W85UND90212-alignment

W85UND90212-alignmen - CLUSTAL W(1.83 multiple sequence alignment ref|NP_001091016.1|- gi|51248012 ref|NP_001091016.1|

Info iconThis preview shows pages 1–2. Sign up to view the full content.

View Full Document Right Arrow Icon
CLUSTAL W (1.83) multiple sequence alignment ref|NP_001091016.1| -------MSFQSIIHLSLDSPVRALCVLGMEICLDVNGCAPERCEAFTISSSPGVSVDLH gi|51248012 GPLGSPQMAQGTLIRVTPEQPTHAVCVLGTLTQLDICSSAPEDCTSFSINASPGVVVDIA * * * * **** ** *** * * * **** ** ref|NP_001091016.1| GTLPGTGQEGTAVTRWPLSNPTDVLVKMTCPSSASDGDQVLVSYYLPNEDAPVATAVLRL gi|51248012 HS-PPAKKKSTGSSTWPLDPGVEVTLTMKAASGSTGDQKVQISYYGP-- KTPPVKALLYL * * *** * * * * *** * * * * * ref|NP_001091016.1| TGIVVSLDVDIYRSGQVEIASDKQAKKNWVWGPSGWGAILLVNCSPAD- KGQIIDQKTTK gi|51248012 TAVEISLCADITRTGKVKPTRAVKDQRTWTWGPCGQGAILLVNCDRDNLESSAMDCEDDE * ** ** * * * * *** * ******** * ref|NP_001091016.1| VFFPEEIKSLSQMTLNVTRARRHLKKYRLVLHTSEEEARKARVYRPQR- DSSSTFEVLLG gi|51248012 VLDSEDLQDMSLMTLSTKTPKDFFTNHTLVLHVARSEMDKVRVFQATRGKLSSKCSVVLG * * * *** **** * * ** * ** * ** ref|NP_001091016.1| PGQCTYTFAPLENNLKETFYVEAIEFPSADFSGLISYSVSLVEEPQDPSIPETLVYKDTV gi|51248012 PKWPSHYLMVPGGKHNMDFYVEALAFPDTDFPGLITLTISLLDT- SNLELPEAVVFQDSV * ***** ** ** *** ** ** * * * ref|NP_001091016.1| VFRVAPCVFIPSTQMPLEVYLCRELQVQGFVNTVMELSEKSNSQVASVYEDPNRLGRWLQ
Background image of page 1

Info iconThis preview has intentionally blurred sections. Sign up to view the full version.

View Full DocumentRight Arrow Icon
Image of page 2
This is the end of the preview. Sign up to access the rest of the document.

This note was uploaded on 07/29/2010 for the course BIOC BIOC2811 taught by Professor Dr.q.hao during the Summer '10 term at HKU.

Page1 / 2

W85UND90212-alignmen - CLUSTAL W(1.83 multiple sequence alignment ref|NP_001091016.1|- gi|51248012 ref|NP_001091016.1|

This preview shows document pages 1 - 2. Sign up to view the full document.

View Full Document Right Arrow Icon
Ask a homework question - tutors are online