Final S109

Final S109 -...

Info iconThis preview shows page 1. Sign up to view the full content.

View Full Document Right Arrow Icon
This is the end of the preview. Sign up to access the rest of the document.

Unformatted text preview: NAME:_________________________________________________ BILD 3 Summer Session 1 2009 Dr. Reuther Final Exam (245 points) NAME: _______________________________________________ PID: __________________________________________________ Section/TA: _________________________________________ Directions: There are 23 pages in this exam, including this cover sheet. Please put your name on each page. Only exams written in ink will be accepted for regrades. You can use the space below the line on this page as scratch paper. There are 105 questions. Please be sure your exam is complete. Write your name at the top of each page. Read each question carefully and choose the best answer. Think before you write and confine your answer to the space provided. We will collect exams promptly at 2:30pm. MAKE SHORT ANSWER RESPONSES BRIEF 1-3 SENTENCES Do not write in the space below. Pg.1 _________________8 2 3 4 5 6 7 _________________9 _________________10 _________________11 _________________12 _________________13 _________________14 _________________15 _________________16 _________________17 _________________18 _________________19 _________________20 _________________21 _________________22_________________ _________________23_________________ _________________Total______________ _________________ _________________ _________________ _________________ ___________/_____________ 1 NAME:_________________________________________________ 1.2pts.Studentsplacedfivepillbugsonthedrysideofachoicechamberandfive pillbugsonthewetside.Theycollecteddataastothenumberoneachsideevery30 secondsfor10minutes.After6minutes,eightorninepillbugswerecontinuallyon thewetsideofthechamber,andseveralwereunderthewetfilterpaper.Whichof thefollowingisNOTareasonableconclusionfromtheseresults? a. Ittakesthepillbugsseveralminutestoexploretheirsurroundingsandselect apreferredhabitat. b. Pillbugspreferamoistenvironment. c. Pillbugspreferadarkenvironment. d. Pillbugsmayfindchemicalsindryfilterpaperirritating. e. Pillbugsdemonstratenosignificanthabitatpreference. 2.2pts.WhichofthefollowingisNOTaconditionthatmustbemetforHardy Weinbergequilibrium? a. b. c. d. e. Largepopulationsize Nomutations Noimmigrationoremigration Dominantallelesmorefrequentthanrecessivealleles Nonaturalselection 3.2pts.InapopulationthatisinHardyWeinbergequilibrium,thefrequencyofthe homozygousrecessivegenotypeis0.09.Whatisthefrequencyofindividualsthat arehomozygousforthedominantallele? 4.2pts.Youwakeupinacountrywherethesunshinesabout12hoursadayall year,precipitationvariationishigh,andtemperaturevariationisverylow.Bythe way,youarealsoscubadivinginalakeandcannotseeathing.Whereareyou? a. Artictundraphoticzone b. Artictundraaphoticzone c. Temperategrasslandaphoticzone d. Tropicalwetforestaphoticzone 5.2pts.YouareinchargeofsavingthefishofLakeWashingtonin1960andhave infiniteresources.Whichofthefollowingactionswillhavesmallesteffecton reducingfishdeath? a. Reducingsewageflow b. Increasingdissolvedoxygen c. Increasingdissolvednitrogen d. Reducingalgalpopulations ___________/_____________ 2 NAME:_________________________________________________ 6.2pts.Whichtypeofrelationshipwouldmostlikelydecreasethesizeofan organism'srealizedniche? a. mutualistic b. commensal c. competitive d. rockyandunsupportive 7.2pts.Speciesthatareharmless,butresembleapoisonousspeciesareMullerian/ Batesian(circleone)mimics. 8.2pts.Specieswithhighlevelsofparentalcaremostlikelydisplaywhichtypeof survivorshipcurve? a. TypeI b. TypeII c. TypeIII d. TypeIV 9.2pts.Whichofthefollowingisthebestexampleofacognitivebehavior? a. Apenguinchickpickingitsmotheroutofacrowdofstrangers. b. Aworkerbeedescribingthelocationofafoodsourceusingacomplexdance. c. Acrowcreatingawiretooltoaccessafooditem. d. Afemaledecidingwhichmaletomatewithoutofacrowdofpotentialmates. 10.2pts.Apopulationisexperiencingexponentialgrowth,thegrowthrate(r)is 0.01andtheinitialpopulationsizeis10.Howlongdoesittakethepopulationto doubleinsize(ln2=0.69). a. 6.9 b. 20 c. 10 d. 69 11.2pts.Whichofthefollowingstatementsiscorrect? a. Anicheistheroleaspeciesplaysintheenvironmentandisusually measuredbymeasuringpopulationgrowth. b. Largerareashavefewerhabitatsthansmallerareas. c. Ahabitatiswhereaspecieslivesbutanichedescribestheenvironmental requirementsforgrowthandsurvivalofaspecies. d. Anicheistheaddressofaspecieswhileahabitatistheroleaspeciesplaysin thecommunity. ___________/_____________ 3 NAME:_________________________________________________ 12.3pts.Whichofthefollowingstatementsiscorrect? a. Anareawithmorediversehabitatswillsupportmorespeciesthananarea withfewhabitats b. Smallerislandssupportmorespeciesthandolargerislands c. Speciesrichnessmeasurestherelativeabundanceofeachspecies d. Speciesdiversitymeasuresonlythenumberofspecies 13.2pts.Youaredesigninganexperimentonthegreenhouseeffectandareusing dryiceasyourinputofcarbondioxide.Youalsowanttoincludeavariablethat wouldremovesomeofthecarbondioxidefromyoursystem.Whichofthefollowing couldyouusetodothis? a. amixtureofbakingsodaandvinegar b. amouserunningonawheel c. agreenplant d. adishofwater 14.2pts.Astheglobalclimatechanges,thedistributionofspeciesisalsochanging. Whichofthefollowingfactorswouldyoupredictwouldbethemainfactors affectingchangesinterrestrialspeciesdistributionandabundance? a. nitrogenandphosphorus b. carbonandnitrogen c. precipitationandtemperature d. depthofwaterandintensityoflight 15)2pts.EarthissometimesreferredtoastheGoldilocksplanetbecauseofits optimaltemperaturerangeforlivingorganisms.MarsandVenusareatopposite extremesofEarthinthisregard.MarsisfartoocoldforlifetoexistwhileVenusis fartoohot.Usingwhatyouknowaboutthegreenhouseeffect,whichofthe followingstatementsiscorrect? a. ThereisnodifferenceintheamountofgreenhousegasesonMarsandVenus. b. MarshasathinatmospherecomparedtoEarthwhileVenushasathick atmosphere. c. Thereisnodifferenceintheamountofatmospheregreenhousegaseson Mars,VenusandEarth. d. MarshasaverythickatmospherecomparedtoEarthwhileVenushasavery thinatmosphere. ___________/_____________ 4 NAME:_________________________________________________ 16.2pts.Bluefintunaareindeclinebecause a. theirpopulationsdeclinedduetooverexploitation b. exoticdiseasesdramaticallyreducedtheirpopulationsize c. humansunintentionallymovedthemtonewlocations d. theyareasourceofpharmaceuticals 17.2pts.Whichofthefollowingstatementsiscorrect? a. theaphoticzonegetslotsofsunlight b. thelimneticzoneistheopenwaterwithenoughlightforphotosynthesis c. thelittoralzoneistheopenwaterwithenoughlightforphotosynthesis d. thebenthiczoneistheseashore 18.2pts.Ifyouobserveantagonisticinteractionsbetweenindividualsofthesame populationyouwouldexpectthedispersionofindividualstobe a. clumped b. totallychaotic c. random d. uniform 19.2pts.Netprimaryproductivityis a. theamountofchemicalenergyusedinecosystems b. highestinthewettropicsamongterrestrialbiomes c. theamountofenergyinvestedinnewanimaltissueduringaspecifictime period d. lowestinaquaticecosystemsnearcoastalareas 20.2pts.Whichofthefollowingstatementsbestdescribestheharelynxpopulation cycle? a. Thepopulationgrowthofharesislimitedbypredation. b. Thepopulationgrowthofharesislimitedbyfoodavailability. c. Theeffectofremovingpredatorsandincreasingfoodavailabilityforhares resultsinamuch,muchlargerpopulationthanjustremovingpredationor addingfood. d. Alloftheabove ___________/_____________ 5 NAME:_________________________________________________ 21.2pts.Whichofthefollowinglistscontainsonlyabioticfactors? a. competition,mutualism,temperature,predation b. heat,wind,humidity,competition c. predation,competition,parasitism,mutualism d. sunlight,temperature,moisture,watercurrents 22.2pts.Youobservetwospeciesofsparrows(smallbirdsthateatseeds)inBalboa Park.Asyouobservethemforashortwhile,theybothappeartobeeatingonly sunflowerseeds,whichisalimitedresource.Whichofthefollowingstatementsbest describesthefeedingbehaviorofthesetwosparrowspecies? a. Bothspecieswillnotbeabletoremaininthesameplaceiftheybothonlyeat sunflowerseeds. b. Bothspeciesmustbecloselyrelatedandsosharethesamefeeding preferencesforsunflowerseeds c. Theymusthaveidenticalniches d. Sincetheyarebotheatingsunflowerseedstheremustbeamutualistic relationship. 23.2pts.Ifthebiomethathasahighaveragetemperature(withverylowvariation intemperature)andveryhighannualprecipitation(andhighvariationin precipitation)experiencedacoolingof5degreescelsiuswhatwouldyoupredict wouldoccur? a. Thisisasubtropicaldesertandthiswouldaffectdesertadaptedplantsthat areadaptedtowarmertemperatures. b. Thisisthelittoralzoneandthedecreaseintemperaturewouldresultincoral bleaching. c. Thisisatropicalwetforestandthiswouldresultinadecreaseinnetprimary productivity. d. Thisisatemperategrasslandandthiswouldincreasethenetprimary productivityofthisbiome. ___________/_____________ 6 NAME:_________________________________________________ 24.3pts.OneofDr.Snufaluphugus'sresearchprojectsexaminestheeffectofcattle grazingonannualplantspeciesdiversity.Heexaminedhowcattlegrazingaffects totalplantabundanceandspeciesdiversity.Hefoundthatprotectionfromcattle grazingfortwoyearsdidnotaffectplantspeciesdiversityorabundance. Whichecologicallevelofinquirybestdescribesthisresearch? a. populationecology b. organismalbiology c. ecosystemecology d. communityecology 25.2pts.WhichofthefollowingisNOTanexampleofanecosystemservice? a. bacteriadetoxifywater b. beespollinateappletrees c. fungiconvertinorganicmaterialintosoil d. treesshadehouses e. humansconvertforestsintopastureland 26.2pts.WhichofthefollowingdoesNOTcontributetothedeadzoneintheGulfof Mexico? a. thenitrogenandphosphorusthatalgaerequireastheygrowrapidly b. adroughtthroughouttheMidwestthatdrasticallydecreasesdrainagefrom theMississippiRiver c. oxygendeprivedsaltwater d. thesunheatingthefreshwaterrunofffromtheMississippiRiver 27.2pts.Inregardstopopulationgrowth,whenB=Dthen a. apopulationisatcarryingcapacity b. resourcesareabundant c. thisisrthepopulationgrowthrate d. thefastestrateofpopulationgrowthisoccurring 28.2pts.HousesparrowsarenativetoEuropeandAsiabutcanbefoundinSt. Louis.Thus,thehousesparrowsinSt.Louisareanexampleof a. anexoticspecies b. ahistoricspecies c. akeystonespecies d. athreatenedspecies e. anextinctspecies ___________/_____________ 7 NAME:_________________________________________________ 29.2pts.Whichspeciesinteractionhasnegativeconsequencesforbothspecies? a. parasitism b. predation c. competition d. mutualism 30.3pts.Inregardstopopulationgrowth,whenN=Kthen a. dN/dtislessthanzero b. dN/dtgreaterthanzero c. dN/dt=0 d. dN/dtislarge 31.2pts.Youaretryingtoidentifyanorganism.Itisananimalbutitcontainsno truetissues.Itisnotdiploblastic.Itmustbea a. sponge(Porifera) b. flatworm c. combjelly(Ctenophora) d. nematode 32.2pts.ThecharacteristicofCnidariansthatdistinguishesthemfromotheranimal phylais a. radialsymmetry b. truetissues c. presenceofabodycavity d. threegermlayers 33.2pts.Anarthropodhasallofthefollowingcharacteristicsexcept a. apseudocoelom b. bilateralsymmetry c. protostomedevelopment d. threeembryonicgermlayers 34.2pts.Whichofthefollowingisnotoneofthefourmostdiverseordersof insects? a. Hymenoptera b. Diptera c. Coleoptera d. Dermaptera ___________/_____________ 8 NAME:_________________________________________________ 35.2pts.IamaDeuterostomewithradialsymmetry.InwhichphylumdoIbelong? a. Chordata b. Echinodermata c. Cnidaria d. Ctenophora 36.2pts.WhichofthefollowingisNOTatraitthatexistswithinLophototrochozoa a. Acoelomy b. Pseudocoelomy c. Molting d. Trochophorelarvae 37.3pts.Onwhatcontinentdidthemostrecentcommonancestorofmodern humanslive? 38.2pts.WhichofthefollowingstatementsMOSTaccuratelydescribesFungi? a. Fungiareheterotrophs b. Yeastsaremulticellularfungi c. Fungiarepolyphyletic d. Fungalmyceliaarealwaysheterokaryotic 39.2pts.Chemicalsthataresecretedbysoilfungithatinhibitthegrowthofbacteria areknownas a. Antibiotics b. Antibodies c. Hallucinogens d. Aflatoxins 40.2pts.Thefollowingconditionsareallcausedbyafungusexcept a. Theplague b. Athlete'sfoot c. Ergotism d. Ringworm ___________/_____________ 9 NAME:_________________________________________________ 41.2pts.Archegonia a. Protectmalegametes b. Arefoundinthegametophytesofbothmosesandferns. c. Helptodispersethespores d. Areasexualreproductivestructures 42.2pts.Thetransitionofgreenplantsfromaquaticenvironmentstoterrestrial (land)environmentswasaccompaniedbytheevolutionofseveralcriticaladaptions. Whichofthefollowingfeaturesdidnotevolveinthelandplants? a. Cuticle b. Stomata c. Vasculartissue d. Flagellatedsperm 43.2pts.Whichofthefollowingchangesinlifecycleoccurredduringtheevolution ofthelandplants? a. Shiftindominancefromsporophytetogametophytegeneration b. Shiftfromanindependentsporophytetoadependentsporophyte c. Extremereductionofthegametophyte d. Shiftfromfertilizationthatdidn'trequirewatertofertilizationthatrequires water 44.2pts.Withingymnosperms,the_____________________aremostmorphologically similartoangiospermsbecausethisphylumhas_____________________and _____________________. a. Gnetophytes;vesselsandflowerlikereproductivestuctures b. Gnetophytes;tracheidsandleafygametophytes c. Conifers;separatemaleandfemaleconesandneedles d. Gingkos;deciduousleaveswithdichotomousvenationandtheyaredioecious 45.3pts.Protistsareconsidered___________________becausetheprotistlineage includes_____________________,whicharenotprotists. a. paraphyletic;animals,plants,andfungi b. polyphyletic;animals,plants,andfungi c. monophyletic;animals,plants,andfungi d. paraphyletic;animalsandparamecium ___________/_____________ 10 NAME:_________________________________________________ 46.3pts.Whichofthefollowingdescribesthealternationofgenerationslifecycle? a. Diploidsporophytedividesbymeiosistoformhaploidspores b. Haploidsporesdividebymitosistoformhaploidgametophytes;haploid gametophytesdividebymitosisyieldinghaploidgametes c. Haploidgametesfusethroughsyngamytoformadiploidzygote,which dividesbymitosistoformasporophyte d. Alloftheabove 47.4pts.Foreachofthestatementsbelow,choosewhichtypeofselectionitis characterizedby: A.Kselection B.rselection a. Densitydependentselection,actsonorganismsthatareusually regulatedbydensitydependentfactors________________ b. Lowearlysurvivorshipbuthighsurvivorshipafterreaching maturity_____________ c. Feweroffspring,characterizedbyhighparentalcare_________________ d. Densityindependentselection,actsonorganismsthatareoften subjecttodensityindependentpopulationregulation_____________ 48a.2pts.Describethecontrastingviewsoftheintegratedhypothesisandthe individualistichypothesisoncommunitystructure. 48b.1pt.Whichscientistsareassociatedwitheachofthesehypotheses? ___________/_____________ 11 NAME:_________________________________________________ 49.3pts.Theentirerangeofconditionsthatanorganismcanpotentiallysurvive andreproduceiniscalledthe____________________niche.Theconditionsanorganism actuallylivesiniscalledthe__________________________niche. 50.4pts.DescribetheCompetitiveExclusionPrinciple.Howdospeciesinnature overcomethisinordertocoexist? 51.3pts.Nameanddescribethreedefensemechanismsdiscussedinclassthatprey animalsutilizetoavoidpredation. 52.2pts.____________________________isatypeofparasitethatlivesonorwithinahost andkillsitintheprocess. 53.3pts.Definetheterm"ecosystemservice"andgiveoneexample. ___________/_____________ 12 NAME:_________________________________________________ 54.3pts.Theraresttypeofmutualisticinteractioniscalled____________________it describeswhenonespeciesbenefitsandtheotherspeciesisnotaffected.Giveone examplementionedinclassofthistypeofinterspecificrelationship. 55.3pts.Whyarefoodchainsusuallyonlyafewtrophiclinkslong? 56.3pts.The___________________________modelofcommunityorganizationproposes thatthecontrolcomesfromthetrophiclevelsabove,whereasthe __________________________modelofcommunityorganizationproposesaunidirectional influencefromlowertohighertrophiclevels. 57.2pts.Afterafloodorfire,themosttypicaltypeofsuccessionis a.primarysuccession b.treesuccession c.secondarysuccession d.grass/shrubsuccession 58.2pts.Afteravolcaniceruptionortherecessionofaglacier,themosttypicaltype ofsuccessionis: a.primarysuccession b.treesuccession c.secondarysuccession d.grass/shrubsuccession ___________/_____________ 13 NAME:_________________________________________________ 59.3pts.Ecosystemsarenotcompletelyisolated,butarerelativelyindependent fromotherecosystemsandaregenerallyselfcontainedunitsmuchlikea population.InEcosystemEcology,twoprimaryconceptsstate: ___________________________________flowsthroughanecosystem. ___________________________________cyclewithinanecosystem. 60.3pts.WhatisthedifferencebetweenGPPandNPPandwhatunitsarethey measuredin? 61.2pts.Trophicefficiencyisgenerally: a. 515% b. 03% c. 1525% d. 2550% 62.4pts.Namethebiomesthatcorrelatewith: LowestterrestrialNPP: HighestmarineNPP: LowestmarineNPP: SanDiego(terrestrial): _____________________________________ _____________________________________ _____________________________________ _____________________________________ ___________/_____________ 14 NAME:_________________________________________________ 63.2pts.Itisadaptivetoselfsacrificeanddieinordertosavethreefullsiblingsso thattheywillsurviveandreproduce.TRUE/FALSE 64.3pts.Whatisthemostimportantfactorlimitingprimaryproductioninaquatic environments? 65.4pts.Circleallcorrectanswers.Atmosphericnitrogenis(N2,NO3,NH4) Whatformsofnitrogencanbeusedbyplants?(N2,NO3,NH4).Theseprocesses fixnitrogenforusebyplants:(lightning,bacteria,earthquakes). 66.4pts.DescribetheprocessofeutrophicationinLakeWashingtoninthe1960s anditseffectonfishes. 67.4pts.List2piecesofevidenceforthephenomenonofglobalwarming. 68.3pts.Whatarethethreelevelsofbiodiversity? ___________/_____________ 15 NAME:_________________________________________________ 69.2pts.Gilamonstersalivawasfoundtohaveacompoundthathadadirecteffect onwhatcommondisease? 70.4pts.DescribetheecologicaldestructionthatoccurredonEasterIslandandhow thisledtothedeclineoftheindigenouspopulation? 71.3pts.Whatisthenumberonecauseofspeciesextinctionsworldwide? 72.3pts.Whyaresmallpopulationsmorelikelytogoextinctthanlarge populations? 73.2pts.Invasivespeciescanpotentiallyhybridizewithnativespecies, TRUE/FALSE 74.2pts.Pathogensandparasitesaregenerallynotconsidered"invasivespecies" TRUE/FALSE 75.2pts.Allexoticspeciescausesignificantharmwithinnativecommunities. TRUE/FALSE ___________/_____________ 16 NAME:_________________________________________________ 76.4pts.Batsfly.ListoneproximateandoneultimatequestionanAnimal Behavioristmightaskaboutthisphenomenon. 77.2pts.Areductioninresponsebyindividualsinagroupafterrepeatedfalse alarmcallsisanexampleofwhichtypeofbehavior. a. innate b. classicalconditioning c. habituation d. habitatselection 78.3pts.Describethecognitiveabilitiesofcrows. 79.3pts.Definephilopatry. ___________/_____________ 17 NAME:_________________________________________________ 80.3pts.Forwhichrelativelevelsoffoodabundanceisterritorialityadaptive.Show youransweronthegraphbelow. 81.4pts.Describeinsituandexsituconservationtechniquesandgiveanexample ofeach. 82.2pts.Evolvedbehaviorwithinlimitstendsto[minimize/maximize]an individual'sreproductivefitness. ___________/_____________ 18 NAME:_________________________________________________ 83.3pts.Whichofthefollowingisacharacteristicoffixedactionpatterns(FAPs)? Circleeachcorrectanswerforeachofthethreefollowingsetsofstatements. a. Novariationinperformance/variationsinbehaviordependingon context(Circleone) b. Speciesspecific/DifferentspeciesexhibitthesameFAPs(Circleone) c. Oncethesequenceofactionbegins,itcontinuesuntilcompletion/The sequenceendsoncetheinitialstimulusisremoved(Circleone) 84.4pts.Matcheachdescriptionwiththetypeoflearningassociatedwithit: A.OperantConditioning B.Classicalconditioning C.Imprinting D.Habituation E.Associativelearning F.Cognitivemapping G.Culture H.SocialLearning a. Generallyirreversible,distinguishedfromothertypesoflearningbya sensitiveperiodduringanearlydevelopmentalphase._____________ b. Internalrepresentationofspatialrelationshipsbetweenobjectsinan animal'ssurroundings(ex.Clark'sNutcrackers)._____________ c. Associativelearningwhereananimalslearnstoassociateoneofits behaviorstoarewardorpunishment._____________ d. ____________islearningthroughtheobservationofothersandformstherootsof culture 85.4pts.Whatisonebenefitofdispersalmentionedinclass?Whatisapotential costofdispersalmentionedinclass? ___________/_____________ 19 NAME:_________________________________________________ 86.2pts.Territorialaggressionbetweenindividualsmostcommonlyescalatesto injuryinordeath,particularlyifoneindividualismuchlargerthantheother. TRUE/FALSE 87.2pts.Sexualdimorphismisthedifferencebetweensexes,includingtraits directlyrequiredforreproduction(penises,vaginas,etc)TRUE/FALSE 88.3pts.Whichofthefourtreesabovedepictsadifferentpatternofrelationships thantheotherthree?Circlethecorrectanswer. 89.3pts.DescribetheOparineHaldanehypothesisfortheformationofearly biochemicalsandtheMillerUreyexperiment. ___________/_____________ 20 NAME:_________________________________________________ 90.3pts.Namethreeevolutionarymilestonesthatoccurredduringthe Precambrian. 91.2pts.TheKTboundaryandextinctioneventoccurred: a. 250MYA b. 100MYA c. 65MYA d. 30MYA 92.2pts.AllChordateshavevertebrae.TRUE/FALSE 93.2pts.Whichofthefollowingisnotanoddtoedungulate. a. Horse b. Zebra c. Rhinoceros d. Deer 94.3pts.Rankthefollowingtermsfromthemodeofspeciationthatinvolvesthe greatestgeographicisolationtotheleastgeographicisolation:Allopatric, sympatric,parapatric. 95.3pts.Listtwolimitationsofthephylogeneticspeciesconcept. ___________/_____________ 21 NAME:_________________________________________________ 96.4pts.Listthetaxonomicclassificationcategoriesinorderfrombroadestto narrowestinthespacebelow. Domain,____________________________,phylum,_______________________________, ____________________________,family,____________________________,species 97.2pts.Inthephylogenyabove,fishareaparaphyletic, polyphyletic,ormonophyleticgroup(Circleoneanswer). 98.2pts.Inthephylogenyabove,sharksshareamorerecentcommonancestorwith sturgeonthansturgeonssharewithamphibians.TRUE/FALSE 99.3pts.Whyaresomecavefishblindandwhatisthetermfortheeyepartsthat remaininthesecavefish(hint=sametermusedforgoosebumpsandwhale pelvis)? 100.3pts.Compareandcontrastsynapomorphyandplesiomorphy. ___________/_____________ 22 NAME:_________________________________________________ 101.3pts.Describewhyblendinginheritancecannotleadtoadaptation. 102.3pts.Ingeneral,femalesarechoosyandmalesarepromiscuous.Whatisthe relationshipbetweenthisstatementandparentalinvestment. 103.3pts.Geneflowtendstoincrease/decrease(Circleone)genetic differencesbetweenpopulations. 104.2pts.Whichofthefollowingisnotanormalcomponentofaflower: a. Stamen b. Carpel c. Beltianbody d. Petals e. Sepals 105.Makesureyoufilloutthecourseevaluationthatisemailedtoyou.It'sbeena pleasureteachingyouandenjoytherestofyoursummer. ___________/_____________ 23 ...
View Full Document

This note was uploaded on 09/17/2009 for the course BILD BILD 3 taught by Professor Woodruff during the Spring '08 term at UCSD.

Ask a homework question - tutors are online