protein-arginine_deiminase_type-6_Canis_lupus_familiaris

protein-arginine_deiminase_type-6_Canis_lupus_familiaris -...

Info iconThis preview shows page 1. Sign up to view the full content.

View Full Document Right Arrow Icon
>gi|148225829|ref|NP_001091016.1| protein-arginine deiminase type-6 [Canis lupus familiaris] MSFQSIIHLSLDSPVRALCVLGMEICLDVNGCAPERCEAFTISSSPGVSVDLHGTLPGTGQEGTAVTRWP LSNPTDVLVKMTCPSSASDGDQVLVSYYLPNEDAPVATAVLRLTGIVVSLDVDIYRSGQVEIASDKQAKK NWVWGPSGWGAILLVNCSPADKGQIIDQKTTKVFFPEEIKSLSQMTLNVTRARRHLKKYRLVLHTSEEEA RKARVYRPQRDSSSTFEVLLGPGQCTYTFAPLENNLKETFYVEAIEFPSADFSGLISYSVSLVEEPQDPS IPETLVYKDTVVFRVAPCVFIPSTQMPLEVYLCRELQVQGFVNTVMELSEKSNSQVASVYEDPNRLGRWL
Background image of page 1
This is the end of the preview. Sign up to access the rest of the document.

Unformatted text preview: QDEMAFCYTQAPHRTLSLVLDTPRVLTLEDFPMKYSLSPGVGYVIQCTKDHRVASMDSIGNLMVSPPVKV EGKEYPLGRILIGSCFYPSKEGRDMSKALRDFLYAQRVQAPVELFSDWLMVGHMDEFMCFIPTPDKSEGE KGFRLLLASPSSCHRLFEEKQKEGYGDMALFEEVREDQLLSNGRQANTINQLLADKNMRKQNDYVEKCIN LNRDILKKELGLVERDIIDIPQLFCLEQLTNVPSSEQTGKFFARPYFPDLLQMIVMGKNLGIPKPFGPQI KGTCCLEEKICQLLEPLGFKCTFIDDFDCYLTEIGDFCACANIRRVPFAFKWWRMVPEPQA...
View Full Document

This note was uploaded on 07/29/2010 for the course BIOC BIOC2811 taught by Professor Dr.q.hao during the Summer '10 term at HKU.

Ask a homework question - tutors are online