Lab7 Bioinformatics problem sets student_1

Lab7 Bioinformatics problem sets student_1 - File of...

Info iconThis preview shows pages 1–3. Sign up to view the full content.

View Full Document Right Arrow Icon

Info iconThis preview has intentionally blurred sections. Sign up to view the full version.

View Full DocumentRight Arrow Icon
This is the end of the preview. Sign up to access the rest of the document.

Unformatted text preview: File of protein sequences for Activity 3 Problem Set 1 Student Copy Only Protein sequence 1 >protein sequence1 315aa mdafkggmslerlpeglrpppppphdmgpsfhlaraadpreplensases sdadlpdkerggeakgpedggagsagcgggaedpakkkkqrrqrthftsq qlqeleatfqrnrypdmsmreeiavwtnlteprvrvwfknrrakwrkrer nqqldlckggyvpqfsglvqpyedvyaagysynnwaakslapaplstksf tffnsmsplssqsmfsapssissmtmpssmgpgavpgmpnsglnninnlt gsslnsamspgacpygtpaspysvyrdtcnsslaslrlkskqhssfgygg lqgpasglnacqyns Protein sequence 2 >protein sequence2 386aa mgypeverrellpaaaprergsqgcgcggaparagegnscllflgffgls lalhlltlccylelrselrrergaesrlggsgtpgtsgtlsslggldpds pitshlgqpspkqqplepgeaalhsdsqdghqmallnfffpdekpyseee srrvrrnkrsksnegadgpvknkkkgkkagppgpngppgppgppgpqgpp gipgipgipgttvmgppgppgppgpqgppglqgpsgaadkagtrenqpav vhlqgqgsaiqvknggvlndwsritmnpkvfklhprsgelevlvdgtyfi ysqvyyinftdfasyevvvdekpflqctrsietgktnyntcytagvcllk arqkiavkmvhadisinmskhttffgairlgeapas Protein sequence 3 >protein sequence3 300aa of the total length 670aa mssaaatstkeavqqlfnqftngcdsinckckwckscsnfpfkfnspnei askvldllkttpfaemvcpnlktespekvvdikaairssdkeqiqnafkr lfteveyfpylfasksqpirkgnyqfessdfksflaylshnlemiesfrn dyynlvekiiandsktytrirsiilafcfdnfllfhtenqisqkfffmid nlsdeevtvlidmfssippvllnslmvcqtiitvlshesfssnkyydfik yackmvkhlhyaslcseaqlpyhaffndplskffikrneiadftpylgal Protein sequence 4 >protein sequence4 300aa of the total length 2249aa mafhwcdnnlhttvftprdfqvellatayerntiiclghrsskefialkl lqelsrrarrhgrvsvylscevgtstepcsiytmlthltdlrvwqeqpdm qipfdhcwtdyhvsilrpegflylletrelllssvelivledchdsavyq rirplfenhimpappadrprilglagplhsagcelqqlsamlatleqsvl cqietasdivtvlrycsrpheyivqcapfemdelslvladvlnthksfll dhrydpyeiygtdqfmdelkdipdpkvdplnvinsllvvlhemgpwctqr Protein sequence5 >protein sequence5 416aa maeeqgrerdsvpkpsvlflhpdlgvggaerlvldaalalqargcsvkiw tahydpghcfaesrelpvrcagdwlprglgwggrgaavcayvrmvflaly vlfladeefdvvvcdqvsacipvfrlarrrkkilfychfpdllltkrdsf lkrlyrapidwieeyttgmadcilvnsqftaavfketfkslshidpdvly pslnvtsfdsvvpeklddlvpkgkkflllsinryerkknltlalealvql rgrltsqdwervhlivaggydervlenvehyqelkkmvqqsdlgqyvtfl rsfsdkqkisllhsctcvlytpsnehfgivpleamymqcpviavnsggpl esidhsvtgflcepdpvhfseaiekfirepslkatmglagrarvkekfsp eafteqlyryvtkllv Protein sequence6 >protein sequence6 193aa mgvhecpawlwlllsllslplglpvlgapprlicdsrvlqrylleakeae nittgcaehcslnenitvpdtkvnfyawkrmevgqqavevwqglallsea vlrgqallvnssqpweplqlhvdkavsglrslttllralgaqkeaisppd aasaaplrtitadtfrklfrvysnflrgklklytgeacrtgdr Protein sequence7 >protein sequence7 387aa msdgeedqtaivcdngsglvksgfagddapravfpsivgrprhqgvmvgm gqkdsyvgdeaqskrgiltlkypiehgiitnwddmekiwhhtmynelrva peehptllteaphnpkanrekmtqimfetfnvpamyvaiqavlslyasgr ttgivmdagdgvshnvpiyegyalphaiarldlagrdltdylmkilterg ysfvttaereivrdikeklcyvaldfeqemataasstsleksyelpdgqv itignerfrcpetlfqpsfigmesagihettynsimkcdidirkdlyann vlsggttmypgiadrmqkeitalapstmkikiiapperkysvwiggsila slstfqqmwiskqeydeagpsivhrkcf Protein sequence8...
View Full Document

Page1 / 6

Lab7 Bioinformatics problem sets student_1 - File of...

This preview shows document pages 1 - 3. Sign up to view the full document.

View Full Document Right Arrow Icon
Ask a homework question - tutors are online