BIS104SCHOLEYMT1

BIS104SCHOLEYMT1 - V746}??? MT~M7 MIDTERM BlOSQ] lgnt...

Info iconThis preview shows pages 1–9. Sign up to view the full content.

View Full Document Right Arrow Icon
Background image of page 1

Info iconThis preview has intentionally blurred sections. Sign up to view the full version.

View Full DocumentRight Arrow Icon
Background image of page 2
Background image of page 3

Info iconThis preview has intentionally blurred sections. Sign up to view the full version.

View Full DocumentRight Arrow Icon
Background image of page 4
Background image of page 5

Info iconThis preview has intentionally blurred sections. Sign up to view the full version.

View Full DocumentRight Arrow Icon
Background image of page 6
Background image of page 7

Info iconThis preview has intentionally blurred sections. Sign up to view the full version.

View Full DocumentRight Arrow Icon
Background image of page 8
Background image of page 9
This is the end of the preview. Sign up to access the rest of the document.

Unformatted text preview: V746}??? MT~M7 MIDTERM BlOSQ] lgnt SUMMER SESSION 2 (hr, Sclwlflf AUGUST 30, 1999 NAME: [D#: 1. (3 points) List the three tenets of the Cell Theory of Schleiden and Schwaan. W 2. (6 points) Draw a diagram of a fluorescence microscope that could be used to visualize mitotic spindles stained with a fluorescein-conjugated anti-tubulin antibody. The dye fluorescein is excited by the blue light (7» = 470—500 nm) and the excited dye emits green light (9» = 510 — 570 nm). BIS 104 8811 99 — 08/3 0/99 3. (12 points) Briefly define the following cellular components and their fimction in cells. A. cytosol \ REE B. microtubule M \ C. mitochondria M D. nucleus E. Golgi apparatus R ER F. endoplasmic reticulum ME ME BIS 104 $811 99 — 08/30/99 4. (8 points) (a) According to the three kingdom hypothesis, the three major kingdoms of living organism are ) and (b) Name a living cell that may be closely related to the common ancestor of all present-day cells. E (c) According to the endosymbiont hypothesis, an ancestral proto-eukaryote engulfed a non-photosynthetic eubacterium by and the engulfed cell gradually evolved into a (d) What argument suggests that all living cells evolved from a common ancestral cell? (4 points) What is the numerical aperture of an objective that has a resolving power of 220 nm using light wavelength E 560 nm? (Show your calculations.) (4 points) List the steps that you would use to prepare a red blood cell for transmission electron microscopy. BIS 104 $811 99 08/3 0/99 — 7. (4 points) List four methods of breaking cells to produce a homogenate. (a) N (b) _. rm (0) _ N (d) N 8. (10 points) (a) Draw the chemical structure of a phosphoglyceride. (b) Consider a single span transmembrane protein with the sequence NH2-NLSTGVKKKGAVLLILLFPWMVAGGPLFWLAADESTYKGS-COOH Draw and label a schematic diagram of a fluid mosaic lipid bilayer cell membrane with this protein as it would reside in the plasma membrane. mo Acids and Their Symbols A All Alanine C ' (N5 WM 0 Asp Aspmic acid E Giu Glutamic acid F PM Phenylalanine G Giy Glycine H His Histidine i lle boieucine K Ly: Lysine L Lou Loudne M Met Methionine N Asn Aspartame P Pro Praline 0 Gln Gluumine R Arg Arginine 5 Ser Senna T Thr Thuonine 4 v V» Valine W Ttp Twptophan Y Tyr Tyrosine BIS 104 8811 99 08/30/99 7. (4 points) List four methods of breaking cells to produce a homogenate. (a) m (b) \ (c) m (d) \ 8. (10 points) (a) Draw the chemical structure of a phosphoglyceride. Draw and label a schematic diagram of a fluid mosaic lipid bilayer cell membrane with this protein as it would reside in the plasma membrane. » - o Acids and Their Symbols 1 A Ala Alanine / C Cys Cysteine / / D Asp Aspanic acid / E Glu Glutamic acid Phe Phenylalanine F G Gly Glycine x__ _ _ _ H His Histidine \x l lle lsoleucine \R K Lys Lysine / L Leu Leucine a M Met Methionine N Asn Asparagine P Pro Praline R O Gln Glutamine R Arg Arginine a 5 Ser Serine K T Thr Threonine V Val Valine a W Trp Tryptophan Y / Tyr Tyrosine ——_-_———__ BIS 104 SSII 99 — 08/3 0/99 9. 10. (6 points) (a) How much free energy would be released if a 10-fold concentration gradient of calcium ions was allowed to dissipate? Let 2.303 RT = 1.4 Kcalmol’l, F = 23.06 Kca1.v‘.mol", and N? = -0.07V. (b) Estimate the membrane potential for a cell membrane whose most permeable ion is K, when [K] in = 120 mM and [K *1 out = IOmM and 2.3 RT/F = 61.5mV4 (10 points) Explain how voltage-gated Na+ channels contribute to the generation of an action potential. BIS 104 8811 99 — 08/30/99 11. (3 points) Name three ways in which an ion channel can be gated. (a) (b) (c) 12. (10 points) Using diagrams, outline the events that occur at a synapse as a neuronal signal (action potential) is transmitted from one neuron to another. BIS 104 8811 99 - 08/30/99 13. (10 points) G-proteins and protein phosphorylation act as molecular “on-off” switches in intracellular signaling cascades. Draw schematic diagrams outlining the reactions by which they are switched on and off. BIS 104 SSII 99 - 08/30/99 14. (10 points) Write down the signaling pathway by which adrenaline stimulates glycogen breakdown in muscles. ...
View Full Document

This note was uploaded on 04/16/2008 for the course BIS 104 taught by Professor Scholey during the Spring '08 term at UC Davis.

Page1 / 9

BIS104SCHOLEYMT1 - V746}??? MT~M7 MIDTERM BlOSQ] lgnt...

This preview shows document pages 1 - 9. Sign up to view the full document.

View Full Document Right Arrow Icon
Ask a homework question - tutors are online