Lect2primaryandsecondarystr

Lect2primaryandsecondarystr - Fig. 3-32 Lehn Fig. 3-33 Lehn...

Info iconThis preview shows pages 1–39. Sign up to view the full content.

View Full Document Right Arrow Icon
Lehn. Fig. 3-9
Background image of page 1

Info iconThis preview has intentionally blurred sections. Sign up to view the full version.

View Full DocumentRight Arrow Icon
Lehn. Fig. 3-10
Background image of page 2
In a highly basic solution (pH 13), the dominant form of glycine is: A)NH 3 + -CH 2 -COOH B)NH 2 -CH 2 -COOH C)NH 2 -CH 3 + -COO - D)NH 2 -CH 2 -COO - E) NH 3 + -CH 2 -COO -
Background image of page 3

Info iconThis preview has intentionally blurred sections. Sign up to view the full version.

View Full DocumentRight Arrow Icon
Fig. 3-12 Lehn
Background image of page 4
Background image of page 5

Info iconThis preview has intentionally blurred sections. Sign up to view the full version.

View Full DocumentRight Arrow Icon
Lehn. Fig. 3-13
Background image of page 6
Lehn 3-14
Background image of page 7

Info iconThis preview has intentionally blurred sections. Sign up to view the full version.

View Full DocumentRight Arrow Icon
Background image of page 8
Background image of page 9

Info iconThis preview has intentionally blurred sections. Sign up to view the full version.

View Full DocumentRight Arrow Icon
Background image of page 10
Fig. 5-1 Lehn
Background image of page 11

Info iconThis preview has intentionally blurred sections. Sign up to view the full version.

View Full DocumentRight Arrow Icon
Fig. 3-30 Lehn
Background image of page 12
>gi|156365516|ref|XP_001626691.1| predicted protein [Nematostella vectensis] MSFSYYTNTSSQSLARPLSAPILDEAFQAHGQSG HRFVRKTFTRPTYCHHCTDMLWGFTNQGFMCDVC NFVTHDRCMIFVTIPCVSIATTLVKIPVAHTWSG LSFSFRKKFCSVCRRRLEDIPAFRCQVCDYYVHE ACQDFSVTDCKQSATYVPFLGKRAVKQDHHWREG NFSASSKCVSCKHSCGSGECLASLKCSWCAQSSH TNCSQLLPKECHYGYLHRVSLPPFCVSFPDKTPK PRHFHTFSERGVQKGFSRFYRMKKIKVYDGNLTS PRASKSVTVPRNAKISKVLDETLKSFHINDDPDN YYLAKAVDERKPLDPEEIPVQFPEKESKPLIFLR IKSADKRKGYIRIYAGTEIDVPVLFKTLPVIAST
Background image of page 13

Info iconThis preview has intentionally blurred sections. Sign up to view the full version.

View Full DocumentRight Arrow Icon
Background image of page 14
Background image of page 15

Info iconThis preview has intentionally blurred sections. Sign up to view the full version.

View Full DocumentRight Arrow Icon
Background image of page 16
Background image of page 17

Info iconThis preview has intentionally blurred sections. Sign up to view the full version.

View Full DocumentRight Arrow Icon
Background image of page 18
Background image of page 19

Info iconThis preview has intentionally blurred sections. Sign up to view the full version.

View Full DocumentRight Arrow Icon
Background image of page 20
Background image of page 21

Info iconThis preview has intentionally blurred sections. Sign up to view the full version.

View Full DocumentRight Arrow Icon
Background image of page 22
Background image of page 23

Info iconThis preview has intentionally blurred sections. Sign up to view the full version.

View Full DocumentRight Arrow Icon
Background image of page 24
Background image of page 25

Info iconThis preview has intentionally blurred sections. Sign up to view the full version.

View Full DocumentRight Arrow Icon
Background image of page 26
Background image of page 27

Info iconThis preview has intentionally blurred sections. Sign up to view the full version.

View Full DocumentRight Arrow Icon
Background image of page 28
Background image of page 29

Info iconThis preview has intentionally blurred sections. Sign up to view the full version.

View Full DocumentRight Arrow Icon
Background image of page 30
This is the end of the preview. Sign up to access the rest of the document.

Unformatted text preview: Fig. 3-32 Lehn Fig. 3-33 Lehn Lehn. Fig. 3-16 Lehn 3-14 B and T Fig. 1-5 Fig. 4-2 Lehn B and T Fig. 1-7 Fig. 4-3 Lehn Lehn 3-14 Lehn. Fig. 2-3 Fig. 4-2 Lehn B and T Fig. 2-2 Fig. 4-4 Lehn Fig. 4-4 Lehn Box 4-1 Lehn B and T Fig. 2-2 Fig. 4-5 Lehn Fig. 4-2 Lehn Fig. 4-6 Lehn Alpha helix stability affected by: Electrostatic repulsion or attraction between charged side chains Repulsion between bulky side chains Interactions between residues 3 - 4 apart Whether or not pro/gly present Amino acids at ends interacting with inherent dipole of helix B and T Fig. 2-4 Fig. 4-7 Lehn Fig. 4-7 Lehn Fig. 4-8 Lehn Fig. 4-16 Lehn...
View Full Document

Page1 / 39

Lect2primaryandsecondarystr - Fig. 3-32 Lehn Fig. 3-33 Lehn...

This preview shows document pages 1 - 39. Sign up to view the full document.

View Full Document Right Arrow Icon
Ask a homework question - tutors are online