Lect4 - ACQDFSVTDCKQSATYVPFLGKRAVKQDHHWREG...

Info iconThis preview shows pages 1–21. Sign up to view the full content.

View Full Document Right Arrow Icon
Lehn. Fig. 3-16
Background image of page 1

Info iconThis preview has intentionally blurred sections. Sign up to view the full version.

View Full DocumentRight Arrow Icon
Background image of page 2
Background image of page 3

Info iconThis preview has intentionally blurred sections. Sign up to view the full version.

View Full DocumentRight Arrow Icon
Background image of page 4
Background image of page 5

Info iconThis preview has intentionally blurred sections. Sign up to view the full version.

View Full DocumentRight Arrow Icon
Background image of page 6
Background image of page 7

Info iconThis preview has intentionally blurred sections. Sign up to view the full version.

View Full DocumentRight Arrow Icon
Background image of page 8
Background image of page 9

Info iconThis preview has intentionally blurred sections. Sign up to view the full version.

View Full DocumentRight Arrow Icon
Background image of page 10
Background image of page 11

Info iconThis preview has intentionally blurred sections. Sign up to view the full version.

View Full DocumentRight Arrow Icon
Background image of page 12
Background image of page 13

Info iconThis preview has intentionally blurred sections. Sign up to view the full version.

View Full DocumentRight Arrow Icon
Lehn Fig. 12-24
Background image of page 14
Background image of page 15

Info iconThis preview has intentionally blurred sections. Sign up to view the full version.

View Full DocumentRight Arrow Icon
Background image of page 16
Fig. 18-11 B and T
Background image of page 17

Info iconThis preview has intentionally blurred sections. Sign up to view the full version.

View Full DocumentRight Arrow Icon
Background image of page 18
Background image of page 19

Info iconThis preview has intentionally blurred sections. Sign up to view the full version.

View Full DocumentRight Arrow Icon
>gi|156365516|ref|XP_001626691.1| predicted protein [Nematostella vectensis] MSFSYYTNTSSQSLARPLSAPILDEAFQAHGQSG HRFVRKTFTRPTYCHHCTDMLWGFTNQGFMCDVC NFVTHDRCMIFVTIPCVSIATTLVKIPVAHTWSG LSFSFRKKFCSVCRRRLEDIPAFRCQVCDYYVHE
Background image of page 20
Background image of page 21
This is the end of the preview. Sign up to access the rest of the document.

Unformatted text preview: ACQDFSVTDCKQSATYVPFLGKRAVKQDHHWREG NFSASSKCVSCKHSCGSGECLASLKCSWCAQSSH TNCSQLLPKECHYGYLHRVSLPPFCVSFPDKTPK PRHFHTFSERGVQKGFSRFYRMKKIKVYDGNLTS PRASKSVTVPRNAKISKVLDETLKSFHINDDPDN YYLAKAVDERKPLDPEEIPVQFPEKESKPLIFLR IKSADKRKGYIRIYAGTEIDVPVLFKTLPVIAST...
View Full Document

This note was uploaded on 10/05/2009 for the course BIBC 100 taught by Professor Nehring during the Winter '07 term at UCSD.

Page1 / 21

Lect4 - ACQDFSVTDCKQSATYVPFLGKRAVKQDHHWREG...

This preview shows document pages 1 - 21. Sign up to view the full document.

View Full Document Right Arrow Icon
Ask a homework question - tutors are online