Tutorial 1 - BCH210 Friday Tutorial Week One Dave Tulumello

Info iconThis preview shows pages 1–11. Sign up to view the full content.

View Full Document Right Arrow Icon
BCH210 Friday Tutorial Week One Dave Tulumello david.tulumello@utoronto.ca
Background image of page 1

Info iconThis preview has intentionally blurred sections. Sign up to view the full version.

View Full DocumentRight Arrow Icon
BCH210 Course Format Three lectures, one tutorial a week Two midterms, one final exam Multiple choice and short answer First midterm is M/C only Responsible for all lecture material No specific textbook needed, but recommended that you get one Keep up with lectures/ tutorials
Background image of page 2
BCH210 Help Tutorial Help Sessions: Tuesday 11-1pm Tanz6 11-1pm Thursday 1-3pm Fitzgerald 103 Friday 11-1pm Convocation Hall Slides posted the night before tutorials Website: http://www.biochemistry.utoronto.ca/undergraduates/courses/BCH210H/index.ht ml All lecture slides posted in advance Electronic Tutorial / Discussion Board: https://portal.utoronto.ca/ Logon using your UTORID (email log-on and pass) Email: david.tulumello@utoronto.ca Please include BCH210 in subject line for any emails Course Coordinator: Dr. Andreopoulos ( s.anderopoulos@utoronto.ca ) Office Hours: Tues/Thur/Fri 8:30-10am MSB 5221
Background image of page 3

Info iconThis preview has intentionally blurred sections. Sign up to view the full version.

View Full DocumentRight Arrow Icon
Tutorial Outline Friday 11-1pm Convocation Hall TAs will be rotating First three weeks : David Tulumello: david.tulumello@utoronto.ca Will review lecture material from past three week Slides will be posted night before tutorial on blackboard Please ask questions!
Background image of page 4
BCH210 Week 1 Introduction to proteins Amino acids Ionizable groups (pKa) Forces stabilizing proteins Protein composition and conformation
Background image of page 5

Info iconThis preview has intentionally blurred sections. Sign up to view the full version.

View Full DocumentRight Arrow Icon
Biochemisty Study of the chemicals of life The central dogma: DNA RNA Protein Information Action
Background image of page 6
CHEMISTRY -CH 3 Methyl
Background image of page 7

Info iconThis preview has intentionally blurred sections. Sign up to view the full version.

View Full DocumentRight Arrow Icon
Introduction to Proteins 20 building blocks: ACDEFGHIKLMNPQRSTVWY Used to construct proteins: MVHLTPEEKSAVTALWGKVNVDEVGGEALGRLLV… Structure: Function:
Background image of page 8
Amino Acids General Amino Acid: C + H 3 N C O O - H R Relevant properties of amino acids: Sterochemistry of amino acids (D- and L-) Chemical structure of R-groups Hydrophobicity of R-groups pKa’s of ionizable groups (COOH, D, E, H, C, Y, K, R, NH2)
Background image of page 9

Info iconThis preview has intentionally blurred sections. Sign up to view the full version.

View Full DocumentRight Arrow Icon
Stereochemistry of Amino Acids Amino acids are chiral Two enantiomers L-Amino acids D-Amino acids L isoform is much more common Fischer Projection “CORN” rule H pointing towards viewer Spells out Co-R-N clockwise
Background image of page 10
Image of page 11
This is the end of the preview. Sign up to access the rest of the document.

This note was uploaded on 11/23/2010 for the course BCH BCH210 taught by Professor Deber during the Fall '08 term at University of Toronto- Toronto.

Page1 / 44

Tutorial 1 - BCH210 Friday Tutorial Week One Dave Tulumello

This preview shows document pages 1 - 11. Sign up to view the full document.

View Full Document Right Arrow Icon
Ask a homework question - tutors are online