Path: Air Force Academy >> STA >> 575 Fall, 2009 Description: Received: from broadway.sfn.saskatoon.sk.ca (majordomo@broadway.sfn.saskatoon.sk.ca [198.169.128.1]) by skatter.USask.Ca (8.9.3/8.8.5) with ESMTP id HAA28029; Sun, 2 Jul 2000 07:47:52 -0600 (CST) Received: (from majordomo@localhost) by broadway.sf... Date Added: 2009-06-03 20:28:16 |
| v03.n405.txt Path: Air Force Academy >> V >> 575 Fall, 2009 Description: Received: from broadway.sfn.saskatoon.sk.ca (majordomo@broadway.sfn.saskatoon.sk.ca [198.169.128.1]) by skatter.USask.Ca (8.9.3/8.8.5) with ESMTP id HAA28029; Sun, 2 Jul 2000 07:47:52 -0600 (CST) Received: (from majordomo@localhost) by broadway.sf... Date Added: 2009-06-03 20:28:16 |
| jula113.txt Path: Air Force Academy >> STA >> 575 Fall, 2009 Description: EVIDENCE [Recorded by Electronic Apparatus] Thursday, April 27, 1995 .1535 [Image] [English] The Chair: I\'d like to call the meeting to order. We are continuing with our consideration of Bill C-68, An Act respecting firearms and other weapons. ... Date Added: 2009-06-03 20:28:58 |
| 1965rcs0-599.doc Path: Neumont >> EN >> 1965 Fall, 2009 Description: Supreme Court of Canada Dominion Auto Accessories Ltd. v. De Frees et al., [1965] S.C.R. 599 Date: 1965-06-07 Dominion Auto Accessories Limited (Defendant) Appellant; and Barbara B. De Frees And Betts Machine Company (Plaintiffs) Respondents. 1965: M... Date Added: 2009-06-03 20:29:18 |
| 1965rcs0-599.doc Path: Neumont >> CSC >> 1965 Fall, 2009 Description: Supreme Court of Canada Dominion Auto Accessories Ltd. v. De Frees et al., [1965] S.C.R. 599 Date: 1965-06-07 Dominion Auto Accessories Limited (Defendant) Appellant; and Barbara B. De Frees And Betts Machine Company (Plaintiffs) Respondents. 1965: M... Date Added: 2009-06-03 20:29:18 |
| fpa346d01.txt Path: Sveriges lantbruksuniversitet >> ARTS >> 19963 Fall, 2009 Description: PROFILE OF STUDENTS IN SFU COURSES COURSE: FPA 346-3 D01 LOCATION: SFU TITLE: MUSIC COMPOSITION IV SECTION TYPE: SEM SEMESTER: 1996-3 ENROL: 3 ... Date Added: 2009-06-03 20:29:34 |
| v01n927.txt Path: Air Force Academy >> STA >> 575 Fall, 2009 Description: From owner-cdn-firearms-digest@broadway.sfn.saskatoon.sk.ca Thu Jul 31 11:35:13 1997 From: owner-cdn-firearms-digest@sfn.saskatoon.sk.ca (Cdn-Firearms Digest) To: cdn-firearms-digest@broadway.sfn.saskatoon.sk.ca Subject: Cdn-Firearms Digest V1 #927 ... Date Added: 2009-06-03 20:30:09 |
| v04-n341.txt Path: Air Force Academy >> STA >> 575 Fall, 2009 Description: From: owner-cdn-firearms-digest@sfn.saskatoon.sk.ca on behalf of Cdn-Firearms Digest [owner-cdn-firearms-digest@sfn.saskatoon.sk.ca] Sent: Tuesday, 04 December, 2001 13:02 To: cdn-firearms-digest@broadway.sfn.saskatoon.sk.ca Subject: Cdn-Firearms Dig... Date Added: 2009-06-03 20:30:46 |
| mvsab1998335.txt Path: Allan Hancock College >> MVSAB >> 1998335 Fall, 2009 Description: _ MOTOR VEHICLE STANDARDS AMENDMENT BILL 1998 1998 THE PARLIAMENT OF THE COMMONWEALTH OF AUSTRALIA HOUSE OF REPRESENTATIVES _ MOTOR VEHICLE ... Date Added: 2009-06-03 20:31:03 |
| TowardsComprehensiveModel.ppt Path: Laurentian >> GEOG >> 3230 Fall, 2009 Description: Towards a Comprehensive Model of \"Place-Community\" and Urban Social Differentiation Geog 3230 Dr. Ivan Townshend University of Lethbridge Department of Geography 1 Utility and Limitations of the material covered to date: Internal structure / geog... Date Added: 2009-06-03 20:31:32 |
| QuestionsPartIIIB_000.doc Path: Virgin Islands >> LAW >> 319 Fall, 2009 Description: LAW 319 - TRUSTS PART IIIB - QUESTIONS Overriding the Trust Instrument Describe a right of revocation and what must be done to reserve such a right. Why is a right of revocation infrequently used in Canada? Set out the broader version of the rule in ... Date Added: 2009-06-03 20:33:02 |
| v04-n217.txt Path: Air Force Academy >> STA >> 575 Fall, 2009 Description: From: owner-cdn-firearms-digest@sfn.saskatoon.sk.ca on behalf of Cdn-Firearms Digest [owner-cdn-firearms-digest@sfn.saskatoon.sk.ca] Sent: Tuesday, 23 October, 2001 10:49 To: cdn-firearms-digest@broadway.sfn.saskatoon.sk.ca Subject: Cdn-Firearms Dige... Date Added: 2009-06-03 20:33:23 |
| ipta2001283.txt Path: Allan Hancock College >> IPTA >> 2001283 Fall, 2009 Description: INSURANCE PROTECTION TAX ACT 2001 - As at 13 December 2007 - Act 40 of 2001 TABLE OF PROVISIONS TABLE OF PROVISIONS PART 1 - PRELIMINARY 1. Name of Act 2. Commencement 3. Definitions PART 2 - IMPOSITION OF TAX Division 1 - ... Date Added: 2009-06-03 20:33:49 |
| v02n683.txt Path: Air Force Academy >> STA >> 575 Fall, 2009 Description: From - Mon Nov 9 11:13:56 1998 Received: from broadway.sfn.saskatoon.sk.ca (majordomo@broadway.sfn.saskatoon.sk.ca [198.169.128.1]) by skatter.USask.Ca (8.8.5/8.8.5) with ESMTP id IAA27474; Sat, 7 Nov 1998 08:36:01 -0600 (CST) Received: (from majo... Date Added: 2009-06-03 20:34:07 |
| rendition.ALL.txt Path: Allan Hancock College >> ICE >> 223 Fall, 2009 Description: <!DOCTYPE html PUBLIC \"-/W3C/DTD XHTML 1.0 Strict/EN\" \"http:/www.w3.org/TR/xhtml1/DTD/xhtml1-strict.dtd\"> <html xmlns=\"http:/www.w3.org/1999/xhtml\" lang=\"en\" xml:lang=\"en\"> <head> <title>Changeset 223 for solrdocs/project_docs/.ice/ARROW_Min... Date Added: 2009-06-03 20:36:32 |
| ccaa200836o2008271.txt Path: Allan Hancock College >> CCAA >> 200836 Fall, 2009 Description: The legislation that is being viewed is valid for Sessional. Climate Change (State Action) Act 2008 (No. 36 of 2008) - CONTENTS Climate Change (State Action) Act 2008 ... Date Added: 2009-06-03 20:38:59 |
| rdb2004261.txt Path: Allan Hancock College >> RDB >> 2004261 Fall, 2009 Description: House of Assembly No 26 As laid on the table and read a first time, 13 October 2004 South Australia Referendum (Direct Democracy) Bill 2004 A Bill For An Act to provide for the submission of the Direct Democracy (Citizen-Initiated Referendums) B... Date Added: 2009-06-03 20:39:54 |
| CMS30110703.ppt Path: Allan Hancock College >> CMS >> 3011 Fall, 2009 Description: Australia\'s Telecommunication Policy Julianne Stewart Competition Convergence Control Hilmer Report End of government monopolies Partial competition era Australian Competition and Consumer Commission The future? Government responses to C... Date Added: 2009-06-03 20:40:19 |
| gtcma2003361.txt Path: Allan Hancock College >> GTCMA >> 2003361 Fall, 2009 Description: GENE TECHNOLOGY (GM CROP MORATORIUM) ACT 2003 - As at 1 January 2009 - Act 12 of 2003 TABLE OF PROVISIONS TABLE OF PROVISIONS PART 1 - PRELIMINARY 1. Name of Act 2. Commencement 3. Object of Act 4. Definitions 5. Food plan... Date Added: 2009-06-03 20:43:03 |
| ohassar20082n261o2008733.txt Path: Allan Hancock College >> OHASSAR >> 20082 Fall, 2009 Description: EXPLANATORY STATEMENT Select Legislative Instrument 2008 No. 261 Issued by the authority of the Minister for Employment and Workplace Relations Occupational Health and Saf... Date Added: 2009-06-03 20:43:06 |
| Dome_Temp.txt Path: Allan Hancock College >> PHYSICS >> 001 Fall, 2009 Description: Time Time In Secs Dome Temp 2009_04_20 09:53:03 3323065983 23.7768 2009_04_20 09:53:05 3323065985 23.6805 2009_04_20 09:54:08 3323066048 23.9694 2009_04_20 09:55:11 3323066111 23.9212 2009_04_20 09:56:14 3323066174 23.7768 2009_04_20 09:57:16 3323066... Date Added: 2009-06-03 20:43:30 |
| selfappraisal.ppt Path: Allan Hancock College >> B >> 22394 Fall, 2009 Description: SELF APPRAISAL Having deferred most of last year I came into this subject being told by my old classmates that it was challenging, mostly due to the digital nature of the course. I found this to be the case. I was genuinely surprised at my lack of ... Date Added: 2009-06-03 20:43:32 |
| cfacgab21999606.txt Path: Allan Hancock College >> CFACGAB >> 21999606 Fall, 2009 Description: 1998-99 The Parliament of the Commonwealth of Australia HOUSE OF REPRESENTATIVES Presented and read a first time Classification (Publications, Films and Computer Games) Amendment Bill (No. 2) 1999 No. , 1999 (Attorney-Gener... Date Added: 2009-06-03 20:44:00 |
| learab2007541.txt Path: Allan Hancock College >> LEARAB >> 2007541 Fall, 2009 Description: Passed by both Houses New South Wales Law Enforcement (Powers and Responsibilities) Amendment Bill 2007 Contents ... Date Added: 2009-06-03 20:45:20 |
| webography5.doc Path: Allan Hancock College >> SRES >> 1001 Fall, 2009 Description: SRES 1001 Critical Webography David Jorm u4137574 ISF, 2001, `Institute for Sustainable Futures\', http:/www.isf.uts.edu.au/ (Accessed 13/03/2005) The ISF is a research institute based in the University of Technology, Sydney. The institute is engaged ... Date Added: 2009-06-03 20:46:11 |
| itab2006312.txt Path: Allan Hancock College >> ITAB >> 2006312 Fall, 2009 Description: Western Australia Industrial Training Amendment Bill 2006 CONTENTS 1. Short title 2 2. Commencement 2 3. The Ac... Date Added: 2009-06-03 20:48:20 |
| casar200422004n230467.txt Path: Allan Hancock College >> CASAR >> 200422004 Fall, 2009 Description: CIVIL AVIATION SAFETY AMENDMENT REGULATIONS 2004 (NO. 2) 2004 NO. 230 CIVIL AVIATION SAFETY AMENDMENT REGULATIONS 2004 (NO. 2) 2004 NO. 230 - TABLE OF PROVISIONS 1. Name of Regulations 2. Commencement 3. Amendment of Civil Aviation Safet... Date Added: 2009-06-03 20:48:32 |
| version_info.txt Path: Allan Hancock College >> DIST >> 9909 Fall, 2009 Description: <!DOCTYPE html PUBLIC \"-/W3C/DTD XHTML 1.0 Strict/EN\" \"http:/www.w3.org/TR/xhtml1/DTD/xhtml1-strict.dtd\"> <html xmlns=\"http:/www.w3.org/1999/xhtml\" lang=\"en\" xml:lang=\"en\"> <head> <title>Changeset 9909 for ice/trunk/apps/ice-maker/dist/versi... Date Added: 2009-06-03 20:48:37 |
| sracar20082n126o2008667.txt Path: Allan Hancock College >> SRACAR >> 20082 Fall, 2009 Description: EXPLANATORY STATEMENT Select Legislative Instrument 2008 No. 126 Issued by the authority of the Minister for Employment and Workplace Relations Safety, Rehabilitation and... Date Added: 2009-06-03 20:49:20 |
| table.py.txt Path: East Los Angeles College >> MISC >> 117 Fall, 2009 Description: \"HTML table builders This module builds HTML tables from a list of lists. Each outer list is a row; each inner list the cells in the row. Actually, any iterable of iterables may be used. Here\'s the simplest usage: from table import Table ... Date Added: 2009-06-03 20:50:07 |
| tar200112001n338457.txt Path: Allan Hancock College >> TAR >> 200112001 Fall, 2009 Description: TELECOMMUNICATIONS AMENDMENT REGULATIONS 2001 (NO. 1) 2001 NO. 338 TELECOMMUNICATIONS AMENDMENT REGULATIONS 2001 (NO. 1) 2001 NO. 338 - TABLE OF PROVISIONS 1. Name of Regulations 2. Commencement 3. Amendment of Telecommunications Regulat... Date Added: 2009-06-03 20:50:56 |
| mhf3202-review1-spr05.doc Path: UNF >> MHF >> 3202 Fall, 2008 Description: MHF 3202 Review Sheet Exam 1 Feb. 3, 2005 When: Feb. 10, in class What: Sections 1.1-1.6 and 2.1, 2.2 Procedure: You will be the entire class period. You do not need to bring anything but something to write with. Closed book, closed notes. How to stu... Date Added: 2009-06-03 20:52:49 |
| sylltabl.doc Path: Delaware >> FLLT >> 250 Fall, 2009 Description: 9/2 9/4 ... Date Added: 2009-06-03 20:54:09 |
| 121extracredit.doc Path: Cal Poly Pomona >> PHY >> 121 Fall, 2009 Description: Extra Credit Quiz Phy121 Please try the following questions after you are done with your preparation for the final exam. Put you answers on a scan-tron (small one) and turn it in on the day of the final before we start. The grade you receive for this... Date Added: 2009-06-03 20:55:45 |
| hw13.doc Path: University of Iowa >> C >> 004131 Fall, 2009 Description: Physical Chemistry 1 Homework # 13 (28 points) Due Fri., Dec. 8 by 5PM 1. Atkins ex. 20.9a (3 points) 2. Atkins ex. 20.9b (3 points) 3. Atkins prob. 20.6 [hint (CD4)=12 and (CHD3)=3, and non-linear molecules like CD4 need partition functions that in... Date Added: 2009-06-03 20:56:27 |
| data.txt Path: Ill. Chicago >> IDS >> 472 Fall, 2008 Description: 7001 92700 28500 64200 7002 95486 26766 68720 7003 113613 32198 81415 7004 101162 35492 65670 7005 100932 34412 66520 7006 137573 38003 99570 7007 183875 42670 141205 7008 215827 47312 168515 7009 131143 ... Date Added: 2009-06-03 20:56:38 |
| objsrepls.doc Path: Cal Poly Pomona >> PHL >> 202 Fall, 2009 Description: Some Reminders About Objections and Replies 1. Do not consider objections that are easy to reply to but trivial in nature. 2. One can object to a thesis in two ways: a. object to the argument(s) for a thesis e.g., Argument: We should put prayer back... Date Added: 2009-06-03 20:59:15 |
| 20220240100630_20050304_1675.txt Path: East Los Angeles College >> MODULE >> 2022024010 Fall, 2009 Description: # %NewTest # SERIAL NUMBER : 20220240100630 TEST MADE BY : muh LOCATION NAME : Manchester Run number : 1675 TEST_DATE : 04/03/2005 PASSED : YES PROBLEM : NO # %DAQ_INFO # #HOST \"MODTEST\" #VERSION \"3.42\" #DUT \"Endcap_Inner\"... Date Added: 2009-06-03 21:00:16 |
| 20220240100630_20050304_1675.txt Path: East Los Angeles College >> MAN >> 2022024010 Fall, 2009 Description: # %NewTest # SERIAL NUMBER : 20220240100630 TEST MADE BY : muh LOCATION NAME : Manchester Run number : 1675 TEST_DATE : 04/03/2005 PASSED : YES PROBLEM : NO # %DAQ_INFO # #HOST \"MODTEST\" #VERSION \"3.42\" #DUT \"Endcap_Inner\"... Date Added: 2009-06-03 21:00:16 |
| PY101.sylabus.doc Path: SEMO >> PY >> 101 Fall, 2009 Description: COURSE: PY101.06 Psychological Perspectives on Human Behavior (Spring 2008) Section 06 (TTh; 11:00-12:15; Scully 412) Email header => \"PY101.06 Spring 2008 YOURNAME\" INSTRUCTOR: OFFICE HOURS: PY101 HOMEPAGE: ATTENDANCE: William E. Snell, Jr., Ph... Date Added: 2009-06-03 21:00:28 |
| MGMT3102-Fall2008-Syllabus.doc Path: Clayton >> MGMT >> 3102 Fall, 2009 Description: MGMT 3102 Performance/Quality Management SYLLABUS Fall, 2008 This syllabus should be used by students taking MGMT 3102 during the Fall semester, 2008 Important Notes Applicable to the Fall 2008 Semester (1) A comprehensive final will be given during ... Date Added: 2009-06-03 21:00:46 |
| 06_Mapping.ppt Path: UAB >> MIC >> 753 Fall, 2009 Description: Mapping Nucleic Acids and Proteins Mapping Restriction Mapping Open Reading Frames Peptide Mapping T1 Ribonuclease maps FingerPrint PlasmidMap Plasmid Maps Restriction Maps Map MapSort MapPlot Peptide Maps PeptideMap PeptideSort ... Date Added: 2009-06-03 21:01:07 |
| ifac2005(wms).txt Path: East Los Angeles College >> EH >> 3081 Fall, 2009 Description: The the problem of minimizing the transient energy of a linear system following a unit energy initial disturbance is considered in this paper. This paper extends previous results on the state feedback case to the output feedback case. Furthermore, it... Date Added: 2009-06-03 21:01:48 |
| 01-Intro.ppt Path: Virginia Tech >> CS >> 2104 Fall, 2007 Description: Introduction to Problem Solving Spring 2009 Alexey Onufriev Departments of Computer Science and Physics Virginia Tech Copyright 2007-2009 Goals of This Course Make you a better problem solver in general Understand how you operate Recognize limi... Date Added: 2009-06-03 21:02:05 |
| germany8.ppt Path: East Los Angeles College >> HI >> 136 Fall, 2009 Description: History of Germany, Week 8 Teutonic Cultural Pessimism Elias\'s Kultur/Zivilisation antithesis Civilisation French Artificial Aristocratic Courtesy Anglo-Saxon Mass Society Political Superficiality Culture German Natural Middle-cl... Date Added: 2009-06-03 21:02:08 |
| RBG_App_2005-07-1.doc Path: Berkeley >> ATT >> 0142 Fall, 2009 Description: CALL FOR PROPOSALS RESEARCH BRIDGING GRANT APPLICATION 2005-2007 Applications must be submitted to your department office. Deadline for applications: THURSDAY, MARCH 17, 2005 5:00 P.M. PLEASE NOTE: Proposals may be submitted under a cooperative progr... Date Added: 2009-06-03 21:02:24 |
| Exercise01.doc Path: East Los Angeles College >> ECON >> 3012 Fall, 2009 Description: ECON3012 Methods of Econometrics Exercise 1 1. Given the standard multiple regression model Y = X + u where Y is n.1, X is n.k and u is n.1, ^ Write down the least squares estimator of . ^ b) Explain the meaning of the statement that is BLUE. c) St... Date Added: 2009-06-03 21:02:49 |
| finalreview.doc Path: Naval Academy >> FE >> 431 Fall, 2009 Description: Public Finance Review Sheet for Final Exam Review sheet for Exam 1 (posted on the web) Review sheet for Exam 2 (posted on the web) Chapter 20 Deficits and the National Debt Reading: pp. 462 - 476 Key topics and terms: Budget deficit versus s... Date Added: 2009-06-03 21:04:22 |
| Accountabilty.ppt Path: East Los Angeles College >> GM >> 6213 Fall, 2009 Description: Professional and Ethical Practice Accountability Accountability Effective selfregulation is reliant on us exercising our personal professional accountability at all times in the interest of our patients and clients. Being able to demons... Date Added: 2009-06-03 21:05:25 |
| QuizQuestion3.txt Path: Maryland >> ENEE >> 114 Fall, 2008 Description: 3.Write a function rms which will read integer array values from the specified input file and store the numbers into an int array. The first number in the file will give the number of elements in the array. The function should return a float, which... Date Added: 2009-06-03 21:05:49 |
| SARSlog2.txt Path: Virginia Tech >> CS >> 1704 Spring, 2003 Description: Programmer: D Barnette Simple Automobile Records System Log - # COMMAND ARG ACTIVITY COMMENT 001 del JBMWD4449R1261090: SUCCESS 002 del 46C2D8C19Q1255242: SUCCESS 003 del S4MD4C629X0379203: SUCCESS 004 ... Date Added: 2009-06-03 21:06:55 |
| gy130_05-06.doc Path: East Los Angeles College >> GY >> 130 Fall, 2009 Description: GY130 Global Environmental Issues s School of the Environment Semester 1 Examinations 2005-2006 GY130 GLOBAL ENVIRONMENTAL ISSUES Instructions to Candidates: Time allowed: TWO hours Answer any THREE questions All questions carry equal marks Date... Date Added: 2009-06-03 21:07:59 |
| 20220040200153_RC_306_31.txt Path: East Los Angeles College >> PHYSICS >> 2022004020 Fall, 2009 Description: #chan code gain offset innse comment 0 0 57.8 33.1 1535 OK 1 0 56.5 33.5 1495 OK 2 0 56.3 37.5 1571 OK 3 0 55.8 35.3 1500 OK 4 0 55.9 37.9 1499 OK 5 0 56.3 35.7 1584 OK 6 0 55.7 36.9 1582 OK 7 0 56.5 35... Date Added: 2009-06-03 21:08:13 |
| ecc3_a_e_hist536.txt Path: East Los Angeles College >> E >> 452 Fall, 2009 Description: TH1.Print Name = ECC3_A_E, Entries= 45, Total sum= 45 fSumw[0]=0, x=-0.5 fSumw[1]=0, x=0.5 fSumw[2]=0, x=1.5 fSumw[3]=0, x=2.5 fSumw[4]=0, x=3.5 fSumw[5]=0, x=4.5 fSumw[6]=0, x=5.5 fSumw[7]=0, x=6.5 fSumw[8]=0, x=7.5 fSumw[9]=0, x=8.5 fSu... Date Added: 2009-06-03 21:08:53 |
| 20220330200572_RC_435_12.txt Path: East Los Angeles College >> PHYSICS >> 2022033020 Fall, 2009 Description: #chan code gain offset innse comment 0 0 60.0 11.5 1464 OK 1 0 60.9 -4.7 1451 OK 2 0 59.9 13.0 1484 OK 3 0 61.1 8.0 1448 OK 4 0 57.8 10.3 1457 OK 5 0 62.9 17.5 1436 OK 6 0 58.8 18.3 1514 OK 7 0 60.4 6.6... Date Added: 2009-06-03 21:09:11 |
| mt2_exams_scores.txt Path: Washington >> STAT >> 395 Fall, 2008 Description: 28 students took the exam 4 students scored 13 to 15 5 students scored 16 to 19 5 students scored 22 or 23 5 students scored 25 to 28 8 students scored 29 to 32 1 student scored 36 Scores will be scaled ... Date Added: 2009-06-03 21:11:08 |
| CASB_Application.doc Path: CSU Northridge >> MG >> 640721 Fall, 2009 Description: COUNCIL ON SOCIAL WORK EDUCATION 1725 Duke Street, Suite 500 Alexandria, VA 22314-3457 ANNOUNCEMENT CARL A. SCOTT BOOK SCHOLARSHIPS We are pleased to announce that the Council on Social Work Education (CSWE) will award two Carl A. Scott Book Schola... Date Added: 2009-06-03 21:12:40 |
| yakou.doc Path: Allan Hancock College >> ARCL >> 3901 Fall, 2009 Description: NINVA YAKOU 0015921 ADOPTION OR APPROPRIATION? THE AMAZON MYTHS IN SOUTH ITALY INTRODUCTION To the Greeks, the Amazons epitomized anarchy, barbarism and chaos. These myths migrated to South Italy with the Greeks and found their way onto the red-figu... Date Added: 2009-06-03 21:12:46 |
| WVUSyllabusPS368Fall2008.doc Path: WVU >> PS >> 368 Fall, 2009 Description: PS368 War, Peace, and Change in International Politics Tuesday, Thursday 11:30AM to 12:45PM (Woodburn G10) West Virginia University David Hauser Office: 301D, Woodburn Hall Office Phone: 293-3811, extension 5289 (Do NOT leave voicemail I will never ... Date Added: 2009-06-03 21:16:23 |
| monitors.txt Path: Duke >> CPS >> 110 Fall, 2009 Description: CPS 110 F08 Practice Problems for Discussions the Week of 9/8/08 Problem 1) You have been hired by an airline company and asked to design a Monitor solution to handle seat reservations on a flight. The flight has MAX seats, initially all a... Date Added: 2009-06-03 21:18:51 |
| healthy_start_memo.doc Path: Duke >> PS >> 145 Fall, 2009 Description: TO: FROM: MR. GLOWACKI, NEW HEALTHY START ACADEMY HEADMASTER INDEPENDENT CHARTER SCHOOL COUNCIL* HEALTHY START CHARTER SCHOOL 5/16/2009 SUBJECT: DATE: _ Healthy Start began as a vision of several concerned parents in a poor neighborhood in Durham.... Date Added: 2009-06-03 21:20:01 |
| pima_test.txt Path: Duke >> STA >> 216 Fall, 2008 Description: id npreg glu bp skin bmi ped age type 1 6 148 72 35 33.6 0.627 50 Yes 2 1 85 66 29 26.6 0.351 31 No 3 1 89 66 23 28.1 0.167 21 No 4 3 78 50 32 31.0 0.248 26 Yes 5 2 197 70 45 30.5 0.158 ... Date Added: 2009-06-03 21:20:24 |
| Manning.82.txt Path: Wisconsin >> ICE >> 1982 Fall, 2009 Description: 8905 - Manning Location: 78 degrees 46 minutes S, 161 degrees 04 minutes E. 11 nm south of Minna Bluff on the Ross Ice Shelf at an elevation 60 meters. Hex id: 8B25B Power: 6 VDC supplied by RTG Aerovane: Old was 00-00-01. Wind directi... Date Added: 2009-06-03 21:20:27 |
| Manning.82.txt Path: Wisconsin >> PUB >> 1982 Fall, 2009 Description: 8905 - Manning Location: 78 degrees 46 minutes S, 161 degrees 04 minutes E. 11 nm south of Minna Bluff on the Ross Ice Shelf at an elevation 60 meters. Hex id: 8B25B Power: 6 VDC supplied by RTG Aerovane: Old was 00-00-01. Wind directi... Date Added: 2009-06-03 21:20:27 |
| SampleMidterm.doc Path: UCSB >> PSYCH >> 117 Fall, 2009 Description: Fall 07 Psychology 117: Sample Exam Questions 1. If you are given a sequence of letters to remember such as PHDBMWIBMCIA this will exceed the capacity of short-term memory. However, if you group the letters so that they read PHD, BMW, IBM, CIA you wi... Date Added: 2009-06-03 21:20:55 |
| Ch03BNFSemanticsHandout.ppt Path: UCSB >> CS >> 162 Fall, 2009 Description: Variable Attributes: Scope The scope of a variable is the range of statements over which it is visible The nonlocal variables of a program unit are those that are visible but not declared there The scope rules of a language determine how refere... Date Added: 2009-06-03 21:21:31 |
| Homework1.doc Path: UC Riverside >> CS >> 120 Fall, 2009 Description: Homework 1 UCR EE/CS120B: Introduction to Embedded Systems Fall Quarter 2004, Lecturer Brian Grattan Due Tuesday, Oct. 5 at the BEGINNING of lecture. Name:_ UCR ID#:_ For this assignment, you will hand in a hardcopy on Tuesday, October 5. But, si... Date Added: 2009-06-03 21:22:24 |
| TPC_IOC_S06b_T13_v0.9.doc Path: USC >> CSCI >> 577 Fall, 2009 Description: Test Plan and Cases (TPC) Web Based XML editor Team 13 Member John Lo Nagesh Arkalgud Sudhanshu Bhushan Dawei, Jia Arpitha Hegde Quan Pham Tanvi Khare Role Project Manager/Iteration Planner System Architect/Transition Planner Requirement Analyst/... Date Added: 2009-06-03 21:23:21 |
| Biochem_Nucleic_Acids.ppt Path: Texas Tech >> NS >> 3402 Fall, 2008 Description: Fig. 17.14 www.whitehistory.com/ychromo_files/ychromo.gif ... Date Added: 2009-06-03 21:25:23 |
| Membership.ppt Path: Old Dominion >> CS >> 775 Fall, 2008 Description: Reliable Distributed Systems Membership Agreement on Membership Recall our approach: Detecting failure is a lost cause. Substitute agreement on membership Too many things can mimic failure To be accurate would end up waiting for ... Date Added: 2009-06-03 21:31:28 |
| s5c1.ppt Path: Youngstown >> CSIS >> 4884 Fall, 2009 Description: Cabrillo College CCNP Semester 5 Building Scalable Cisco Networks Rick Graziani, Instructor with Mark McGregor version 1 1 Scalable Networks s s Scalability: The ability to grow and adapt without major redesign or reinstallation More often than n... Date Added: 2009-06-03 21:32:10 |
| Enron.doc Path: CSU Bakersfield >> SOC >> 120 Fall, 2008 Description: 1Tuesday, February 05, 2002 2By Bill O\'Reilly 3 4The Talking Points memo this evening is about the growing Enron scandal. Even if you don\'t 5care about the stock market or economics, you should pay attention to this story, because this 6goes to the h... Date Added: 2009-06-03 21:33:06 |
| runtimeEfficiency.ppt Path: UMBC >> CMSC >> 202 Spring, 1999 Description: Runtime Efficiency and Asymptotic Analysis CMSC 202 1 Efficiency (Complexity) The rate at which storage or time grows as a function of the problem size. Two types of efficiency: Time efficiency Space efficiency There are always tradeoffs betw... Date Added: 2009-06-03 21:34:31 |
| Exercise_12_Self_Monitoring.doc Path: Colorado >> PSYC >> 4521 Fall, 2008 Description: Spring 2009 Due: Mon. 3/9/2009 [Type your name here ] [Type the date here] EXERCISE 12: SELF MONITORING: OBSERVING AND RECORDING BEHAVIOR: The first step in modifying your own behavior using cognitive-behavioral techniques is to specific the behav... Date Added: 2009-06-03 21:34:32 |
| chapt9.ppt Path: Delaware >> CRJU >> 110 Spring, 2008 Description: Pretrial Procedures: The Adversary System in Action Chapter 9 Introduction to Criminal Justice 2003: A Microsoft PowerPoint Tool Slides prepared by: Larry Bassi SUNY Brockport 2002 Wadsworth Publishing Co. Abstract Goals of the Courts Provide for... Date Added: 2009-06-03 21:35:59 |
| geog5110basicthesis.doc Path: North Texas >> GEOG >> 5110 Fall, 2008 Description: UNIVERSITY OF NORTH TEXAS Department of Geography GEOG 5110 Research Design and Geographic Applications Dr. Murray Rice Basic Principles for Thesis Research Writing Start writing sooner rather than later it is good to hammer out a first draft, eve... Date Added: 2009-06-03 21:36:52 |
| ThesisTitlePage.doc Path: Wake Forest >> ETD >> 12162003 Fall, 2009 Description: PHYLOGENY AND BIOGEOGRAPHY OF ERICA By AVERY F. MCGUIRE A thesis submitted to the Graduate Faculty of WAKE FOREST UNIVERSITY In Partial Fulfillment of the Requirements For the degree of MASTER OF SCIENCE In the Department of Biology December 2003 Win... Date Added: 2009-06-03 21:38:25 |
| WBB_22_log.txt Path: Michigan State University >> D >> 2105 Fall, 2009 Description: Warning: parameter fixed_couplings not found setting it to default value T A PDF is used, so alpha_s(MZ) is going to be modified Old value of alpha_s from param_card: 0.118 New value of alpha_s from PDF cteq6l1: 0.13 Warning: cut... Date Added: 2009-06-03 21:39:23 |
| lec23.doc Path: N.C. State >> ENGR >> 517 Fall, 2009 Description: Converting Data to and from XML [1] Water Import Most data in the world is not in XML format. Water Import can convert many data sources into XML objects. Each type of data format has a conversion method that takes a string and returns an XML object,... Date Added: 2009-06-03 21:40:30 |
| fitted-par_f11_c0.txt Path: Stanford >> CPT >> 080619 Fall, 2009 Description: 0 8152 13 11 3.231308e-05 759 0.0000e+00 6.6323e-05 -7.2975e-05 0.0000e+00 -3.6177e-04 1.0134e-04 0.0000e+00 1.2538e-04 -2.1442e-04 0.0000e+00 0.0000e+00 1.4991e-05 0.0000e+00 0.0000e+00 0.0000e+00 0.0000e+00... Date Added: 2009-06-03 21:41:43 |
| CatFlynn_ArticleReview.doc Path: Los Angeles Southwest College >> EDET >> 735 Fall, 2009 Description: Article Review: Investigation of Direct Intervention in Children with ADHD by Catherine Flynn Technology for Diverse Populations EDET 735 Dr. Cheryl Wissick February 26, 2007 Flynn - Attention Training With Pay Attention! Article Kerns, K. A., Es... Date Added: 2009-06-03 21:46:28 |
| 280-2001-R03.doc Path: Portland >> ARCH >> 280 Fall, 2008 Description: Department of Architecture Arch 280: Design Fun.; \"Leaping into the 3rd Dimension\" Winter 2001 Portland State University G. Martin, J. Siemens, F. Zal Research Project 3: History & Theory Issued: 19 February 2001 (Monday) Due: 16 March 2001 (Friday... Date Added: 2009-06-03 21:46:47 |
| NWMan.ppt Path: Dallas >> EE >> 4367 Fall, 2008 Description: Networ k M anagement All material copyright 1996-2002 J.F Kurose and K.W. Ross, All Rights Reserved 1 What i s networ k management? autonomous systems (aka \"networ k\"): 100s or 1000s of i nter acti ng har dwar e/ softwar e components other comp... Date Added: 2009-06-03 21:47:00 |
| datadictviews.doc Path: CSU Fullerton >> DBS >> 301 Fall, 2009 Description: Some Useful ORACLE Data Dictionary Views View Name USER_TABLES USER_OBJECTS Data All tables in your schema All objects in your schema (tables, views, indexes, .) USER_TAB_COLUMNS All columns in all tables in your schema Significant Columns TABLE_NAME... Date Added: 2009-06-03 21:47:33 |
| Syllabus.Chem1505R.Summer2002.140.doc Path: Youngstown >> CHEM >> 1505 Fall, 2008 Description: 1 Chemistry 1505R, Allied Health Chemistry I, Recitation: Syllabus, Summer 2002 Lecturer: Dr. Allen Hunter (Office 5015, NMR Lab 5031, X-Ray Lab 5024/5020, Research Lab 5005A) Phone: 742-7176 (Office) E-mail: adhunter@cc.ysu.edu Home Page: http:/www... Date Added: 2009-06-03 21:50:51 |
| Module1.ppt Path: Allan Hancock College >> INFS >> 1200 Fall, 2009 Description: The Database Concept Database Management System Typical Functions of DBMS Module 1 Database Systems INFS1200 / INFS7900 Information Systems Data and Knowledge Engineering Group School of Information Technology and Electrical Engineering INFS1200/IN... Date Added: 2009-06-03 21:53:59 |
| table_instructions.doc Path: U. Houston >> CUIN >> 3113 Fall, 2008 Description: Instructions on How to Use Tables on Microsoft Word click on Start 2. click on Microsoft Word 3. click on Table (on top of the page between Tools and Windows) 4. click on Insert 5. click on Table 6. For Number of Columns you will input 2 7. For Numbe... Date Added: 2009-06-03 21:54:14 |
| recitation9.ppt Path: Pittsburgh >> CS >> 1520 Fall, 2007 Description: Recitation 9 Assignment 3 Message Board Yinglin Sun 03/20/2009 Database tables User table UserId, password, email, type (pending, regular, moderator), posting privilege. Id, subject MsgID, thread ID, UsrID, message body, status (pending, ... Date Added: 2009-06-03 21:55:18 |
| lab11.ppt Path: UPenn >> CIS >> 110 Fall, 2009 Description: CIS110203 Intro to Computer Science Lab #11 TA: Catherine Stocker Mentor: Jay Fiddelman University of Pennsylvania 15 November 2007 Today\'s Agenda Review Review Question Lab Work Space Invaders Monitors. Turn `em off Genera... Date Added: 2009-06-03 21:55:23 |
| The World Trade Organization Final.ppt Path: Middlebury >> ECON >> 0340 Fall, 2008 Description: World Trade Organization \"The World Trade Organization (WTO) is the only international organization dealing with the global rules of trade between nations. Its main function is to ensure that trade flows as smoothly, predictable and freely as possibl... Date Added: 2009-06-03 21:55:57 |
| cachecalc.xls Path: Georgia Tech >> CS >> 2200 Fall, 2008 Description: Cache Inputs: Address 32 bits Read/Write Outputs: Cache Hit/Miss/Writeback? Block SIze Associativity No of Sets Index Bits Cache Size Choices 16 Bytes/Block 16, 32, 64, 256 1 Blocks/Set 1, 2, 4, 8 64 (Calculated see below) 6 (Calculated see belo... Date Added: 2009-06-03 21:56:18 |
| CH_8_more_practice.doc Path: Texas A&M University, Corpus Christi >> ORMS >> 3310 Fall, 2008 Description: ORMS 3310 1. CHAPTER 8 More Practice Problems NAME: _ The movie Harry Potter and the Sorcerer\'s Stone shattered the box office debut record. A sample of 29 movie theaters showed that the mean three-day weekend gross was $25,467 per theater. The s... Date Added: 2009-06-03 21:56:28 |
| 060101construct.txt Path: Chester >> ECO >> 343 Fall, 2008 Description: Business Report - Construction boom gives Irish economy a boostConstruction boom gives Irish economy a boost Dublin - Ireland\'s economy is maintaining a Europe-leading pace of growth thanks in part to strong consumer spending an... Date Added: 2009-06-03 21:56:53 |
| yield_cost_090105.xls Path: Berkeley >> EE >> 290 Spring, 2004 Description: Year 1997 1999 2001 2003 2006 2009 2012 D (killer defects/cm2 for 0.25um rules) 0.0006000 0.0005000 0.0001400 0.0000500 0.0000020 0.0000020 0.0000002 CD 0.250 0.180 0.150 0.130 0.065 0.045 0.020 Die Area 300.000 340.000 385.000 430.000 520.000 620... Date Added: 2009-06-03 21:57:33 |
| quiz4-soln.doc Path: Berkeley >> CS >> 150 Fall, 1996 Description: University of California at Berkeley College of Engineering Department of Electrical Engineering and Computer Sciences EECS150 Spring 2000 Quiz #4 Solution We implement a leftward bit rotator using tri-states. Given a 4-bit input {x3 x2 x1 x0} and a... Date Added: 2009-06-03 21:58:43 |
| SemanticWeb.ppt Path: SUNY Albany >> INF >> 703 Fall, 2009 Description: Semantic Web Lecture Notes Prepared by Jagdish S. Gangolly Ph.D Program in Information Science State University of New York at Albany 05/16/09 Inf 703, Fall 2003 (Gangolly) 1 Semantic Web .is a mesh of information linked up in such a way as t... Date Added: 2009-06-03 21:59:12 |
| 01- Agenda1.ppt Path: Idaho >> ENGR >> 404 Fall, 2008 Description: University of Idaho Engr 404 Introduction to Space Systems & Satellite Design Tuesday, September 2, 2008 Agenda 10 Minute Quiz ... Date Added: 2009-06-03 22:03:39 |
| 232hw1.doc Path: Washington University in St. Louis >> ESE >> 232 Fall, 2009 Description: ESE 232 Homework Assignment 1 Chapter 1 of Text Assigned Date: January 14, 2009 Due Date: January 21, 2009 Problem 1.23 Problem 1.26 Problem 1.39 Problem 1.40 Problem 1.45 Problem 1.48 Problem 1.50 Problem 1.56 ... Date Added: 2009-06-03 22:03:40 |
| Chap13.ppt Path: Oregon State >> CS >> 162 Fall, 2008 Description: CS 162 - Spring 2004 Chapter 13 Arrays and Array Lists Array Data structure (encapsulated data & operations) Data elements of specific type (primitive, Object reference) Access method is indexing Fixed length Get array length as data.length. (N... Date Added: 2009-06-03 22:05:58 |
| monsanto.doc Path: Iowa State >> MR >> 0818 Fall, 2009 Description: New York Times 08-16-06 Monsanto Buys Delta and Pine Land, Top Supplier of Cotton Seeds in U.S. By ANDREW POLLACK Monsanto will acquire the Delta and Pine Land Company, the nation\'s leading supplier of cotton seeds, in a move that would add to Monsan... Date Added: 2009-06-03 22:09:16 |
| ippost.ps Path: Sveriges lantbruksuniversitet >> CS >> 471 Fall, 2009 Description: %!PS-Adobe-2.0 %Creator: dvips(k) 5.96 Copyright 2005 Radical Eye Software %Title: ippost.dvi %CreationDate: Mon May 26 11:10:38 2008 %Pages: 8 %PageOrder: Ascend %BoundingBox: 0 0 612 792 %DocumentFonts: Bookman-Light Bookman-Demi ZapfDingbats %+ Bo... Date Added: 2009-06-03 22:11:57 |
| 05.10.03.DescribingDistributions.ppt Path: UH Clear Lake >> PSYC >> 6036 Fall, 2008 Description: Summarizing Distributions & Measurement Administrative Summarizing Distributions Review Homework Measurement Concepts Administrative Test next week Should take about 1 - 1 1/2 hours Introduction due 10/24/05 Most HW and Article reviews grad... Date Added: 2009-06-03 22:12:05 |
| 08-MIPSAddressingModes.1p.ps Path: UCSC >> CMPE >> 110 Winter, 2008 Description: %!PS-Adobe-2.0 %Creator: dvips(k) 5.86 Copyright 1999 Radical Eye Software %Title: 08-MIPSAddressingModes.dvi %Pages: 24 %PageOrder: Ascend %BoundingBox: 0 0 612 792 %EndComments %DVIPSWebPage: (www.radicaleye.com) %DVIPSCommandLine: dvips -o 08-MIPS... Date Added: 2009-06-03 22:12:46 |
| soln3.ps Path: Caltech >> AY >> 123 Fall, 2008 Description: %!PS-Adobe-2.0 %Creator: dvips(k) 5.78 Copyright 1998 Radical Eye Software (www.radicaleye.com) %Title: soln3.dvi %Pages: 10 %PageOrder: Ascend %BoundingBox: 0 0 612 792 %DocumentFonts: cmbx12 cmr12 cmex10 cmmi12 cmmi8 cmr8 cmsy8 cmsy10 %+ cmti12 cmr... Date Added: 2009-06-03 22:13:43 |
| logit-output.doc Path: Duke >> STA >> 121 Fall, 2008 Description: OUTPUT FROM SPLUS LOGISTIC REGRESSION * Generalized Linear Model * Call: glm(formula = SURV ~ CAGE + LLIGHT, family = binomial(link = logit), data = seeds, na.action = na.omit, control = list(epsilon = 0.001, maxit = 50, trace = F) Deviance Residuals... Date Added: 2009-06-03 22:16:01 |
| cps151Prog9.doc Path: University of Dayton >> CPS >> 151 Fall, 2009 Description: CPS151, Winter 2009 Submission: Program #9 due Wednesday, 4/15/09 (25 points max) Translation and Execution last accepted Friday, 4/17/09 (21 points max) Program Translation Computer programs are written by human programmers using a specific compu... Date Added: 2009-06-03 22:16:31 |
| MenuCostGraphs.doc Path: Cal Poly Pomona >> ECON >> 161 Fall, 2009 Description: Economics 161 2009 A. Main idea: P Mankiw\'s Menu Cost Model of Price Stickiness Spring MC P1 = P0 P1* C B A Lost profit (small) MR MR\' Q1Q1*Q0 D D\' Q Point A: profit-maximizing price and quantity initially. Point B: profit-maximizing price and... Date Added: 2009-06-03 22:19:09 |
| rfc3189.txt Path: Dallas >> EE >> 6345 Fall, 2008 Description: Network Working Group K. Kobayashi Request for Comments: 3189 Communication Research Laboratory Category: Standards Track A. Ogawa ... Date Added: 2009-06-03 22:20:42 |
| class08.ppt Path: North-West Uni. >> CS >> 213 Fall, 2008 Description: EECS213 Machine-Level Programming IV: Structured Data Apr. 23, 2008 Topics Arrays Structures Unions Basic Data Types Integral Stored & operated on in general registers Intel GAS byte b word w double word [unsigned] int Floating Point Bytes ... Date Added: 2009-06-03 22:21:45 |
| ch04-routing1.ppt Path: Colorado State >> CS >> 457 Fall, 2008 Description: CS 457 Link-State and Distance Vector Routing Fall 2008 Routing vs. Forwarding routing algorithm local forwarding table header value output link 0100 0101 0111 1001 3 2 2 1 value in arriving packet\'s header 0111 1 3 2 Network Graph Abstraction 5... Date Added: 2009-06-03 22:24:03 |
| AnsDiffPrac.doc Path: Arizona >> MATH >> 124 Fall, 2008 Description: Faith Bridges bridges@math.arizona.edu ANSWERS TO MORE PRACTICE 1. (t 3 +1 ) (1 - 0.5t ) -0.5 3 t3 +1 14. 2 3 + tan 2 (4 ) ( 3 + 2 tan(4 ) ) 2 cos (4 ) -0.5 ( ) 2. - x -2 - 3x -4 ( x + 1) (5 - x) (11 - 7 x) 2 3 15. 1 cos x 1 / 3 + 1 -... Date Added: 2009-06-03 22:24:12 |
| svmcode-jfp.txt Path: Toledo >> STA >> 414 Fall, 2009 Description: library(e1071) library(rgl) boundaries=function(y,b,n=100){ # y is the data, b the svm object grid=expand.grid(seq(min(y[,1]),max(y[,1]),length=n),seq(min(y[,2]),max(y[,2]),length=n) points(grid,pch=4,cex=.15,col=paste(as.character(predict(b,grid) }... Date Added: 2009-06-03 22:24:33 |
| IESLecture20 - Memory Expansion.ppt Path: UNC Charlotte >> ECGR >> 4101 Spring, 2008 Description: vti_encoding:SR|utf8-nl vti_timelastmodified:TR|17 Nov 2004 14:04:51 -0000 vti_extenderversion:SR|6.0.2.6353 vti_author:SR|MOSAIC\\jmconrad vti_modifiedby:SR|MOSAIC\\jmconrad vti_timecreated:TR|17 Nov 2004 14:04:51 -0000 vti_cacheddtm:TX|17 Nov 2004 14... Date Added: 2009-06-03 22:25:31 |
| Lab13_Debate.docx Path: Idaho >> FCS >> 365 Fall, 2008 Description: Lab 13: Nutrition Controversy/Debate Points Earned:_ Name:_ Date of Lab:_ Date of Submission:_ Points Possible: 30 Objectives: 1. To investigate the recommended levels of selected nutrients and /or current nutrient controversy. 2. 3. To debate ei... Date Added: 2009-06-03 22:27:28 |
| Hill and Jones Chapter 7 Slides.ppt Path: Wells >> MGMT >> 201 Fall, 2009 Description: Chapter Seven Strategy and Technology Technical Standards and Format Wars Technical standards are a set of technical specifications that producers adhere to when making the product or a component of it. Format wars Often, only one standard will co... Date Added: 2009-06-03 22:27:47 |
| powers2.txt Path: UMBC >> CS >> 201 Fall, 2000 Description: retriever% cc201 powers2.c retriever% retriever% a.out This program prints out the powers of 2. How many entries? 7 2 raised to 0 = 1 2 raised to 1 = 2 2 raised to 2 = 4 2 raised to 3 = 8 2 raised to 4 = 16 2 raised to 5 = 32 2 raised to 6 = 64 2 r... Date Added: 2009-06-03 22:29:03 |
| runtimeEfficiency.ppt Path: UMBC >> CS >> 202 Fall, 1997 Description: Runtime Efficiency and Asymptotic Analysis CMSC 202 1 Efficiency (Complexity) The rate at which storage or time grows as a function of the problem size. Two types of efficiency: Time efficiency Space efficiency There are always tradeoffs betw... Date Added: 2009-06-03 22:29:08 |
| L03-AlgorithmsI.ppt Path: UMBC >> MGASTO >> 203 Fall, 2009 Description: CMSC 203, Section 0401 Discrete Structures Fall 2004 Matt Gaston mgasto1@cs.umbc.edu http:/www.csee.umbc.edu/~mgasto1/203 UMBC CMSC 203, Section 0401 - Fall 2004 Algorithms Ch. 2.1-2.3 UMBC CMSC 203, Section 0401 - Fall 2004 Definition Book defi... Date Added: 2009-06-03 22:29:59 |
| nmos018.txt Path: UCSB >> ECE >> 594 Fall, 2009 Description: * DATE: Jan 21/05 * LOT: T4BK WAF: 3004 * Temperature_parameters=Default .MODEL CMOSN NMOS ( LEVEL = 49 +VERSION = 3.1 TNOM = 27 TOX = 4E-9 +XJ = 1E-7 NCH = 2.3549E17 ... Date Added: 2009-06-03 22:33:57 |
| ShowalterPLANS.rtf Path: Maryville MO >> SESFH >> 7377 Fall, 2009 Description: Sarah Showalter TILP Technology Integration Learning Plan: Andy Warhol, Pop Art with Photoshop 1 Learning Activity: In this learning activity, the students will use Adobe Photoshop to create a repeating series of pictures/prints in different colors... Date Added: 2009-06-03 22:35:03 |
| ps_6.doc Path: Stevens >> PS >> 344 Fall, 2009 Description: Problem Set 6 Due: Tuesday, 31 October, 2006 at beginning of lecture * On the solution set you submit, please: 1. staple multiple pages together; and 2. legibly (e.g. print) write your name and 4-digit ID number. Papers without this information will ... Date Added: 2009-06-03 22:36:52 |
| Problem core 5.08.doc Path: Stevens >> E >> 344 Fall, 2009 Description: The average molecular weight of a solid 1 gram sample of polyethylene is 400,000 g/mole. Calculate the average degree of polymerization. Estimate the length of the average molecule in this sample. In the solid, with (roughly) what probability do you ... Date Added: 2009-06-03 22:39:50 |
| MAMMALS Didelphimorphia to Rodentia.ppt Path: UCSB >> EEMB >> 113 Fall, 2008 Description: EEMB 113L MAMMAL TAXA 1 Department of Ecology, Evolution, and Marine Biology University of California, Santa Barbara 1 CLASS: MAMMALIA Order Didelphimorphia Order Insectivora Order Chiroptera Order Lagomorpha Order Rodentia Suborder(s): Sciurognath... Date Added: 2009-06-03 22:43:44 |
| Assignment0.doc Path: CSU LA >> CS >> 120 Fall, 2009 Description: Assignment 0 Due 1-11-2005 by 11:59:59p.m. 0% of course grade E-mail me (jmiller6@calstatela.edu) the following information: Name Class (CS120) At least one interesting piece of information about yourself. (i.e. What do you do in your spare time? Why... Date Added: 2009-06-03 22:45:54 |
| Assignment2.doc Path: CSU LA >> CS >> 120 Fall, 2009 Description: Assignment 2 Due 7-11-2007 during lab time 5% of course grade This assignment will build on the last assignment of creating your personal web site. For this assignment, you will add 4 more pages to your web site one page that lists all of the classe... Date Added: 2009-06-03 22:46:12 |
| foo1.jsp.txt Path: CSU LA >> CS >> 320 Fall, 2009 Description: <%@ page language =\"java\"%> <%@ include file=\"header.html\"%> <html> <body> <%! int count = 0;%> <%count+;%> <h3>You are the <%= count %>th visitor</h3> </body> </html> ... Date Added: 2009-06-03 22:47:08 |
| semslides.ps Path: SUNY Albany >> CSI >> 310 Fall, 2009 Description: %!PS-Adobe-2.0 %Creator: dvipsk 5.86 p1.5d Copyright 1996-2001 ASCII Corp.(www-ptex@ascii.co.jp) %based on dvipsk 5.86 Copyright 1999 Radical Eye Software (www.radicaleye.com) %Title: semslides.dvi %Pages: 29 %PageOrder: Ascend %Orientation: Landscap... Date Added: 2009-06-03 22:49:11 |
| 05tsp.ps Path: Princeton >> CS >> 126 Fall, 2008 Description: %!PS-Adobe-2.0 %Creator: dvips 5.55 Copyright 1986, 1994 Radical Eye Software %Title: 05tsp_pa.dvi %CreationDate: Tue Mar 12 16:52:59 1996 %Pages: 3 %PageOrder: Ascend %BoundingBox: 0 0 612 792 %EndComments %DVIPSCommandLine: rdvips 05tsp_pa.dvi %DVI... Date Added: 2009-06-03 22:50:37 |
| 0403.ps Path: Princeton >> CS >> 511 Fall, 2009 Description: %!PS-Adobe-2.0 %Creator: dvipsk 5.58f Copyright 1986, 1994 Radical Eye Software %Title: 0403.dvi %Pages: 4 %PageOrder: Ascend %BoundingBox: 0 0 612 792 %DocumentFonts: CMBX12 CMR10 CMBX10 CMR8 CMMI10 CMMI8 CMSY10 CMBX8 %+ CMSY8 CMTI10 CMEX10 CMSY6 CM... Date Added: 2009-06-03 22:51:06 |
| 07_chap16_part2.ppt Path: MD University College >> CSMN >> 662 Fall, 2009 Description: Lab Lab milestone IV on p. 75 Step through so can work on after exam Note that later in lab, we will look at how optimizer gets the data CSMN 662 ... Date Added: 2009-06-03 22:51:41 |
| Introduction.doc Path: ASU >> MAT >> 294 Fall, 2009 Description: Introduction Are men taller than women? o Pick one man and one woman (hopefully where the woman is taller) and compare their heights o Ask the class if this answers the question Why do we sample? o To understand something about a population o What i... Date Added: 2009-06-03 22:52:53 |
| M Sp09 syllabus.doc Path: UNC Wilmington >> CHML >> 211 Fall, 2009 Description: Spring 2009 CHML211 Monday Sections REQUIRED TEXTS: CHML 211212 Laboratory Manual for Organic Chemistry (Fall 2008 Edition) Organic Chemistry Laboratory Notebook *ALL STUDENTS MUST SUPPLY THEIR OWN SAFETY GLASSES!* COURSE WEBSITE: http:/www.un... Date Added: 2009-06-03 22:53:19 |
| Recrystallization.ppt Path: UNC Wilmington >> CHML >> 211 Fall, 2009 Description: Experiment 7: RECRYSTALLIZATION, MELTING POINT, and HPLC ANALYSIS of ANALGESICS Objectives To learn the purification technique of recrystallization. To further purify aspirin and acetaminophen samples isolated by extraction. To learn the technique... Date Added: 2009-06-03 22:53:20 |
| HOMEWORK.rtf Path: Rose-Hulman >> MA >> 211 Fall, 2009 Description: HOMEWORK - MA 211 - Fall 1995-96 No. Date Due 1 9/4 2 9/7 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 9/11 9/14 9/18 9/21 9/25 9/28 10/2 10/6 10/9 10/10 10/17 10/20 10/24 10/27 10/30 11/6 Assignment Exercises 5,6,7,8,9 Exercises 10,11,12,13 Exercises 18... Date Added: 2009-06-03 22:53:45 |
| hand26.txt Path: Cincinnati >> YR >> 615 Fall, 2009 Description: LINEAR MODELS III HANDOUT #26 This handout will illustrate factor analysis using the correlation matrix as input. DATA PHYS8(TYPE=CORR /* DF=304 */); IN... Date Added: 2009-06-03 22:56:30 |
| assign2.txt Path: Cincinnati >> YR >> 614 Fall, 2009 Description: LINEAR MODELS II ASSIGNMENT #2 DUE JAN 22 CONSIDER THE DATA ON PAGE 414 IN \"ANALYSIS OF MESSY DATA\" PERFORM AN ANALYSIS OF VARIANCE (NOTE: the ... Date Added: 2009-06-03 22:56:51 |
| Lecture_10---Name-Binding.ppt Path: UF >> COP >> 4020 Fall, 2008 Description: Name Binding and Object Lifetimes Programming Language Concepts Lecture 10 Manuel E. Bermdez, Ph.D. Associate Professor University of Florida Prepared by Names Pervasive in programming languages. Not limited to identifiers (\'+\' can be a name) ... Date Added: 2009-06-03 22:58:23 |
| Practice Session #1.doc Path: Clemson >> CPSC >> 372 Fall, 2009 Description: CpSc 372: Introduction to Software Development Autumn 2004 Practice Session #1 The following excerpt is from the initial scope document of a system that will be used by a local bookseller to extend their business boundaries to the internet. The Onl... Date Added: 2009-06-03 23:00:58 |
| CLG Topic 10.doc Path: Purdue >> STAT >> 502 Fall, 2008 Description: Topic 10 Handout: ANCOVA (2) An understanding of why such models are worthwhile. 10.1 Output for Example II (from notes) is given below on pages 1-2... Date Added: 2009-06-03 23:02:08 |
| burget queen merged synch part out.txt Path: RPI >> DSES >> 6620 Fall, 2009 Description: - General Report Output from A:\ ich\\Homework 9\\burget queen merged synch part.MOD Date: Mar/28/2002 Time: 06:56:17 PM -- Scenario : Normal Run Replication : All Period : Final Report (0 sec to 8 hr Elapsed: 8 hr) Simulation Tim... Date Added: 2009-06-03 23:03:18 |
| fantastic dan constant output.txt Path: RPI >> DSES >> 6620 Fall, 2009 Description: - General Report Output from A:\\Homework 5\\fantastic dan constant.MOD [Fantastic Dan] Date: Mar/01/2002 Time: 04:01:44 AM -- Scenario : Normal Run Replication : 1 of 1 Simulation Time : 8 hr - LOCATIONS ... Date Added: 2009-06-03 23:03:26 |
| assignment_7a.txt Path: Fayetteville State University >> PHZ >> 4151 Fall, 2009 Description: #include <iostream> using namespace std; void print(int aI) { cout < \"This is \" < aI < endl; } void print(double aI[ ]) { cout < \"This is (2) \" < aI < endl; } int main() { double i = 3; print(i); } Compiler output = assignment_7.cc: In fun... Date Added: 2009-06-03 23:04:02 |
| assignment_7a.txt Path: Fayetteville State University >> ASSIGNMENT >> 4151 Spring, 2009 Description: #include <iostream> using namespace std; void print(int aI) { cout < \"This is \" < aI < endl; } void print(double aI[ ]) { cout < \"This is (2) \" < aI < endl; } int main() { double i = 3; print(i); } Compiler output = assignment_7.cc: In fun... Date Added: 2009-06-03 23:04:06 |
| jeopardy_template.ppt Path: N.E. Illinois >> EIU >> 1111 Fall, 2009 Description: The History of Eastern Building Former Residence History Presidents Halls Academic Fun Facts Buildings 100 200 300 400 500 100 200 300 400 500 100 200 300 400 500 100 200 300 400 500 100 200 300 400 500 What was the first building on Easter... Date Added: 2009-06-03 23:05:32 |
| 361.TXT Path: East Los Angeles College >> LJ >> 310 Fall, 2009 Description: 0.006447 0.003989 0.289495 -0.736954 -0.739581 0.288165 0.923935 -0.276337 -0.911967 -0.279160 0.748715 0.749456 0.009401 0.001801 0.576697 1.861647 0.576235 -1.497223 -1.502404 1.506752 1.504406 -0.566070 -1.850284 -0.573186 0.009599 0.292849 0.9426... Date Added: 2009-06-03 23:09:39 |
| CV.doc Path: Montclair >> MEDIA >> 1450 Fall, 2009 Description: Tony Spanakos 5100 Ocean View Avenue Brooklyn, NY 11225 (718) 373-2586 spanakos@gmail.com Education: Ph.D. in Political Science, UMass Amherst, May 2000 Dissertation: The Privatization of Citizenship: Race and Democracy in the Dominican Republic and... Date Added: 2009-06-03 23:10:00 |
| Form67.txt Path: Duke >> MATH >> 290 Fall, 2009 Description: The size of LONG is: 4 The size of UNSIGNED LONG is: 4 The size of DOUBLE is: 8 The default LONG is: 1073851552 The default UNSIGNED LONG is: 1073851552 The default DOUBLE is: 7.12893e-270 The smallest LONG is: -2147483648 The largest LONG ... Date Added: 2009-06-03 23:10:10 |
| FRD_LCA_F06a_T12_V1.5.doc Path: USC >> CSCI >> 577 Fall, 2009 Description: Feasibility Rationale Description (FRD) ECLIPSE-BASED COCOMO II Team # 12 Alexander Mathew Girija Goleria Pawan Chandak Gaurav Badlaney Bankim Bhalaria Tanya Jacob Christopher Higginbotham Michael Medved Project Manager, Prototype Life Cycle Plan ... Date Added: 2009-06-03 23:11:27 |
| ise582questionnaire.doc Path: USC >> ENGR >> 582 Fall, 2009 Description: University of Southern California Daniel J. Epstein Department of Industrial and Systems Engineering ISE 582: Web Technology for Industrial Engineering Questionnaire Name: _ _ Email: __ _ Nickname: Tel: Program: EMT / MSISE / Manufacturing / OR /... Date Added: 2009-06-03 23:11:28 |
| HW10.doc Path: W. Kentucky >> CIT >> 141 Fall, 2009 Description: Name: _ CIT 141002, Spring 2009 Homework #10 Go to Staples web site at www.staples.com Under Technology, click on Printers & AllinOnes Choose a Featured Item Which printer did you choose? Answer #A: What is its print speed? Answer #B: What is i... Date Added: 2009-06-03 23:12:20 |
| Week5c.ppt Path: USC >> CS >> 589 Fall, 2008 Description: Software Engineering Issues for Ubiquitous Computing Presented By: Paul Ramirez My Perspective Not projects Understanding ubiquitous computing Classroom 2000 Cyberguide Common Features Challenges Software Engineering aspects Ubiq... Date Added: 2009-06-03 23:12:35 |
| barnfm10e_ppt_9_3.ppt Path: Governors State >> MATH >> 161 Fall, 2009 Description: 9.3 Linear programming and 2 x 2 games : A geometric approach This section will introduce the method of solving a nonstrictly determined matrix game without recessive rows or columns. All such games can be converted into linear programming probl... Date Added: 2009-06-03 23:14:18 |
| words2.txt Path: Wisconsin Milwaukee >> LIB >> 1763 Fall, 2009 Description: ! 29199,55675,1099,245 \"i 4439,11119,1079,2124 11 56165,3659,1079,1716 : 29090,9859,699,190 ^-y 45051,45876,399,898 a 20592,13019,739,953 a 34810,46776,719,1007 a 15743,48156,739,953 a 9724,56195,739,953 a 12093,51376,739,953 a 42273,11079,1099,1443 ... Date Added: 2009-06-03 23:15:31 |
| Exam2Review.doc Path: Evansville >> EE >> 210 Fall, 2009 Description: EE 210 Exam 2 Review Problems March 12, 2009 Dr. Blandford 1. In the circuit below Vi = 3 volts. What is the value of Vo. Show all work. 2. For each circuit below determine the output voltage Vo if Vi = 3 volts. A) B) C) Vo = _ Vo = __ Vo = _ ... Date Added: 2009-06-03 23:16:07 |
| quoteDB-0.txt Path: New Mexico >> CS >> 241 Fall, 2009 Description: :echo: Aa:Bbb :print:quotelist :print:heaplist :print:data:6 Cccc:Dddd :print:quotelist :print:heaplist :print:data:16 H:I :print:quotelist :print:heaplist :print:data:20 Ffffff:Gggggg :print:quotelist :print:heaplist :print:data:34 :remove:2 /remov... Date Added: 2009-06-03 23:17:52 |
| Poetry.ppt Path: UNC Charlotte >> CGLOVE >> 3226 Fall, 2009 Description: Poetry ELED 3226 Agenda Features and Characteristics of Poetry The purposes for reading/writing poetry in the classroom Teaching Poetry in the Classroom Writer\'s Workshop: Poetry Poets on Poetry \"Poetry is simply the most beautiful, impressive, and... Date Added: 2009-06-03 23:18:04 |
| detailed_log.txt Path: Southern Oregon >> CASA >> 20080604 Fall, 2009 Description: 2007-06-04 18:22:59 CDT - BEGIN (6 h Fcst, 2007-06-03.11:00Z, casax, casa_600x540_1) 2007-06-04 18:23:07 CDT - Processing satellite data 2007-06-04 18:23:15 CDT - Processing background grids for hours 0 - 6 [Using 20070603_06Z Eta12 run] 2007-06-04 1... Date Added: 2009-06-03 23:18:39 |
| syllabus01.doc Path: Southern Oregon >> PHIL >> 3283 Fall, 2009 Description: Religion and the Environment Spring, 2001 Syllabus 1. Course Information Course Number: Meeting Times: Meeting Place: Instructor: Office: Phone: E-Mail: Office Hours: 2. Course Goals In this course we will take a cross-cultural perspective on human b... Date Added: 2009-06-03 23:18:48 |
| Set7.doc Path: Cal Poly Pomona >> EGR >> 599 Fall, 2009 Description: EGR599 (Fall 2002) ADVANCED ENGINEERING MATH _ LAST NAME, FIRST Problem set #7 Do the computations by hand unless otherwise indicated, and then check those that yield numerical or symbolic results with MATLAB. Turn in MATLAB work. ... Date Added: 2009-06-03 23:20:00 |
|
|
Get Started With Course Hero Today!
Get study guides, join study groups, and more!
Sign up in seconds with your Facebook account!
Course Hero is a Facebook Application Partner.
Our Social Learning Network was built to provide students and key learning partners like professors a platform to share, meet and collaborate while accelerating their comprehension of course-related theories and concepts. We are committed to providing you immediate access to a growing wealth of study materials and an unparalleled academic network of students, professors and other key partners. Why do you care? Because you want the best grade possible and at times need a 24/7 resource that’s responsive to your needs. |
|
What People Are Saying About Course Hero
|
|||
|
|||
|
Explore the benefits of joining Course Hero's social learning network.
|
|||
![]() |
Get millions of study materials now!Need lecture notes for a missed class or want insightful explanation of the theories and concepts you learn in class? Look no further, Course Hero’s Study Materials empowers you to find a broad and deep set of materials that can help you right now! |
||
![]() |
Get over 200,000 textbook solutions now!Having difficulty with your homework and need documents that are relevant for your Textbook? Don't be frustrated. Course Hero's Textbook Help presents you study materials from many college courses. |
||
![]() |
Meet over 300,000 students and your fellow classmates now!Want to meet your current classmates or those that took the class last year? Don’t worry or have anxiety. Course Hero’s Study Groups gives you the seamless opportunity to develop both anonymous or direct relationships with those classmates whom you want to meet and get help from right now! |
||



