Lec4-SequenceSimilaritySearches

Lec4-SequenceSimilaritySearches - Sequence Similarity...

Info iconThis preview shows pages 1–8. Sign up to view the full content.

View Full Document Right Arrow Icon
Sequence Similarity Searches Subtitle
Background image of page 1

Info iconThis preview has intentionally blurred sections. Sign up to view the full version.

View Full DocumentRight Arrow Icon
Three key questions Query? Purpose? Database?
Background image of page 2
BLAST
Background image of page 3

Info iconThis preview has intentionally blurred sections. Sign up to view the full version.

View Full DocumentRight Arrow Icon
>gi|77630012|ref|ZP_00792598.1| COG0442: Prolyl-tRNA synthetase [Yersinia pseudotuberculosis IP 31758] Length=572 Score = 1013 bits (2619), Expect = 0.0, Method: Composition-based stats. Identities = 498/572 (87%), Positives = 537/572 (93%), Gaps = 0/572 (0%) Query 1 MRTSQYMLSTLKETPADAEVISHQLMLRAGMIRKLASGLYTWLPTGLRVLRKVENIVREE 60 MRTSQY+LST KETPADAEVISHQLMLRAGMIRKLASGLYTWLPTG+RVL+KVENIVREE Sbjct 1 MRTSQYLLSTQKETPADAEVISHQLMLRAGMIRKLASGLYTWLPTGVRVLKKVENIVREE 60 Query 61 MNNAGAIEVSMPVVQPADLWVESGRWDQYGPELLRFVDRGERPFVLGPTHEEVITDLIRN 120 MNNAGAIEVSMPVVQPADLW ESGRW+QYGPELLRFVDRGERPFVLGPTHEEVITDLIR Sbjct 61 MNNAGAIEVSMPVVQPADLWQESGRWEQYGPELLRFVDRGERPFVLGPTHEEVITDLIRG 120 Query 121 EVSSYKQLPLNFFQIQTKFRDEVRPRFGVMRSREFLMKDAYSFHTSQESLQATYDTMYAA 180 E++SYKQLPLNFFQIQTKFRDEVRPRFGVMR+REFLMKDAYSFHT+QESLQ TYD MY A Sbjct 121 EINSYKQLPLNFFQIQTKFRDEVRPRFGVMRAREFLMKDAYSFHTTQESLQETYDAMYTA 180 …………………………. Query 481 MNMHKSFRVKEVAEDIYQQLRAKGIEVLLDDRKERPGVMFADMELIGVPHTIVIGDRNLD 540 MNMHKSFRVKE+AE++Y LR+ GI+V+LDDRKERPGVMFADMELIGVPH IVIGDRNLD Sbjct 481 MNMHKSFRVKELAEELYTTLRSHGIDVILDDRKERPGVMFADMELIGVPHNIVIGDRNLD 540 Query 541 SEEIEYKNRRVGEKQMIKTSEIIDFLLANIIR 572 SEE+EYKNRRVGEKQMIKTSEI++FLL+ I R Sbjct 541 SEEVEYKNRRVGEKQMIKTSEIVEFLLSQIKR 572
Background image of page 4
Background image of page 5

Info iconThis preview has intentionally blurred sections. Sign up to view the full version.

View Full DocumentRight Arrow Icon
Background image of page 6
Global Alignment vs. Local Alignment Global Methods find the best alignment of both sequences in their entirety Local Methods find the best alignable subsections of both sequences
Background image of page 7

Info iconThis preview has intentionally blurred sections. Sign up to view the full version.

View Full DocumentRight Arrow Icon
Image of page 8
This is the end of the preview. Sign up to access the rest of the document.

Page1 / 30

Lec4-SequenceSimilaritySearches - Sequence Similarity...

This preview shows document pages 1 - 8. Sign up to view the full document.

View Full Document Right Arrow Icon
Ask a homework question - tutors are online