BI379_F09_Exercise_1

BI379_F09_Exercise_1 - BI 379 Assignments for next week 1....

Info iconThis preview shows pages 1–2. Sign up to view the full content.

View Full Document Right Arrow Icon
BI 379 Assignments for next week 1. Read the part of section 2.2 that concerns malaria. This starts on p 74 ("what kind of organism causes malaria") and runs through p. 78. If you do the Discovery questions, be forewarned that the layout of the KEGG pathway has been changed and you'll have to hunt for what you want. 2. Read the paper I have put on Moodle (Carvalho 2005 – in the Literature folder). It will be difficult, so just get the gist of what they're saying. On Tuesday, we'll briefly discuss it and I'll hand out some questions on the paper to help guide you in understanding it. The questions will be due on Thursday. 3. Read my handout on BLAST searches and Math Minute 1.1 (page 7). Do the following exercise. BI379 F09 Exercise 1 Due Tuesday, Sep 22 A: Do the following exercise. 1. Open BLASTp in a browser window. Paste the sequence below in the Enter Query box and search the nr database (the default database) NTYACNFDGNDCSLGINPWANCTANECWNKFKNGKCNEECNNAACHYDGHDCERKLKSCD 2. Open up a fresh word document, turn the document horizontally (this will help with viewing on
Background image of page 1

Info iconThis preview has intentionally blurred sections. Sign up to view the full version.

View Full DocumentRight Arrow Icon
Image of page 2
This is the end of the preview. Sign up to access the rest of the document.

This note was uploaded on 11/25/2009 for the course BI 379 taught by Professor Kavaler during the Spring '09 term at Colby.

Page1 / 2

BI379_F09_Exercise_1 - BI 379 Assignments for next week 1....

This preview shows document pages 1 - 2. Sign up to view the full document.

View Full Document Right Arrow Icon
Ask a homework question - tutors are online