• 1 Page vehicle-insurance-model
    Vehicle-insurance-model

    School: University Of Texas

    note: an unusual multiplicity for aggregation. Car insurance can have many vehicles listed, but a legal vehicle has just a single insurance policy

  • 3 Pages hw789-optIII
    Hw789-optIII

    School: University Of Texas

    Homework 7,8 & 9 Homework 7: Assigned: 11/15/07 Due: 11/24/07, deliver to the T.A. Part 1: Do (turn-in) textbook problems: 16,4.1 c, d, h, i, 16.6,1 Think about textbook problems: 16.5.1 Part 2: Question 3 from the midterm, (the R-tree question). Par

  • 1 Page hw789-optIII
    Hw789-optIII

    School: University Of Texas

    Homework 7,8 & 9 Homework 7: Assigned: 11/15/07 Due: 11/24/07, deliver to the T.A. Part 1: Do (turn-in) textbook problems: 16,4.1 c, d, h, i, 16.6,1 Think about textbook problems: 16.5.1 Part 2: Question 3 from the midterm, (the R-tree question). Par

  • 1 Page hw5n6-III07
    Hw5n6-III07

    School: University Of Texas

    Homeworks 5 & 6 Assigned: 10/26/07 Due dates: HW5, Sunday 11/4/07 HW6, Monday 11/5/07 Option III Data Engineering, Fall '05 C Created on TIME \@ "M/d/yy" 10/26/07 Version: 1.0 Homework 5: Part 1: Textbook problems: 15.2.1 c,e,g,i, 15.2.4c, 15.3.3 P

  • 3 Pages Midterm Exam Review Sheet
    Midterm Exam Review Sheet

    School: University Of Texas

    Midterm Exam Review Sheet EE382V Data Engineering Fall '07 Professor Daniel Miranker Exam Date: Saturday, 10/14/05, 1:00 2:15, closed book. This review sheet is intended only as a study guide concerning the breadth of the exam. You are expected to

  • 3 Pages Fianl Exam Review Sheet 07
    Fianl Exam Review Sheet 07

    School: University Of Texas

    Final Exam Review Sheet EE382V Data Engineering Fall '07 Professor Daniel Miranker Exam Date: Friday, 12/7/07, comprehensive 3 hour exam, closed book. This review sheet is intended only as a study guide concerning the breadth of the exam. You are exp

  • 84 Pages mixins
    Mixins

    School: University Of Texas

    %!PS-Adobe-3.0 %BoundingBox: (atend) %Pages: (atend) %PageOrder: (atend) %DocumentFonts: (atend) %Creator: Frame 5.0 %DocumentData: Clean7Bit %EndComments %BeginProlog % % Frame ps_prolog 5.0, for use with Frame 5.0 products % This ps_prolog file is

  • 41 Pages weise
    Weise

    School: University Of Texas

    %!PS-Adobe-2.0 %Creator: dvips 5.490 Copyright 1986, 1992 Radical Eye Software %Title: pldi-macro.dvi %Pages: 12 1 %BoundingBox: 0 0 612 792 %EndComments %DVIPSCommandLine: dvips -f pldi-macro.dvi %BeginProcSet: tex.pro %! /TeXDict 250 dict def TeXDi

  • 43 Pages protver
    Protver

    School: University Of Texas

    %!PS-Adobe-2.0 %Creator: dvips(k) 5.83 Copyright 1998 Radical Eye Software %Title: protver.dvi %Pages: 9 %PageOrder: Ascend %BoundingBox: 0 0 596 842 %EndComments %DVIPSWebPage: (www.radicaleye.com) %DVIPSCommandLine: dvips protver.dvi -o %DVIPSParam

  • 114 Pages chiba-oopsla95
    Chiba-oopsla95

    School: University Of Texas

    %!PS-Adobe-2.0 %Creator: dvipsk 5.58c Copyright 1986, 1994 Radical Eye Software %Title: paper.dvi %Pages: 15 %PageOrder: Ascend %BoundingBox: 0 0 612 792 %EndComments %DVIPSCommandLine: dvips paper.dvi %DVIPSParameters: dpi=300, compressed, comments

  • 81 Pages zpl00
    Zpl00

    School: University Of Texas

    %!PS-Adobe-2.0 %Creator: dvipsk 5.66a Copyright 1986-97 Radical Eye Software (www.radicaleye.com) %Title: paper.dvi %Pages: 29 %PageOrder: Ascend %BoundingBox: 0 0 612 792 %DocumentFonts: Times-Roman Times-Bold Courier Times-Italic %+ Helvetica-Bold

  • 126 Pages zpl93
    Zpl93

    School: University Of Texas

    %!PS-Adobe-2.0 (TeXPS: dvi->PostScript Driver dvitps, Version 3.11 of September 5, 1990\n)print flush %Creator: derkins.cs.washington.edu:linc (Calvin Lin) %DocumentPaperSizes: Letter %Title: Dvi to PostScript converter, Version 3.11 of September 5,

  • 21 Pages mcguire
    Mcguire

    School: University Of Texas

    %!PS-Adobe-2.0 %Creator: dvips(k) 5.78 Copyright 1998 Radical Eye Software (www.radicaleye.com) %Title: dp2.dvi %Pages: 14 %PageOrder: Ascend %BoundingBox: 0 0 612 792 %DocumentFonts: Palatino-Roman Palatino-Bold Palatino-Italic Courier %EndComments

  • 195 Pages casper
    Casper

    School: University Of Texas

    %!PS-Adobe-2.0 %Creator: dvipsk 5.58f Copyright 1986, 1994 Radical Eye Software %Title: paper.dvi %Pages: 31 %PageOrder: Ascend %BoundingBox: 0 0 596 842 %DocumentPaperSizes: A4 %EndComments %DVIPSCommandLine: dvips -o casper.ps paper.dvi %DVIPSParam

  • 30 Pages syllabus
    Syllabus

    School: University Of Texas

    %!PS-Adobe-2.0 %Creator: dvipsk 5.66a Copyright 1986-97 Radical Eye Software (www.radicaleye.com) %Title: syllabus.dvi %Pages: 3 %PageOrder: Ascend %BoundingBox: 0 0 612 792 %EndComments %DVIPSCommandLine: /lusr/tex/bin/dvips -o syllabus.ps syllabus.

  • 3 Pages hw5n6-III07
    Hw5n6-III07

    School: University Of Texas

    Homeworks 5 & 6 Assigned: 10/26/07 Due dates: HW5, Sunday 11/4/07 HW6, Monday 11/5/07 Option III Data Engineering, Fall '05 Created on 10/26/07 Version: 1.0 Homework 5: Part 1: Textbook problems: 15.2.1 c,e,g,i, 15.2.4c, 15.3.3 Part 2: In english p

  • 3 Pages Midterm Exam Review Sheet
    Midterm Exam Review Sheet

    School: University Of Texas

    Midterm Exam Review Sheet EE382V Data Engineering Fall 07 Professor Daniel Miranker Exam Date: Saturday, 10/14/05, 1:00 2:15, closed book. This review sheet is intended only as a study guide concerning the breadth of the exam. You are expected to kn

  • 18 Pages bali
    Bali

    School: University Of Texas

    The Bali Language Jacob ("Jack") Neal Sarvela May 1, 2003 Abstract. Bali is an LL(k) grammar-specification language designed to produce parsers for the AHEAD tool suite. Unlike traditional grammar specifications using, for example, lex/yacc or JavaCC

  • 57 Pages lab1
    Lab1

    School: University Of Texas

    #%-12345X@PJL JOB @PJL ENTER LANGUAGE = Postscript %!PS-Adobe-3.0 %Title: Microsoft Word - lab1.doc %Creator: PScript5.dll Version 5.2 %CreationDate: 2/21/2002 20:9:29 %For: NIL %BoundingBox: (atend) %Pages: (atend) %Orientation: Portrait %PageOrder:

  • 7 Pages lab1
    Lab1

    School: University Of Texas

    CS 386M Lab 1 Router Configuration and Routing Cisco 2600 Router Configuration Static Routing Dynamic Routing In this lab you will learn: PartA PartB PartC Explore! Time: 2 hrs 50 min 30 min 40 min Components used in this lab: 2 computers with Micro

  • 3 Pages goudalab
    Goudalab

    School: University Of Texas

    CS386M Lab Cisco 2600 Router Configuration Static Routing Dynamic Routing Access Control Lists In this lab you will learn: PartA PartB PartC PartD Explore! Time: 2 hrs 30 min 40 min 20 min 30 min 30 min Components used: 2 computers with Microsoft Wi

  • 15 Pages gouda_lab
    Gouda_lab

    School: University Of Texas

    CS CS386M Communication Networks Basic LAN Setup & Trace analysis using Ethereal Time: 2 hrs Tasks: Time: 2:00 hrs (Task 1-6 should take 45 min; the rest of the time is for Ethereal) 1 - Verify that TCP/IP is installed on each of the computers 2 -

  • 2 Pages gouda_prelab
    Gouda_prelab

    School: University Of Texas

    CS 386M Communication Networks Spring 2004 Pre-Lab: Basic LAN Setup & Trace analysis using Ethereal A completed pre-lab needs to be turned in at the beginning of the lab session and you should bring your lab handout with you. 0. Please sign up for y

  • 1 Page Quiz5
    Quiz5

    School: University Of Texas

    - Mohamed G. Gouda CS 386S Spring 2009 Quiz 5 -- Consider an e-voting system that consists of a voting center c and an array of 100 voters v[0], ., v[99]. Periodically, c sends a

  • 1 Page Quiz3
    Quiz3

    School: University Of Texas

    - Mohamed G. Gouda CS 386S Spring 2008 Quiz#3 -- A process p needs to establish a session key sk with another process q under the following three assumptions: 1. Process p trus

  • 3 Pages Midterm2
    Midterm2

    School: University Of Texas

    - Mohamed G. Gouda CS 386S Spring 2009 Midterm 2 -- Open book 75 minutes - 1. (10 points) In the Single Password Protocol (SPP), a server S maintains the following tuple f

  • 11 Pages JTS-Theory
    JTS-Theory

    School: University Of Texas

    JTS: Tools for Implementing Domain-Specific Languages Don Batory, Bernie Lofaso, and Yannis Smaragdakis Department of Computer Sciences The University of Texas at Austin Austin, Texas 78712 {batory, bernie, smaragd}@cs.utexas.edu Abstract1 The Jakar

  • 19 Pages AHEAD-Tutorial
    AHEAD-Tutorial

    School: University Of Texas

    Revised September 8, 2004 A Tutorial on Feature Oriented Programming and the AHEAD Tool Suite (ATS) Don Batory Department of Computer Sciences University of Texas at Austin Austin, Texas, 78712 U.S.A. batory@cs.utexas.edu 1 Introduction Software En

  • 3 Pages goudaprelab
    Goudaprelab

    School: University Of Texas

    Router configuration, Static and Dynamic Routing, Access control lists Pre Lab(To be submitted when you come for the lab) Name: 1. Differentiate between Routers, Switches and Hubs. 2. Explain subnet masks. 3. What are the advantages of Dynamic rout

  • 1 Page goudaprelab
    Goudaprelab

    School: University Of Texas

    Router configuration, Static and Dynamic Routing, Access control lists Pre Lab(To be submitted when you come for the lab) Name: 1. Differentiate between Routers, Switches and Hubs. 2. Explain subnet masks. 3. What are the advantages of Dynamic rout

  • 7 Pages lab1
    Lab1

    School: University Of Texas

    CS 386M Lab 1 Router Configuration and Routing Cisco 2600 Router Configuration Static Routing Dynamic Routing In this lab you will learn: PartA PartB PartC Explore! Time: 2 hrs 50 min 30 min 40 min Components used in this lab: 2 computers with Micro

  • 13 Pages gouda_lab
    Gouda_lab

    School: University Of Texas

    CS CS386M Communication Networks Basic LAN Setup & Trace analysis using Ethereal Time: 2 hrs Tasks: Time: 2:00 hrs (Task 1-6 should take 45 min; the rest of the time is for Ethereal) 1 - Verify that TCP/IP is installed on each of the computers 2 -

  • 2 Pages gouda_prelab
    Gouda_prelab

    School: University Of Texas

    CS 386M Communication Networks Spring 2004 Pre-Lab: Basic LAN Setup & Trace analysis using Ethereal A completed pre-lab needs to be turned in at the beginning of the lab session and you should bring your lab handout with you. 0. Please sign up for y

  • 1 Page schedule
    Schedule

    School: University Of Texas

    Presentation Schedule for CS 386S: - Any student enrolled in CS 386S class can attend any subset of the following presentations: - Subject Date-and-Time Room -- E-Voting May 8, 11-12 noon TAY 3.144 Denial-of-Service May 8, 3-4 pm ACE 3.116

  • 1 Page Quiz8
    Quiz8

    School: University Of Texas

    - Mohamed G. Gouda CS 386S Spring 2009 Quiz 8 -- Design a packet filter that implements hop integrity over the subnetwork 128.83.10.0/24. (Recall that the IP addresses on this s

  • 1 Page Quiz7
    Quiz7

    School: University Of Texas

    - Mohamed G. Gouda CS 386S Spring 2009 Quiz 7 -- There are two objectives of the anonymity protocol of David Chaum: 1. A user process p can send a secret fore message to anothe

  • 1 Page Quiz6
    Quiz6

    School: University Of Texas

    - Mohamed G. Gouda CS 386S Spring 2008 Quiz 6 -- Consider an antireplay window protocol where a process p sends a continuous stream of messages to process q. Each sent message fr

  • 2 Pages Quiz4
    Quiz4

    School: University Of Texas

    - Mohamed G. Gouda CS 386S Spring 2008 Quiz 4 -- Consider a mutual authentication protocol between processes p and q. In this protocol, process p has a public key B.p and a priva

  • 2 Pages Quiz2
    Quiz2

    School: University Of Texas

    - Mohamed Gouda CS 386 S Spring 2008 Quiz#2 - Consider the following two-step cascade protocol PR, similar to those described in the Dolev and Yao paper. x -> y : Ad x <- y : BAd where d is data, A is a reduced key sequen

  • 1 Page Quiz1
    Quiz1

    School: University Of Texas

    - Mohamed Gouda CS 386 S Spring 2009 Quiz#1 - Consider the following two-step cascade protocol, similar to those defined in the Dolev and Yao paper: x -> y : D.x E.y E.x D.y d x <- y : E.x D.y D.x E.y E.x D.y d Specify the steps

  • 1 Page Project
    Project

    School: University Of Texas

    - Mohamed G. Gouda CS 386S Spring 2009 Project -- Project: The students in the class will be orgainzed into seven teams of three students each. Then each team will perform the f

  • 20 Pages 2-4
    2-4

    School: University Of Texas

    Part 2: Design Principles Goals: identify, study common architectural principles, protocol mechanisms synthesis: big picture Overview: Separation of data and control: signaling state management: hard vs. soft-state randomization indirection mu

  • 1 Page chomsky-hierarchy
    Chomsky-hierarchy

    School: University Of Texas

    All of Computational Linguistics deterministic methods chomsky hierarchy Type 0 Unrestricted Languages Grammars Type 1 Context Sensitive Languages Grammars Type 2 Context Free Languages Grammars Type 3 Regular Language Grammars Expressions statist

  • 56 Pages ShuDefense-0929
    ShuDefense-0929

    School: University Of Texas

    On Multiple Sequence Alignment Shu Wang Ph.D. Defense Committee Members: Professor Daniel Miranker, advisor Professor Tony Ambler, co-advisor Professor Joydeep Ghosh Professor Robin Gutell Professor Driga Mircea Computer Engineering Curriculum Track

  • 73 Pages SemanticWeb09
    SemanticWeb09

    School: University Of Texas

    Introduction to the Semantic Web from the database & data integration perspective Professor Daniel P. Miranker Department of Computer Sciences University of Texas at Austin Austin, Texas, USA http:/cs.utexas.edu/~miranker In the beginning, the Sema

  • 1 Page CIPRes_poster_2
    CIPRes_poster_2

    School: University Of Texas

    C Common data standards and exchange protocols Collaborative study tools Solution: Morph* and CIPRes Interope

  • 46 Pages 36b-treescont09
    36b-treescont09

    School: University Of Texas

    B+ Tree's:continued a) structure,split and promote b) intro: when to use. Objective: Understand the implications disk access on the design of data structures. fat fanout split/promote many slides, Thanks GarciaMolina, (but you may want to s

  • 31 Pages 19leftoversouffle09
    19leftoversouffle09

    School: University Of Texas

    Left Over Souffl - Clock replacement - Waits for graph - Join index - Outer join - XML Objective: Not let you leave this class not knowing certain specific, sometimes high profile ideas 19LeftOverSouffle Database Management & Engineering 1 Clock Re

  • 58 Pages 16Log-Based Recovery09
    16Log-Based Recovery09

    School: University Of Texas

    Log-Based Failure Recovery (when database management systems fail) Objectives: 1) review transactional requirements of a DBMS 2) Log-based algorithms to support durability Slide thanks: many from textbook web site 16 Transactions, Recovery Databas

  • 36 Pages 10chaining08-prelim
    10chaining08-prelim

    School: University Of Texas

    Chaining Local Alignments Elements of Biological Data Models Daniel P. Miranker Objectives: Dynamic Programming Algorithm for Longest Path in a Directed Acyclic Graph Applied to piecing together maximal scoring local alignment 10Chaining-V2 Biol

  • 20 Pages 10bitvectorindex
    10bitvectorindex

    School: University Of Texas

    Bit-Vector Index Objectives: Basic introduction to a very different indexing concept. Place for the method in application use and culture Thanks: a few slides borrowed from Ramakrishnan text slides 14BitVectorIndex09 Database Systems 1 Cultura

  • 21 Pages 9SmithWaterman08-new
    9SmithWaterman08-new

    School: University Of Texas

    From Edit Distance Local Alignment Objectives: - global alignment (Needleman-Wunch) - local (Smith-Waterman) alignment Also for you reference http:/www.techfak.uni-bielefeld.de/bcd/Curric/welcome.html http:/lectures.molgen.mpg.de/Pairwise/SeqAli

  • 27 Pages 8alignmentF08-errata
    8alignmentF08-errata

    School: University Of Texas

    Biological Sequence Alignment Objectives: Terminology surrounding sequence alignment Simple Edit Distance Dynamic Programming Algorithm 8Seq.Alignment08-errata Elements of Biological Data Models 1 Biological Sequence Alignment Materials adapt

  • 27 Pages 8alignment08
    8alignment08

    School: University Of Texas

    Biological Sequence Alignment Objectives: Terminology surrounding sequence alignment Simple Edit Distance Dynamic Programming Algorithm 8Seq.Alignment07-errata Elements of Biological Data Models 1 Biological Sequence Alignment Materials adapt

  • 36 Pages 6DDL-F08
    6DDL-F08

    School: University Of Texas

    Physical Implementation: Objectives: Role, structure of SQL data definition language Database enforcement of the data model (constraints) culminating in cascade delete. 6DDL Biological Data Models 1 Data Modeling In the Context of Database D

  • 22 Pages 5memoryRole09
    5memoryRole09

    School: University Of Texas

    The Use of Memory (RAM) Objectives: Last two lectures, external data structures (index) for data retrieval measuring/understanding the utility of such data structures. This lecture role of main-memory allocation two-phase external sort block

  • 24 Pages sesameISWC2002TRversion
    SesameISWC2002TRversion

    School: University Of Texas

    On-To-Knowledge: Content-Driven Knowledge Management Tools through Evolving Ontologies Sesame: A generic Architecture for Storing and Querying RDF and RDF Schema Jeen Broekstra Arjohn Kampman Summary. On-To-Knowledge project deliverable 10. RDF and

  • 12 Pages DasOraclesEffortVLDB2004
    DasOraclesEffortVLDB2004

    School: University Of Texas

    Supporting Ontology-based Semantic Matching in RDBMS Souripriya Das, Eugene Inseok Chong, George Eadon, Jagannathan Srinivasan Oracle Corporation One Oracle Drive, Nashua, NH 03062, USA Abstract Ontologies are increasingly being used to build applica

  • 117 Pages 17
    17

    School: University Of Texas

    Concurrency Control, Ch 18 Objectives: Serializble Schedules Serializability Theorem Modified from Hector GarciaMolina slides 17ConcurrencyControl Database Management 1 Correctness This text's authors include "transaction people". Introduc

  • 26 Pages rosse
    Rosse

    School: University Of Texas

    1 Terminologia Anatomica; Considered from the Perspective of Next-Generation Knowledge Sources CORNELIUS ROSSE, M.D., D.Sc. Structural Informatics Group, Department of Biological Structure and Division of Biomedical Informatics, Department of Medica

  • 13 Pages p144-navathe
    P144-navathe

    School: University Of Texas

    VIEW REPRFSENTATION LOGICAL DATABASEDESIGN IN Shamkant B. Navathe Graduate School of Business New York University Mario Schkolnick IBM Research Laboratory San Jose, California 95193 ABSTRACT: The process of logical database design consists of four

  • 10 Pages nrg1295bioontologyreview
    Nrg1295bioontologyreview

    School: University Of Texas

    REVIEWS ONTOLOGIES IN BIOLOGY: DESIGN, APPLICATIONS AND FUTURE CHALLENGES Jonathan B. L. Bard* and Seung Y. Rhee Biological knowledge is inherently complex and so cannot readily be integrated into existing databases of molecular (for example, sequen

  • 13 Pages navathe-sigmod78
    Navathe-sigmod78

    School: University Of Texas

    VIEW REPRFSENTATION LOGICAL DATABASEDESIGN IN Shamkant B. Navathe Graduate School of Business New York University Mario Schkolnick IBM Research Laboratory San Jose, California 95193 ABSTRACT: The process of logical database design consists of four

  • 12 Pages golbreich
    Golbreich

    School: University Of Texas

    What reasoning support for Ontology and Rules? the brain anatomy case study Christine Golbreich1, Olivier Dameron1, Olivier Bierlaire1 2, Bernard Gibaud2 1 Laboratoire dInformatique Mdicale, Av du Pr. Lon Bernard, 35043 Rennes France {christine.golb

  • 3 Pages redundantExcludedMiddle
    RedundantExcludedMiddle

    School: University Of Texas

    1,000.00 m 0.50 0.25 m_x 1.21 0.05 0.10 0.15 0.20 0.25 0.30 0.35 0.40 0.50 1.04 1.08 1.12 1.16 1.21 1.26 1.31 1.37 1,036,913.77 1,075,716.64 1,116,717.34 1,160,252.02 1,206,695.05 1,256,470.80 1,310,067.35 1,368,053.22 0.55 1.04 1.07 1.11 1.15 1.2

  • 84 Pages patel-schneider-sw
    Patel-schneider-sw

    School: University Of Texas

    The Semantic Web and (vs?) Knowledge Representation ENC 2004, September 2004 Peter F. PatelSchneider Bell Labs Research Murray Hill, NJ, USA pfps@lucent.com Abstract The vision of the Semantic Web is a collection of documents in the World Wide Web

  • 1 Page hw1-386
    Hw1-386

    School: University Of Texas

    Homework 1 Assigned: 9/6/05 CS 386 Database Management, Fall '05 Created on 9/6/05 Version: 1.0 Due: 9/13/05, at the begining of class, late to class, homework is late. If you are going to be late, make other arrangments with the T.A. Textbook prob

  • 1 Page gyra_ecoli
    Gyra_ecoli

    School: University Of Texas

    >sp|P09097|GYRA_ECOLI DNA gyrase subunit A (EC 5.99.1.3) - Escherichia coli, and Shigella flexneri. MSDLAREITPVNIEEELKSSYLDYAMSVIVGRALPDVRDGLKPVHRRVLYAMNVLGNDWN KAYKKSARVVGDVIGKYHPHGDSAVYDTIVRMAQPFSLRYMLVDGQGNFGSIDGDSAAAM RYTEIRLAKIAHELMADLEKETVDFVDN

  • 17 Pages AHEAD-Theory
    AHEAD-Theory

    School: University Of Texas

    IEEE TRANSACTIONS ON SOFTWARE ENGINEERING, VOL. 30, NO. 6, JUNE 2004 355 Scaling Step-Wise Refinement Don Batory, Member, IEEE, Jacob Neal Sarvela, Student Member, IEEE, and Axel Rauschmayer, Student Member, IEEE AbstractStep-wise refinement is

  • 3 Pages rose_gotchas
    Rose_gotchas

    School: University Of Texas

    CS386 Database Management Smriti Ramakrishnan Data Modeling with IBM Rational Rose: Things to Remember This is my draft of class notes for 15 Sep 2005, along with some of my own UML notes. Please send any mistakes you find to smriti@cs.utexas.edu [

  • 3 Pages hwFinal-09
    HwFinal-09

    School: University Of Texas

    CS386D: Remaining Homework and Schedule Due Dates: HW 8: Tuesday, April 21, noon HW 9: Monday, April 27, noon CS386D Database Systems Created on 4/17/09 Version: 1.0 This page speaks to all your deadlines, and all your homework for the rest of the

  • 10 Pages Manual
    Manual

    School: University Of Texas

    Jacob Schrum, JBS2362, CS386C Dependable Computing Synchronous Atomic Broadcast Simulator Manual Underlying implementeation: Processor.php Models individual processors and the network. Contains global variable $network: 1. An array of instances of

  • 15 Pages CS386L-Lecture-11
    CS386L-Lecture-11

    School: University Of Texas

    The Structure of Typed Programming Languages (Chapter 4) CS386L- Programming Languages Dr. Greg Lavender Department of Computer Sciences The University of Texas at Austin CS386L: Lecture-11 - The Structure of Typed Programming Languages: Chapter 4

  • 51 Pages 6b-trees
    6b-trees

    School: University Of Texas

    B+Trees:Primarymethodfor managingdataondisks. Obective:Understandtheimplicationsdiskaccesson thedesignofdatastructures. fatfanout split/promote manyslides,ThanksGarciaMolina,(butyoumay wanttoseehisoriginalset) 6:btrees DatabaseManagement&Engineerin

  • 19 Pages 1intro-08
    1intro-08

    School: University Of Texas

    Introduction Option III: Data Engineering Daniel P. Miranker Objectives: Get to know each other Set expectations 1: Introduction Data Management & Engineering 1 Outline: Administrivia (see handouts) Personal introductions Course motivation

  • 24 Pages 20webapp
    20webapp

    School: University Of Texas

    Milestone 5: Web Application Elements of Biological Data Models Daniel P. Miranker Objectives: Information and Platform Organization of 3-tier architectures Milestone 5 as Java Applet 20WebApp Biological Data Models 1 Recap: Claimed benefit of

  • 28 Pages 17xml2-07
    17xml2-07

    School: University Of Texas

    XML Objectives: 1) Specifying the contents of an XML document (DTD's and XML Schema) 2) A simple programmatic way to fetch and parse XML from bio-websites. Thanks: Eran Toch, Kroenke, some materials derived from http:/www.w3schools.com/xml/default.a

  • 34 Pages 16xml-intro-07
    16xml-intro-07

    School: University Of Texas

    XML Database Export Schema Go Mainstream objectives: The parts and scope of XML Larger technological context of XML 16Intro XML 1 Usual Introduction to XML "Just like HTML, except the tags say what the data is, both people and programs can inte

  • 8 Pages 15bIndexKeyOptimization
    15bIndexKeyOptimization

    School: University Of Texas

    Index-Key Optimization (cont'd) Elements of Biological Data Models Daniel P. Miranker Objectives: Key "hacks" to improve disk cluster & performance embolden students to take on a task traditionally reserved for DBA's 15bIndexKeyOptimization Bio

  • 30 Pages 14jdbc08
    14jdbc08

    School: University Of Texas

    JDBC: "Wiring Java to a Database" Objectives: Explain generic structure of client-server relationship in the application of databases. Detail programming JDBC for the MiniRosetta Project. slides: many with help from Shulin, some from Kroenke 12JDB

  • 51 Pages 6b-trees
    6b-trees

    School: University Of Texas

    B+Trees:Primarymethodfor managingdataondisks. Objective:Understandtheimplicationsdiskaccesson thedesignofdatastructures. fatfanout split/promote manyslides,ThanksGarciaMolina,(butyoumay wanttoseehisoriginalset,seeclasswebsite) 6:btrees CS386Databas

  • 27 Pages 2vocabulary-06
    2vocabulary-06

    School: University Of Texas

    The Vocabulary of Logical Data Models Objectives: Databases are content addressable The role of keys Terminology basic database vocabulary of data models - words and images 2Vocabulary Bio. Data Models 1 DataModelingInthe ContextofDatabaseD

  • 12 Pages shaprio
    Shaprio

    School: University Of Texas

    Journal of the American Medical Informatics Association Volume 12 Number 1 Jan / Feb 2005 35 Application of Information Technology j Processes and Problems in the Formative Evaluation of an Interface to the Foundational Model of Anatomy Knowledg

  • 3 Pages overview-posterversion
    Overview-posterversion

    School: University Of Texas

    CS329e Elements of Modeling Biological Data Spring 2006 Professor Daniel P. Miranker Course Content: The goal of this course is to teach non-CS students the basics of organizing data from an experiment as data in a database so that it will be easy t

  • 3 Pages hw8910-optIII-v2
    Hw8910-optIII-v2

    School: University Of Texas

    Homework 8, 9 & 10 Note the consecutive Monday due dates EE382v Data Engineering, Fall '05 Created on 11/15/05 Version: 2.0 Homework 8: Assigned: 11/12/05 Due: 11/21/05, deliver to the T.A. Do (turn-in) textbook problems: 16.2.2c, 16.2.9 e,i, 16,4.

  • 3 Pages hw8-9-386
    Hw8-9-386

    School: University Of Texas

    Homework 8 & 9 Homework 8: Assigned: 11/11/05 Due: 11/16/05, deliver to the T.A. CS 386 Database Management, Fall '05 Created on 11/11/05 Version: 1.0 Do (turn-in)textbook problems: 16.2.2c, 16.2.9 e,i, 16,4.1 c, d, h, i, 16.6,1 Think about textboo

  • 3 Pages hw8-9-386-v2
    Hw8-9-386-v2

    School: University Of Texas

    Homework 8 & 9 Homework 8: Assigned: 11/11/05 Due: 11/16/05, deliver to the T.A. CS 386 Database Management, Fall '05 Created on 11/15/05 Version: 2.0 Do (turn-in)textbook problems: 16.2.2c, 16.2.9 e,i, 16,4.1 c, d, h, i, 16.6,1 Think about textboo

  • 1 Page excludedMiddleM
    ExcludedMiddleM

    School: University Of Texas

    1rho 0.5 0.77 0.07 0.13 0.19 0.24 0.29 0.34 0.38 0.42 0.46 0.5 0.54 0.57 0.6 0.63 0.67 0.7 0.73 0.77 0.81 rho 0.5 0.23 0.93 0.87 0.81 0.76 0.71 0.66 0.62 0.58 0.54 0.5 0.46 0.43 0.4 0.37 0.33 0.3 0.27 0.23 0.19 m 0.5 0.9 0.05 0.1 0.15 0.2 0.25 0

  • 3 Pages cs329e-for-BME-review
    Cs329e-for-BME-review

    School: University Of Texas

    CS329e Elements of Modeling Biological Data Spring 2006 Professor Daniel P. Miranker Course Content: The objectives of this course are twofold. First, the course will cover the emerging methods in biology that are responsible for the creation of lar

  • 1 Page Workbook20
    Workbook20

    School: University Of Texas

    1rho 0.5 0.77 0.07 0.13 0.19 0.24 0.29 0.34 0.38 0.42 0.46 0.5 0.54 0.57 0.6 0.63 0.67 0.7 0.73 0.77 0.81 rho 0.5 0.23 0.93 0.87 0.81 0.76 0.71 0.66 0.62 0.58 0.54 0.5 0.46 0.43 0.4 0.37 0.33 0.3 0.27 0.23 0.19 m 0.5 0.9 0.05 0.1 0.15 0.2 0.25 0

  • 117 Pages 17
    17

    School: University Of Texas

    Concurrency Control, Ch 18 Objectives: Serializble Schedules Serializability Theorem Modified from Hector GarciaMolina slides 17ConcurrencyControl Database Management 1 Correctness This text's authors include "transaction people". Introduc

  • 8 Pages 15bIndexKeyOptimization
    15bIndexKeyOptimization

    School: University Of Texas

    Index-Key Optimization (contd) Elements of Biological Data Models Daniel P. Miranker Objectives: Key hacks to improve disk cluster & performance embolden students to take on a task traditionally reserved for DBAs 15bIndexKeyOptimization Biologi

  • 30 Pages 14jdbcF08
    14jdbcF08

    School: University Of Texas

    JDBC: Wiring Java to a Database Objectives: Explain generic structure of client-server relationship in the application of databases. Detail programming JDBC for the MiniRosetta Project. slides: many with help from Shulin, some from Kroenke 12JDBC

  • 35 Pages 13multidimindex09
    13multidimindex09

    School: University Of Texas

    Multidimensional (spatial) Indexing Objectives: Think of data in a space that can be cut up in many ways (k-d trees, quad-trees, R-trees) If thought of wrt split-and-promote, forms a generalizable infrastructure. Detailed considerations Thanks:

  • 26 Pages 13 Join Operators
    13 Join Operators

    School: University Of Texas

    Physical Join Operators Objectives: Introduce three primary join methods Cost and adornment on plan trees 13 Join Operators Database Management & Engineering 1 Three Primary Classes of Join Algorithm 1. Block-Nested Loops (vs. Simple Nested Lo

  • 27 Pages 8alignmentF08
    8alignmentF08

    School: University Of Texas

    Biological Sequence Alignment Objectives: Terminology surrounding sequence alignment Simple Edit Distance Dynamic Programming Algorithm 8Seq.Alignment07-errata Elements of Biological Data Models 1 Biological Sequence Alignment Materials adapt

  • 34 Pages 7TriggersViewsSemantics
    7TriggersViewsSemantics

    School: University Of Texas

    Triggers and Views [Further opportunity for integrating application semantics] Objectives: Definition and use of Triggers and Views Expression and Compilation of Inheritance in UML 7:Semantics/Triggers/Views Database Systems 1 Course Notice: U

  • 12 Pages Akella03
    Akella03

    School: University Of Texas

    A Measurement-Based Analysis of Multihoming Aditya Akella Bruce Maggs Srinivasan Seshan Carnegie Mellon University {aditya, srini+, bmm}@cs.cmu.edu Anees Shaikh IBM T.J. Watson Research Center aashaikh@watson.ibm.com Ramesh Sitaraman Univ. of Massa

  • 12 Pages meridian-sigcomm05
    Meridian-sigcomm05

    School: University Of Texas

    Meridian: A Lightweight Network Location Service without Virtual Coordinates Bernard Wong Aleksandrs Slivkins Emin Gun Sirer Dept. of Computer Science, Cornell University, Ithaca, NY 14853 {bwong, slivkins, egs}@cs.cornell.edu ABSTRACT This paper in

  • 14 Pages spam-gt-css-2006-001
    Spam-gt-css-2006-001

    School: University Of Texas

    Understanding the Network-Level Behavior of Spammers Anirudh Ramachandran and Nick Feamster College of Computing Georgia Tech {avr, feamster}@cc.gatech.edu ABSTRACT well prove to be a huge asset for designing spam filters that are based on spammers'

Back to course listings